Q9NTU4 CTSRZ_HUMAN

Gene name: CATSPERZ
Protein name: Cation channel sperm-associated protein subunit zeta

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell differentiation GO:0030154
- developmental maturation GO:0021700
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UJZ1 STOML2 0.82322 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q16656 NRF1 0.7305 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
generation of precursor metabolites and energy GO:0006091
3 Q9Y216 MTMR7 0.71977 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
4 Q86UK0 ABCA12 0.70467 anatomical structure development GO:0048856
cell differentiation GO:0030154
homeostatic process GO:0042592
...
5 Q6V1P9 DCHS2 0.68895 cell adhesion GO:0007155
6 Q13886 KLF9 0.68026 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
7 Q92805 GOLGA1 0.67971
8 P49281 SLC11A2 0.67906 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
9 Q9H8W4 PLEKHF2 0.67439 protein transport GO:0015031
transport GO:0006810
10 P81133 SIM1 0.64859 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD..........................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDD.........
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDDDDDDDDDDDDDDDDDD......................
RICH_[D]:                             DrqgsDeesvhsDtrD                                                                       
RICH_[E]:                                                                                                   EEldEhalvE       
RICH_[S]:                     SkvSlkSSdrqgSdeeSvhS                                                                           
RICH_[DS]:                          SSDrqgSDeeSvhSD                                                                          
RICH_[KS]:                  KpSKvSlKSS                                                                                       
RICH_[LT]:                                         TrdLwTTTTLsqaqLnmpL                                                       
RICH_fLPS_[T]:                                    dTrdlwTTTT                                                                 
RICH_MOBI_[D]:                        DrqgsDeesvhsDtrD                                                                       
RICH_MOBI_[DS]:                     SSDrqgSDeeSvhSD                                                                          
RICH_MOBI_[KS]:             KpSKvSlKSS                                                                                       

                                          120                 140                 160                 180
AA:                      SMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
STMI:                                                                                                                        
DO_DISOPRED3:            .DDDDDDDDDDDDDDDDDDDDDDDD....................................................................DDDDDDD
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................DDDDDDDDDD
CONSENSUS:               .DDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................DDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[S]:                            SqieaekSSSmSS