Q9NUB4 CT141_HUMAN
Gene name: C20orf141
Protein name: Uncharacterized protein C20orf141
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H4L4 | SENP3 | 0.80787 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ribosome biogenesis GO:0042254 |
| 2 | Q9H427 | KCNK15 | 0.80323 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | O60512 | B4GALT3 | 0.80318 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | O00160 | MYO1F | 0.77029 | cytoskeleton organization GO:0007010 cytoskeleton-dependent intracellular transport GO:0030705 transport GO:0006810 |
| 5 | Q5JR98 | TCTEX1D4 | 0.74904 | |
| 6 | Q9BUH6 | PAXX | 0.74807 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 7 | Q96S06 | LMF1 | 0.74631 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 protein maturation GO:0051604 ... |
| 8 | O60304 | ZNF500 | 0.74507 | |
| 9 | Q8TDC3 | BRSK1 | 0.74471 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 10 | Q2M2I3 | FAM83E | 0.74322 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MTRLCLPRPEAREDPIPVPPRGLGAGEGSGSPVRPPVSTWGPSWAQLLDSVLWLGALGLTIQAVFSTTGPALLLLLVSFLTFDLLHRPAGHTLPQRKLLT STMI: DO_DISOPRED3: DDDDDD.D................D...D....................................................................... DO_IUPRED2A: ...DD.D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................DDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................DDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................DDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[PR]: RlclPRPeaRedPiPvPPR RICH_[P]: PrPearedPiPvPP RICH_[R]: RlclpRpeaRedpipvppR RICH_[GP]: PearedPiPvPPrGlGaGeGsGsPvrPP RICH_MOBI_[PR]: RlclPRPeaRedPiPvPPR RICH_MOBI_[P]: PrPearedPiPvPP RICH_MOBI_[R]: RlclpRpeaRedpipvppR RICH_MOBI_[GP]: PvPPrGlGaGeGsGsPvrPP RICH_fLPS_MOBI_[G]: rGlGaGeGsG
120 140 160 AA: RGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLLRACGMPLTLLGLAFCLHPWA STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...DDDDDDDD...................................................... DO_IUPRED2A: DDDDDDD..DDDD.................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD............................................. CONSENSUS: DDDDDDDDDDDDD..................... .......... CONSENSUS_MOBI: .................................. .......... RICH_[G]: GqsqGaGeGpG RICH_[GQ]: GQsQGaGeGpGQ RICH_fLPS_[G]: GqsqGaGeGpG