Q9NVV2 CS073_HUMAN

Gene name: C19orf73
Protein name: Putative uncharacterized protein C19orf73

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NCQ9 RNF222 0.86334
2 Q8TEM1 NUP210 0.85332 biological process involved in symbiotic interaction GO:0044403
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
3 Q9NSE2 CISH 0.83247 cellular protein modification process GO:0006464
growth GO:0040007
signal transduction GO:0007165
4 Q6P1J9 CDC73 0.81552 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 A0A0U1RQS6 TMEM275 0.79715
6 Q5UAW9 GPR157 0.79169 anatomical structure development GO:0048856
cell differentiation GO:0030154
homeostatic process GO:0042592
...
7 A6NHQ4 EPOP 0.78456 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 P80365 HSD11B2 0.78118 biosynthetic process GO:0009058
circulatory system process GO:0003013
reproduction GO:0000003
...
9 O95466 FMNL1 0.77541 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cytoskeleton organization GO:0007010
10 Q9Y278 HS3ST2 0.77056 biosynthetic process GO:0009058

                                           20                  40                  60                  80                 100
AA:                      MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD.DDDD........................DDD..DDDDDDDDDD....................................................
DO_IUPRED2A:             .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          .................................DDDDDDDDDDDDDDDDDDDDDDDD...........................................
RICH_[PR]:                                                              PPatPtqtvvRPagfPRRtR                                 
RICH_[PT]:                                                             PPPaTPTqTvvrPagfPrrT                                  
RICH_[AP]:                                             APhsAPlrPPrelhAAPPPAtP                                                
RICH_[RT]:                                                                 TpTqTvvRpagfpRRTR                                 
RICH_[P]:                                               PhsaPlrPPrelhaaPPPatPtqtvvrP                                         
RICH_[R]:                                                                         RpagfpRRtRlmvRsapptqR                      
RICH_[T]:                                                                  TpTqTvvrpagfprrT                                  
RICH_MOBI_[AP]:                                            APlrPPrelhAAPPPAtP                                                
RICH_MOBI_[P]:                                              PlrPPrelhaaPPPatP                                                

                                          120           
AA:                      LLRVGSVVLSSAPALRPRLGPCLRPPPSD
STMI:                                                 
DO_DISOPRED3:            ................DDDDDDDDDDDDD
DO_IUPRED2A:             ...............DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...............DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................