Q9NWQ9 CN119_HUMAN
Gene name: C14orf119
Protein name: Uncharacterized protein C14orf119
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P00540 | MOS | 0.73422 | cell cycle GO:0007049 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 2 | Q6ZRC1 | C4orf50 | 0.67873 | |
| 3 | Q99567 | NUP88 | 0.67723 | biological process involved in symbiotic interaction GO:0044403 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
| 4 | Q8TDS5 | OXER1 | 0.67448 | signal transduction GO:0007165 |
| 5 | Q13608 | PEX6 | 0.63221 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 6 | Q00973 | B4GALNT1 | 0.63118 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q6AI12 | ANKRD40 | 0.59422 | |
| 8 | Q12918 | KLRB1 | 0.57279 | immune system process GO:0002376 signal transduction GO:0007165 |
| 9 | Q14765 | STAT4 | 0.56777 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9ULS6 | KCNS2 | 0.56611 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: ..................D........DDDD..................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[PS]: PleSSSSmPlSfPSllPSvP RICH_[P]: PlsfPsllPsvPhntnPsP RICH_[S]: SSSSmplSfpSllpS RICH_[LP]: PLessssmPLsfPsLLPsvP RICH_[LS]: LeSSSSmpLSfpSLLpS RICH_[MS]: MpleSSSSMplSfpS
120 AA: QWFRGWAEQERNEFVRQLEFSEPDFVAKFYQAVAATAGKD STMI: DO_DISOPRED3: ....................................DDDD DO_IUPRED2A: ........................................ DO_SPOTD: ...................................DDDDD CONSENSUS: ....................................DDDD CONSENSUS_MOBI: ........................................