Q9NX09 DDIT4_HUMAN

Gene name: DDIT4
Protein name: DNA damage-inducible transcript 4 protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y5K3 PCYT1B 0.76659 anatomical structure development GO:0048856
biosynthetic process GO:0009058
reproduction GO:0000003
2 Q17RH7 TPRXL 0.75842
3 Q8N1I0 DOCK4 0.75088 circulatory system process GO:0003013
signal transduction GO:0007165
4 Q9UGV2 NDRG3 0.74633 cell differentiation GO:0030154
growth GO:0040007
reproduction GO:0000003
...
5 O15075 DCLK1 0.74587 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
6 P0DO97 CCDC192 0.73635
7 Q16512 PKN1 0.7313 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q9H6S0 YTHDC2 0.72695 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
9 Q7Z309 FAM122B 0.72304
10 A6NI28 ARHGAP42 0.72111 circulatory system process GO:0003013
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
DO_IUPRED2A:             ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDD..............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
RICH_[PR]:                                   PRtPtPdRPPRsawgsatR                                                             
RICH_[PS]:                       SSSStSSSPSSlPrtPtPdrPPrS                                                                    
RICH_[P]:                                PsslPrtPtPdrPP                                                                      
RICH_[R]:                                     RtptpdRppRsawgsatR                                                             
RICH_[S]:                  SlwdrfSSSStSSSpSSlprtptpdrpprS             StSleSSdceSldSSnS                                      
RICH_[DS]:                                                          DrStSleSSDceSlD                                          
RICH_[ES]:                                                      EEgfdrStSlESSdcESldS                                         
RICH_fLPS_[S]:           mpSlwdrfSSSStSSSpSSl                         StSleSSdceSldSS                                        
RICH_MOBI_[PR]:                               RtPtPdRPPR                                                                     
RICH_MOBI_[PS]:                    SStSSSPSSlPrtPtPdrPPrS                                                                    
RICH_MOBI_[P]:                           PsslPrtPtPdrPP                                                                      
RICH_MOBI_[R]:                                RtptpdRppRsawgsatR                                                             
RICH_MOBI_[S]:             SlwdrfSSSStSSSpSS                          StSleSSdceSldSSnS                                      
RICH_MOBI_[DS]:                                                     DrStSleSSDceSlD                                          
RICH_MOBI_[ES]:                                                 EEgfdrStSlESSdcESldS                                         
RICH_fLPS_MOBI_[S]:      mpSlwdrfSSSStSSSpSSl                                                                                

                                          120                 140                 160                 180                 200
AA:                      QESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPF
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220        
AA:                      LPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
STMI:                                                    
DO_DISOPRED3:            ................................
DO_IUPRED2A:             ................................
DO_SPOTD:                ................................
CONSENSUS:               ................................
CONSENSUS_MOBI:          ......................DDDD......