Q9NXH3 PP14D_HUMAN

Gene name: PPP1R14D
Protein name: Protein phosphatase 1 regulatory subunit 14D

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6UX41 BTNL8 0.77626 immune system process GO:0002376
signal transduction GO:0007165
2 Q14246 ADGRE1 0.77005 cell adhesion GO:0007155
immune system process GO:0002376
signal transduction GO:0007165
3 Q9NPH3 IL1RAP 0.76858 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
4 Q02156 PRKCE 0.76319 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cell adhesion GO:0007155
...
5 Q9P1A2 PPP4R1L 0.76159 cellular protein modification process GO:0006464
6 P30556 AGTR1 0.75388 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
7 Q13158 FADD 0.75065 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
8 O15457 MSH4 0.74844 anatomical structure development GO:0048856
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
9 O15075 DCLK1 0.74768 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
10 Q5H9J9 TCP11X2 0.73789 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...

                                           20                  40                  60                  80                 100
AA:                      MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEAL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD.DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
RICH_[PS]:                 SSSPaSctSPSPdgenP                                                                                 
RICH_[S]:                  SSSpaSctSpS             SgrrrtSStdSeSkShpdSSkiprSrrpS                                             
RICH_[CP]:                    PasCtsPsPdgenPC                                                                                
RICH_[CS]:                 SSSpaSCtSpSpdgenpC                                                                                
RICH_MOBI_[RS]:                                              SeSkShpdSSkipRSRRpSR                                            
RICH_MOBI_[C]:                   CtspspdgenpC                                                                                
RICH_MOBI_[S]:             SSSpaSctSpS             SgrrrtSStdSeSkShpdSS                                                      
RICH_MOBI_[CS]:            SSSpaSCtSpSpdgenpC                                                                                

                                          120                 140               
AA:                      MDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
STMI:                                                                 
DO_DISOPRED3:            ..........................................DDD
DO_IUPRED2A:             DDDD.D.D.DDDDDDDDDD......................D..D
DO_SPOTD:                ......................................DDDDDDD
CONSENSUS:               .........................................DDDD
CONSENSUS_MOBI:          .............................................