Q9NY25 CLC5A_HUMAN
Gene name: CLEC5A
Protein name: C-type lectin domain family 5 member A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96IQ7 | VSIG2 | 0.91791 | |
| 2 | P06028 | GYPB | 0.79083 | immune system process GO:0002376 |
| 3 | Q86VL8 | SLC47A2 | 0.75472 | transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q9NP60 | IL1RAPL2 | 0.72542 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 5 | O95292 | VAPB | 0.70212 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 homeostatic process GO:0042592 ... |
| 6 | Q8IZV2 | CMTM8 | 0.69537 | anatomical structure development GO:0048856 |
| 7 | Q9UPC5 | GPR34 | 0.67914 | signal transduction GO:0007165 |
| 8 | Q9H8K7 | PAAT | 0.67146 | |
| 9 | Q5T7R7 | C1orf185 | 0.66949 | |
| 10 | P03999 | OPN1SW | 0.66139 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
20 40 60 80 100 AA: MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCK STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS: .... DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................ CONSENSUS_MOBI: .... ......................................................................... RICH_[S]: SygtvSqifgSSSpS RICH_[ST]: TTTrSygTvSqifgSSSpS RICH_[NT]: NksNdgfTTT
120 140 160 180 AA: GKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK STMI: DO_DISOPRED3: .......................................................................................D DO_IUPRED2A: ........................................................................................ DO_SPOTD: ......................................................................................DD CONSENSUS: .......................................................................................D CONSENSUS_MOBI: ........................................................................................