Q9NY26 S39A1_HUMAN
Gene name: SLC39A1
Protein name: Zinc transporter ZIP1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O43292 | GPAA1 | 0.84422 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 2 | Q9BXL8 | CDCA4 | 0.80178 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 3 | P14373 | TRIM27 | 0.74405 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 4 | Q96RP8 | KCNA7 | 0.73007 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 5 | Q96DH6 | MSI2 | 0.71846 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | P46108 | CRK | 0.67896 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 7 | P0DMV8 | HSPA1A | 0.67407 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q9UPM9 | B9D1 | 0.66718 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q9UM00 | TMCO1 | 0.66718 | homeostatic process GO:0042592 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 10 | Q66K79 | CPZ | 0.66718 | cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
20 40 60 80 100 AA: MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEAL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD......................D.DDDDDDDDD......D....................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDD........D.DDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDD....................................... CONSENSUS: DDDDDDDD........DDDDD......... DDD......D....... ........... CONSENSUS_MOBI: .............................. ................. ...........
120 140 160 180 200 AA: AALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................... DO_IUPRED2A: ...........................................................DDDDDDDD..D.............................. DO_SPOTD: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... CONSENSUS: .... ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..... CONSENSUS_MOBI: .... ...................................................... RICH_[G]: GtvnGGpqhwhdGpG RICH_[GH]: GtvnGGpqHwHdGpG RICH_[GP]: GGPqhwhdGPGvPqasGaP
220 240 260 280 300 AA: QRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ...... .......... .............. ....... CONSENSUS_MOBI: ...... .......... .............. .......
320 AA: QRILKVILLLAGFALLTGLLFIQI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................ DO_IUPRED2A: ........................ DO_SPOTD: ....................DDDD CONSENSUS: ... CONSENSUS_MOBI: ...