Q9NZ72 STMN3_HUMAN
Gene name: STMN3
Protein name: Stathmin-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cytoskeleton organization GO:0007010
- embryo development GO:0009790
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P12757 | SKIL | 0.7482 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | Q53EZ4 | CEP55 | 0.74037 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell division GO:0051301 ... |
| 3 | Q9H7T9 | AUNIP | 0.73049 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 cytoskeleton organization GO:0007010 ... |
| 4 | Q96RE9 | ZNF300 | 0.66409 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9Y2F9 | BTBD3 | 0.62977 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
| 6 | Q9NXZ1 | SAGE1 | 0.59705 | cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q5QGS0 | NEXMIF | 0.57531 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 |
| 8 | O60861 | GAS7 | 0.57219 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
| 9 | O60765 | ZNF354A | 0.5709 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nervous system process GO:0050877 |
| 10 | Q9NYS7 | WSB2 | 0.55793 |
20 40 60 80 100 AA: MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQE STMI: DO_DISOPRED3: DDDD.............................................................DDDDDDDDDDDDD...................... DO_IUPRED2A: ...................................DDDDDDD.............DDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDD.............................................................DDDDDDDDDDDDDDD..................... CONSENSUS: DDD.............................................................DDDDDDDDDDDDDDD..................... CONSENSUS_MOBI: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDD.................. RICH_MOBI_[PS]: PSdlSPeSPmlSSPP RICH_MOBI_[K]: KspsdlspespmlssppKKK RICH_MOBI_[S]: SpSdlSpeSpmlSS RICH_MOBI_[KS]: KSpSdlSpeSpmlSSppKKK
120 140 160 AA: AQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG STMI: DO_DISOPRED3: ............................D..D.DDD....................................DDDDDDDD DO_IUPRED2A: DDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDD.DDDDD...D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..............................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ............................DDDDDDDD..........................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................................ RICH_[ER]: EvRRnkEqREE