Q9NZY2 FA30A_HUMAN
Gene name: FAM30A
Protein name: Putative uncharacterized protein FAM30A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96A44 | SPSB4 | 0.95294 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 2 | Q96IC2 | REXO5 | 0.90001 | |
| 3 | Q9Y5U5 | TNFRSF18 | 0.80408 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 4 | Q14166 | TTLL12 | 0.79493 | cell cycle GO:0007049 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 5 | P19086 | GNAZ | 0.79218 | protein folding GO:0006457 signal transduction GO:0007165 |
| 6 | Q7L8S5 | OTUD6A | 0.78314 | cellular protein modification process GO:0006464 |
| 7 | Q6ZUL3 | C8orf86 | 0.75691 | |
| 8 | Q9NQR7 | CCDC177 | 0.75568 | |
| 9 | P35610 | SOAT1 | 0.74535 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 10 | P24046 | GABRR1 | 0.74404 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MGTLQGAALRSRERPSWPQETHGHRERTEEGCAVAAFSADALRTGGQELEQTGLRPKAGAPPMPDLLGHRICTDIGKGWRMDGGRTCSCSSFCRCPERGA STMI: DO_DISOPRED3: DDDDDDDDDDDDD...DDD................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDD.DDD...............DDDDDDDDDDDDDDDD....................................... DO_SPOTD: DDDDDDDDDDDDDDDD.DDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDD....................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... RICH_[R]: RsReRpswpqethghReR RICH_[EH]: EtHgHrErtEE RICH_[ER]: RsRERpswpqEthghRERtEE RICH_MOBI_[R]: RsReRpswpqethghReR RICH_MOBI_[ER]: RsRERpswpqEthghRERtEE
120 AA: RRSSPDAPGLALDFPLLLDLLWHLCSWTSQPLEL STMI: DO_DISOPRED3: .................................. DO_IUPRED2A: ....DD............................ DO_SPOTD: DDDDDDDDDD......................DD CONSENSUS: ....DD............................ CONSENSUS_MOBI: ..................................