Q9P0U1 TOM7_HUMAN
Gene name: TOMM7
Protein name: Mitochondrial import receptor subunit TOM7 homolog
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG STMI: MMMMMMMMMMMMMMMM DO_DISOPRED3: DD..................................................... DO_IUPRED2A: ....................................................... DO_SPOTD: DDDDD.................................................. CONSENSUS: DD.................. ................... CONSENSUS_MOBI: .................... ...................