Q9UBF6 RBX2_HUMAN
Gene name: RNF7
Protein name: RING-box protein 2
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6DCA0 | AMMECR1L | 0.85688 | |
| 2 | Q96EY1 | DNAJA3 | 0.81032 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q9BZY9 | TRIM31 | 0.80566 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q9H222 | ABCG5 | 0.73671 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P62508 | ESRRG | 0.72439 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 6 | Q9UK96 | FBXO10 | 0.71818 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 7 | Q2M2I5 | KRT24 | 0.71508 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 8 | Q9UPE1 | SRPK3 | 0.71053 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q4ADV7 | RIC1 | 0.70813 | anatomical structure development GO:0048856 catabolic process GO:0009056 extracellular matrix organization GO:0030198 ... |
| 10 | Q5VVW2 | GARNL3 | 0.70807 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... RICH_[S]: ShSgSSgSkS RICH_[GS]: GeetcalaShSGSSGSkSGG RICH_MOBI_[S]: ShSgSSgSkS RICH_MOBI_[GS]: GeetcalaShSGSSGSkSGG
AA: LCQQDWVVQRIGK STMI: DO_DISOPRED3: ............. DO_IUPRED2A: ............. DO_SPOTD: ............D CONSENSUS: ............. CONSENSUS_MOBI: .............