Q9UBF6 RBX2_HUMAN

Gene name: RNF7
Protein name: RING-box protein 2

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6DCA0 AMMECR1L 0.85688
2 Q96EY1 DNAJA3 0.81032 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q9BZY9 TRIM31 0.80566 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
4 Q9H222 ABCG5 0.73671 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
5 P62508 ESRRG 0.72439 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
6 Q9UK96 FBXO10 0.71818 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
7 Q2M2I5 KRT24 0.71508 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
8 Q9UPE1 SRPK3 0.71053 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 Q4ADV7 RIC1 0.70813 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
10 Q5VVW2 GARNL3 0.70807 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
RICH_[S]:                              ShSgSSgSkS                                                                            
RICH_[GS]:                     GeetcalaShSGSSGSkSGG                                                                          
RICH_MOBI_[S]:                         ShSgSSgSkS                                                                            
RICH_MOBI_[GS]:                GeetcalaShSGSSGSkSGG                                                                          

                                
AA:                      LCQQDWVVQRIGK
STMI:                                 
DO_DISOPRED3:            .............
DO_IUPRED2A:             .............
DO_SPOTD:                ............D
CONSENSUS:               .............
CONSENSUS_MOBI:          .............