Q9UBP8 KAAG1_HUMAN

Gene name: KAAG1
Protein name: Kidney-associated antigen 1

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O43488 AKR7A2 0.84446 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
2 Q6UX72 B3GNT9 0.81281 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
3 P55107 GDF10 0.7961 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
4 Q8N9Z2 CCDC71L 0.79334 cell differentiation GO:0030154
5 O75676 RPS6KA4 0.79076 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q1W6H9 FAM110C 0.78276 cellular component assembly GO:0022607
signal transduction GO:0007165
7 Q6SPF0 SAMD1 0.78131 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 C9J069 AJM1 0.77305 cell junction organization GO:0034330
9 Q9HBU6 ETNK1 0.77295 biosynthetic process GO:0009058
10 Q9NSI2 FAM207A 0.76497 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254

                                           20                  40                  60                  80                
AA:                      MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
STMI:                                                                                                        
DO_DISOPRED3:            DDDDDDD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                      RwPPPqlaasRReaPPlsqR                         
RICH_[AP]:                                           AgPgAAAAhlPrwPPPqlAAsrreAPP                             
RICH_[AR]:                                                             AAsRReApplsqRphRtqgA                  
RICH_[AV]:                   AAprVegVpVAVhkhA                                                                
RICH_[A]:                                   AlhdglrqvAgpgAAAA                                                
RICH_[P]:                                                      PrwPPPqlaasrreaPP                             
RICH_[R]:                                                       RwpppqlaasRReapplsqR                         
RICH_[V]:                        VegVpVaVhkhalhdglrqV                                                        
RICH_[DV]:                DDDaaprVegVpVaV                                                                    
RICH_[HV]:                       VegVpVaVHkHalH                                                              
RICH_fLPS_[A]:                                     qvAgpgAAAAhlprwpppqlAA                                    
RICH_fLPS_[V]:                 prVegVpVaV                                                                    
RICH_MOBI_[AP]:                                             AhlPrwPPPqlAAsrreAPP                             
RICH_MOBI_[AR]:                                                        AAsRReApplsqRphRtqgA                  
RICH_MOBI_[A]:                                           AAAAhlprwpppqlAAsrreA                               
RICH_MOBI_[P]:                                                 PrwPPPqlaasrreaPP                             
RICH_MOBI_[R]:                                                  RwpppqlaasRReapplsqR