Q9UBT3 DKK4_HUMAN
Gene name: DKK4
Protein name: Dickkopf-related protein 4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell-cell signaling GO:0007267
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZXV5 | TMTC3 | 0.77898 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 2 | A8MT65 | ZNF891 | 0.65641 | |
| 3 | O15519 | CFLAR | 0.64464 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 4 | O43933 | PEX1 | 0.60474 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 5 | O75330 | HMMR | 0.59869 | catabolic process GO:0009056 cell cycle GO:0007049 mitotic cell cycle GO:0000278 ... |
| 6 | O95340 | PAPSS2 | 0.59471 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q5K651 | SAMD9 | 0.58366 | membrane organization GO:0061024 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | Q8N2N9 | ANKRD36B | 0.58361 | |
| 9 | Q49AG3 | ZBED5 | 0.58354 | |
| 10 | Q02224 | CENPE | 0.5818 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell division GO:0051301 ... |
20 40 60 80 100 AA: MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPIL STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDD............DDDDDDDDDDD............................................................DDDD CONSENSUS: .......DDD........................................................................ CONSENSUS_MOBI: ..................................................................................
120 140 160 180 200 AA: ERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS_MOBI: ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. RICH_[K]: KrKpsiKKsqgrK RICH_[Q]: QenQpkrkpsikksQgrkgQ RICH_[GH]: GtHaeGttGH RICH_[KQ]: QenQpKrKpsiKKsQgrKgQ RICH_MOBI_[K]: KrKpsiKKsqgrK RICH_MOBI_[GH]: GtHaeGttGH
220 AA: LCRSQLTSNRQHARLRVCQKIEKL STMI: DO_DISOPRED3: ........................ DO_IUPRED2A: ........................ DO_SPOTD: ......DDDDDDD........DDD CONSENSUS: ........................ CONSENSUS_MOBI: ........................