Q9UBU3 GHRL_HUMAN

Gene name: GHRL
Protein name: Appetite-regulating hormone

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- cytoskeleton organization GO:0007010
- growth GO:0040007
- homeostatic process GO:0042592
- nervous system process GO:0050877
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P13196 ALAS1 0.72029 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q9BXU7 USP26 0.68694 catabolic process GO:0009056
cell cycle GO:0007049
cellular protein modification process GO:0006464
...
3 Q9UGI8 TES 0.6848 cell population proliferation GO:0008283
4 P54821 PRRX1 0.68132 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 P58215 LOXL3 0.66714 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
6 Q9NYK6 EURL 0.66356 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q99541 PLIN2 0.66119 transport GO:0006810
8 Q96AY2 EME1 0.65594 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9UGC6 RGS17 0.65521 signal transduction GO:0007165
10 Q5SSQ6 SAPCD1 0.65393

                                           20                  40                  60                  80                 100
AA:                      MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGK
STMI:                    SSSSSSSSSSSSSSSSSSSSSSS                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDD.DDD....D.DDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD.............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
CONSENSUS:                                      .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
CONSENSUS_MOBI:                                 .....DDDDDDDDDDDDDDDDDDDDDD..................................................
RICH_[AG]:                                                                  AlAGwlrpedGGqAeGA                                
RICH_[Q]:                                                QrvQQrkeskkppaklQ                                                   
RICH_[EG]:                                                                          EdGGqaEGaE                               
RICH_[KQ]:                                               QrvQQrKesKKppaKlQ                                                   
RICH_MOBI_[Q]:                                           QrvQQrkeskkppaklQ                                                   
RICH_MOBI_[KQ]:                                          QrvQQrKesKKppaKlQ                                                   

                            
AA:                      FLQDILWEEAKEAPADK
STMI:                                     
DO_DISOPRED3:            .........DDDDDDDD
DO_IUPRED2A:             ............D..DD
DO_SPOTD:                ..........DDDDDDD
CONSENSUS:               ..........DDDDDDD
CONSENSUS_MOBI:          .................