Q9UBY9 HSPB7_HUMAN

Gene name: HSPB7
Protein name: Heat shock protein beta-7

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- circulatory system process GO:0003013
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P25103 TACR1 0.92034 homeostatic process GO:0042592
reproduction GO:0000003
response to stress GO:0006950
...
2 Q03167 TGFBR3 0.80662 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 Q495N2 SLC36A3 0.79472 transmembrane transport GO:0055085
transport GO:0006810
4 O43462 MBTPS2 0.77403 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 Q96CX6 LRRC58 0.77078 signal transduction GO:0007165
6 Q9NYV6 RRN3 0.75571 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
7 Q9NXV6 CDKN2AIP 0.75558 growth GO:0040007
response to stress GO:0006950
signal transduction GO:0007165
8 P57768 SNX16 0.75012 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
...
9 O15195 VILL 0.75005 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
10 P05787 KRT8 0.74981 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...

                                           20                  40                  60                  80                 100
AA:                      MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD........................................................
DO_IUPRED2A:             DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDD...........................DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDD.............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDD.............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
RICH_[AS]:                                         SSSASrAlpA                                                                
RICH_[S]:                 ShrtSStfraerSfhSSSSSSSSStSSSaS                                                                     
RICH_[FS]:                    SStFraerSFhSSSSSSS                                                                             
RICH_fLPS_[S]:                      erSfhSSSSSSSSStSSSaS                                                                     
RICH_MOBI_[AS]:                                    SSSASrAlpA                                                                
RICH_MOBI_[S]:            ShrtSStfraerSfhSSSSSSSSStSSSaS                                                                     
RICH_MOBI_[FS]:           ShrtSStFraerSFhSSSSSSSSStSS                                                                        
RICH_fLPS_MOBI_[S]:                 erSfhSSSSSSSSStSSSaS                                                                     

                                          120                 140                 160          
AA:                      SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
STMI:                                                                                          
DO_DISOPRED3:            ..............................................................DDD.....
DO_IUPRED2A:             DDD...DDDDD............DDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
DO_SPOTD:                .......................................................DDDDDDDDDDDDDDD
CONSENSUS:               .......................................................DDDDDDDDDDD....
CONSENSUS_MOBI:          ......................................................................