Q9UGL9 CRCT1_HUMAN

Gene name: CRCT1
Protein name: Cysteine-rich C-terminal protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H7T3 C10orf95 0.53567
2 Q9UHD8 SEPTIN9 0.5034 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
3 Q9UKP6 UTS2R 0.50152 circulatory system process GO:0003013
signal transduction GO:0007165
4 Q5T7P3 LCE1B 0.49825 anatomical structure development GO:0048856
cell differentiation GO:0030154
5 Q2TAK8 PWWP3A 0.49808 cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
DNA metabolic process GO:0006259
...
6 Q5T753 LCE1E 0.48575 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q96MR7 OBSCN-AS1 0.48072
8 Q9NRR6 INPP5E 0.47853 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
9 Q5TA76 LCE3A 0.47788 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
10 Q9H0D2 ZNF541 0.47742 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003

                                           20                  40                  60                  80 
AA:                      MSSQQSAVSAKGFSKGSSQGPAPCPAPAPTPAPASSSSCCGSGRGCCGDSGCCGSSSTSCCCFPRRRRRQRSSGCCCCGGGSQRSQRSNNRSSGCCSGC
STMI:                                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDD......................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                        AkgfskgssqgPAPcPAPAPtPAP                                                                  
RICH_[P]:                                    PaPcPaPaPtPaP                                                                  
RICH_[S]:                 SSqqSavSakgfSkgSS                                                                                 
RICH_[CN]:                                                                                                       NNrssgCCsgC
RICH_[CS]:                                                                                                   SqrSnnrSSgCCSgC
RICH_fLPS_[C]:                                                                                               sqrsnnrssgCCsgC
RICH_MOBI_[AC]:                               ApCpApAptpApAssssCC                                                           
RICH_MOBI_[AP]:                              PAPcPAPAPtPAPA                                                                 
RICH_MOBI_[A]:                                ApcpApAptpApA                                                                 
RICH_MOBI_[RS]:                                                                                             RSqRSnnRSS      
RICH_MOBI_[C]:                                                                                     CCCCgggsqrsqrsnnrssgCC   
RICH_MOBI_[P]:                               PaPcPaPaPtPaP                                                                  
RICH_MOBI_[R]:                                                                           RRRRRqRssgccccgggsqRsqR            
RICH_MOBI_[CG]:                                                                                   GCCCCGGGsqrsqrsnnrssGCCsGC
RICH_MOBI_[CN]:                                                                                                  NNrssgCCsgC
RICH_MOBI_[CP]:                              PaPCPaPaPtPaPassssCC                                                           
RICH_MOBI_[CR]:                                                                          RRRRRqRssgCCCCgggsqRsqR            
RICH_MOBI_[CS]:                                                                                       CgggSqrSqrSnnrSSgCCSgC
RICH_MOBI_[GR]:                                                                          RRRRRqRssGccccGGGsqRsqR            
RICH_MOBI_[GS]:                                                                                        GGGSqrSqrSnnrSSGccSG 
RICH_fLPS_MOBI_[R]:                                                                      RRRRRqRssgccccgggsqR               
RICH_fLPS_MOBI_[C]:                                                                      rrrrrqrssgCCCCgggsqrsqrsnnrssgCCsgC
RICH_fLPS_MOBI_[CR]:                                                                     RRRRRqRssgCCCCg