Q9UHA2 S18L2_HUMAN

Gene name: SS18L2
Protein name: SS18-like protein 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60   
AA:                      MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME
STMI:                                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................DDDDDDDDD
DO_IUPRED2A:             .......................................................................DDDDDD
DO_SPOTD:                DDDDDDDDDDDDD.....................................................DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD.......................................................DDDDDDDDD
CONSENSUS_MOBI:          .............................................................................