List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40     
AA:                      MESPKCLYSRITVNTAFGTKFSHISFIILFKVFLFPRITISKKTKLVTLSNYLNK
STMI:                                                                           
DO_DISOPRED3:            DD....................................................D
DO_IUPRED2A:             .......................................................
DO_SPOTD:                DDD.................................................DDD
CONSENSUS:               DD....................................................D
CONSENSUS_MOBI:          .......................................................