Q9UK33 ZN580_HUMAN

Gene name: ZNF580
Protein name: Zinc finger protein 580

List of terms from Generic GO subset, which this protein is a part of:
- cell population proliferation GO:0008283
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O43281 EFS 0.81473 cell adhesion GO:0007155
cytoskeleton organization GO:0007010
signal transduction GO:0007165
2 A6NGB9 WIPF3 0.77129 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
3 Q9P2A4 ABI3 0.75117
4 Q8TF74 WIPF2 0.75022 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
5 Q8TC26 TMEM163 0.74913 transmembrane transport GO:0055085
transport GO:0006810
6 A6NJJ6 C19orf67 0.74837
7 Q9H987 SYNPO2L 0.74741 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
8 Q9NZN9 AIPL1 0.7437 cell death GO:0008219
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
9 Q9BYE0 HES7 0.74291 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q8WXE0 CASKIN2 0.74232

                                           20                  40                  60                  80                 100
AA:                      MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................DDDDD................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
RICH_[PY]:                                                                            PYtYtvqleeePrgPPqreaP                  
RICH_[AP]:                                      PkAPPfPkAegPsstPssAAgP                                                       
RICH_[P]:                    PPrPPhPrsssPeamdPPPPkaPPfPkaegPsstP                                 PrgPPqreaPPgePgP            
RICH_[EP]:                                                                            PytytvqlEEEPrgPPqrEaPPgEPgP            
RICH_[EY]:                                                                             YtYtvqlEEEprgppqrE                    
RICH_[GP]:                                                                                       PrGPPqreaPPGePGPrkG         
RICH_[LP]:                LLLPPrPPhP                                                                                         
RICH_[LR]:                                                            RppRLgRhLL                                             
RICH_[LY]:                                                                LgrhLLidangvpYtYtvqL                               
RICH_fLPS_[P]:               PPrPPhPrsssPeamdPPPPkaPPfP                                          PrgPPqreaPPgePgP            
RICH_MOBI_[AP]:                                 PkAPPfPkAegPsstPssAA                                                         
RICH_MOBI_[L]:                                                            LgrhLLidangvpytytvqL                               
RICH_MOBI_[P]:               PPrPPhPrsssPeamdPPPPkaPPfPkaegPsstP                                 PrgPPqreaPPgePgP            
RICH_MOBI_[EP]:                                                                               EEEPrgPPqrEaPPgEPgP            
RICH_MOBI_[EY]:                                                                        YtYtvqlEEEprgppqrE                    
RICH_MOBI_[GP]:                                                                                  PrGPPqreaPPGePGPrkG         
RICH_MOBI_[LP]:           LLLPPrPPhPrsssP                                                                                    
RICH_MOBI_[LR]:                                                       RppRLgRhLL                                             
RICH_MOBI_[LY]:                                                           LgrhLLidangvpYtYtvqL                               
RICH_MOBI_[MP]:          MlllPPrPPhPrsssPeaM                                                                                 
RICH_fLPS_MOBI_[P]:          PPrPPhPrsssPeamdPPPPkaPPfP                                                                      

                                          120                 140                 160        
AA:                      FASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH
STMI:                                                                                            
DO_DISOPRED3:            ........................................................................
DO_IUPRED2A:             ....DD.DDDDDDD..................DDDDDDDDDDDDDDDD.DDD.............DDD.DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....DDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDD.............DDDDDDD
CONSENSUS_MOBI:          ........................................................................
RICH_[AR]:                                                   RhRAthRARA                          
RICH_[H]:                                                 HlsrHratHraragppH                      
RICH_[HR]:                                                HlsRHRatHRaRagppH