Q9UL46 PSME2_HUMAN
Gene name: PSME2
Protein name: Proteasome activator complex subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96D46 | NMD3 | 0.73652 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nucleocytoplasmic transport GO:0006913 ... |
| 2 | Q05513 | PRKCZ | 0.73217 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q92973 | TNPO1 | 0.67818 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 4 | P20645 | M6PR | 0.64044 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | Q96SY0 | INTS14 | 0.63898 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | P10523 | SAG | 0.63839 | signal transduction GO:0007165 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | P43627 | KIR2DL2 | 0.62892 | immune system process GO:0002376 |
| 8 | Q8N743 | KIR3DL3 | 0.62892 | |
| 9 | P43632 | KIR2DS4 | 0.62892 | immune system process GO:0002376 response to stress GO:0006950 |
| 10 | Q8N139 | ABCA6 | 0.62617 | transport GO:0006810 |
20 40 60 80 100 AA: MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKV STMI: DO_DISOPRED3: DDDDD..................................................................DDDDDDDDDDDDDD............... DO_IUPRED2A: .................................................................DDDDDDDDDDDDDDDDDD.D..DD........... DO_SPOTD: DDDDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............. CONSENSUS: DDDDD............................................................DDDDDDDDDDDDDDDDDDDD............... CONSENSUS_MOBI: .................................................................................................... RICH_[D]: DpppkDDemetD RICH_[DE]: DDEmEtDkqE RICH_[DI]: IpIpDpppkDD RICH_[DP]: PiPDPPPkDDemetD
120 140 160 180 200 AA: LSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYG STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: ELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY STMI: DO_DISOPRED3: .................................DDDDDD DO_IUPRED2A: ..................................D..DD DO_SPOTD: ..............................DDDDDDDDD CONSENSUS: .................................DDDDDD CONSENSUS_MOBI: .......................................