Q9ULZ0 T53G3_HUMAN

Gene name: TP53TG3
Protein name: TP53-target gene 3 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q99962 SH3GL2 0.82381 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 Q14195 DPYSL3 0.70391 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
3 Q9HBB8 CDHR5 0.7018 cell adhesion GO:0007155
cell differentiation GO:0030154
cellular component assembly GO:0022607
4 O43347 MSI1 0.64622 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
5 A0A1W2PS18 PMIS2 0.63906
6 Q96D59 RNF183 0.63603 cell death GO:0008219
cellular protein modification process GO:0006464
response to stress GO:0006950
...
7 O43316 PAX4 0.63072 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q7Z5P9 MUC19 0.62438 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
immune system process GO:0002376
...
9 Q9HCI5 MAGEE1 0.62323
10 Q96S90 LYSMD1 0.62224

                                           20                  40                  60                  80                 100
AA:                      MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDD.D.DDDDDDDDDDDDDDDDDDDDDDDDDDD...DD......................................................
DO_IUPRED2A:             ................DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDD.........
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................
RICH_[PT]:                                PsalrPTagsgPdTrTPgT                                                                
RICH_[AP]:                 AsPcisqPAAswhPrPsA                                                                                
RICH_[T]:                                       TagsgpdTrTpgT                                                                
RICH_[GP]:                                        GsGPdtrtPGtvedGsaPcP                                                       
RICH_[GT]:                                      TaGsGpdTrTpGTvedG                                                            
RICH_MOBI_[T]:                                  TagsgpdTrTpgT                                                                
RICH_MOBI_[GT]:                                 TaGsGpdTrTpGTvedG                                                            

                                          120        
AA:                      IPCRSTKGRWPLTASAAGLSRHAQCGPSLGLG
STMI:                                                    
DO_DISOPRED3:            ...............................D
DO_IUPRED2A:             .............D..................
DO_SPOTD:                ....DDDDDDD...DDDDDDDDDDDDDDDDDD
CONSENSUS:               ...............................D
CONSENSUS_MOBI:          ................................