Q9ULZ2 STAP1_HUMAN
Gene name: STAP1
Protein name: Signal-transducing adaptor protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- immune system process GO:0002376
- membrane organization GO:0061024
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9Y243 | AKT3 | 0.89443 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
2 | Q9GZL7 | WDR12 | 0.88492 |
cell cycle
GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
3 | Q0VD86 | INCA1 | 0.85166 |
cell cycle
GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
4 | P31749 | AKT1 | 0.8165 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
5 | A8MPS7 | YDJC | 0.81373 |
carbohydrate metabolic process
GO:0005975 |
6 | Q99965 | ADAM2 | 0.81373 |
cell adhesion
GO:0007155 membrane organization GO:0061024 nervous system process GO:0050877 ... |
7 | Q9Y487 | ATP6V0A2 | 0.81044 |
catabolic process
GO:0009056 homeostatic process GO:0042592 immune system process GO:0002376 ... |
8 | Q16342 | PDCD2 | 0.79436 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
9 | O96024 | B3GALT4 | 0.79262 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
10 | Q8TAF3 | WDR48 | 0.79162 |
anatomical structure development
GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell population proliferation GO:0008283 ... |
20 40 60 80 100
AA: MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQ
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A: DDDD................................................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDD..................................................................................
CONSENSUS: DDDDDDDDDDDDDDDDD...................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: LKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNM
STMI:
DO_DISOPRED3: ...........................................D..........D.DDDDDDD.....................................
DO_IUPRED2A: D..DD.........................................D.DDDDDDDDDDDDDDDDDDD......................DD.DDDDDDDD
DO_SPOTD: ............................................DDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS: ..............................................DDDDDDDDDDDDDDDDDDDDD.................................
CONSENSUS_MOBI: ..................................................................DDDD..............................
RICH_[E]: EtEqstsvEkEkEptE
220 240 260 280
AA: ILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA
STMI:
DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A: DDDD........D.....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD: .......................................................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: .......................................................................DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: .....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD