Q9UMY4 SNX12_HUMAN
Gene name: SNX12
Protein name: Sorting nexin-12
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- protein maturation GO:0051604
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UNH7 | SNX6 | 0.89443 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 2 | P43627 | KIR2DL2 | 0.88492 | immune system process GO:0002376 |
| 3 | Q8N743 | KIR3DL3 | 0.88492 | |
| 4 | Q14954 | KIR2DS1 | 0.88492 | immune system process GO:0002376 response to stress GO:0006950 |
| 5 | P17023 | ZNF19 | 0.87622 | |
| 6 | P07585 | DCN | 0.87416 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | P17987 | TCP1 | 0.83205 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | Q7LG56 | RRM2B | 0.79687 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 9 | P13010 | XRCC5 | 0.77348 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 10 | Q8N5C7 | DTWD1 | 0.77324 | cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: D..DDDDDDDDDDDDDDDD.D.D............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[D]: DtavaDtrrlnskpqDltD
120 140 160 AA: QLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA STMI: DO_DISOPRED3: .........................................................DDDDDDDDDDDDDDD DO_IUPRED2A: ........................................................................ DO_SPOTD: ....................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: .........................................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................