Q9UNK0 STX8_HUMAN
Gene name: STX8
Protein name: Syntaxin-8
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y243 | AKT3 | 0.89443 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 2 | Q96M32 | AK7 | 0.88492 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 3 | Q9GZL7 | WDR12 | 0.88492 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 4 | Q0VD86 | INCA1 | 0.85166 | cell cycle GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 5 | P31749 | AKT1 | 0.8165 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q99965 | ADAM2 | 0.81373 | cell adhesion GO:0007155 membrane organization GO:0061024 nervous system process GO:0050877 ... |
| 7 | A8MPS7 | YDJC | 0.81373 | carbohydrate metabolic process GO:0005975 |
| 8 | Q9Y487 | ATP6V0A2 | 0.81044 | catabolic process GO:0009056 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 9 | Q16342 | PDCD2 | 0.79436 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 10 | O96024 | B3GALT4 | 0.79262 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNE STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ..........................DDD.DDD.DD................................................................ DO_SPOTD: DD..........................DDDDDD.......................................DDDDDDD........DDDDDDDDDDDD CONSENSUS: D...........................DDDDD................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: GAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNE STMI: DO_DISOPRED3: ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: ....DDDDDDDDDD...DDDDDDDDD..D......DD...............................DDDDDDD........................D DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD..DDDDDDDDDDDD..DDDD.DDD..DD..D..DD..D..DD.......... CONSENSUS: ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................DDDDDD......................... CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EEakrgapnpwlfEEpEE
220 AA: TRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN STMI: MMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................D.D DO_IUPRED2A: DDDD................................ DO_SPOTD: .................................... CONSENSUS: ............... .... CONSENSUS_MOBI: ............... ....