Q9Y294 ASF1A_HUMAN
Gene name: ASF1A
Protein name: Histone chaperone ASF1A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P9F7 | LRRC8B | 0.94731 | response to stress GO:0006950 transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q16706 | MAN2A1 | 0.93695 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q9H159 | CDH19 | 0.93053 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | P51582 | P2RY4 | 0.78754 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 5 | Q9ULS6 | KCNS2 | 0.76363 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 6 | Q14849 | STARD3 | 0.75599 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 transport GO:0006810 ... |
| 7 | P13584 | CYP4B1 | 0.73239 | catabolic process GO:0009056 |
| 8 | Q92730 | RND1 | 0.72627 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 9 | Q8IZA0 | KIAA0319L | 0.69315 | biological process involved in symbiotic interaction GO:0044403 |
| 10 | Q9NYB5 | SLCO1C1 | 0.68842 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESH STMI: DO_DISOPRED3: ............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................DDDDDDDDDD....D.................D....DDDDDDDDDDDDDDDDDDD.........D....D.......... DO_SPOTD: .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................DDDDDDDDDDDDDDDDDDD......................... RICH_[L]: LqsLLstdaL RICH_[S]: SSnpnlqSllStdalpSaS RICH_[LS]: SSnpnLqSLLStdaLpSaS
AA: MDCM STMI: DO_DISOPRED3: DDDD DO_IUPRED2A: .... DO_SPOTD: DDDD CONSENSUS: DDDD CONSENSUS_MOBI: ....