List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q96HJ5	MS4A3	0.93809	cell cycle GO:0007049 immune system process GO:0002376 transport GO:0006810 ...
2	Q2M3M2	SLC5A9	0.88	transmembrane transport GO:0055085 transport GO:0006810
3	P48066	SLC6A11	0.85736	anatomical structure development GO:0048856 transport GO:0006810
4	Q96NY7	CLIC6	0.7541	transmembrane transport GO:0055085 transport GO:0006810
5	Q9NVC6	MED17	0.74649	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
6	Q99674	CGREF1	0.73404	cell adhesion GO:0007155 cell cycle GO:0007049 cell population proliferation GO:0008283
7	Q96C19	EFHD2	0.7163
8	Q9H9R9	DBNDD1	0.70137	cellular protein modification process GO:0006464
9	Q7Z7G2	CPLX4	0.68984	cell-cell signaling GO:0007267 nervous system process GO:0050877 transport GO:0006810 ...
10	Q9H2Y9	SLCO5A1	0.6678	transport GO:0006810

                                           20                  40                  60    
AA:                      MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS
STMI:                                                                                                
DO_DISOPRED3:            DDDDD..DDDD........DDDD....DDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             D.D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                                     AgdmgElAlEgAEgqvEgsA                  
RICH_[AG]:                                                     AGdmGelAleGAeGqveGsA                  
RICH_[D]:                         DfiscDrtgrrnavpDiqgD                                               
RICH_[EG]:                                                      GdmGElalEGaEGqvEGsapdkE              
RICH_MOBI_[AE]:                                                     ElAlEgAEgqvEgsApdkEA             
RICH_MOBI_[AG]:                                                       AleGAeGqveGsApdkeAG            
RICH_MOBI_[EG]:                                                         EGaEGqvEGsapdkEaG