Q9Y2Y0 AR2BP_HUMAN
Gene name: ARL2BP
Protein name: ADP-ribosylation factor-like protein 2-binding protein
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVK5 | FGFR1OP2 | 0.64603 | response to stress GO:0006950 |
| 2 | Q9ULK0 | GRID1 | 0.63303 | cell-cell signaling GO:0007267 |
| 3 | Q8IZF2 | ADGRF5 | 0.60164 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 4 | Q86WK7 | AMIGO3 | 0.59303 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 5 | Q9NP62 | GCM1 | 0.58831 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q8N2R0 | OSR2 | 0.58576 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | P54368 | OAZ1 | 0.58482 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q96Q07 | BTBD9 | 0.57294 | cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 9 | Q8NF91 | SYNE1 | 0.56763 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton organization GO:0007010 ... |
| 10 | Q9NV70 | EXOC1 | 0.55883 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: KDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH STMI: DO_DISOPRED3: .................................................DDDDDDDDDDDDDD DO_IUPRED2A: ............................................................... DO_SPOTD: ..................................................DDDDDDDDDDDDD CONSENSUS: ..................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[NS]: SSSlpaSqNN RICH_MOBI_[L]: LdLssgLvvtsLcksssL RICH_MOBI_[S]: SSglvvtSlckSSS RICH_MOBI_[SV]: VVtSlckSSS RICH_MOBI_[LS]: LdLSSgLvvtSLckSSSLpaS RICH_MOBI_[NS]: SSSlpaSqNN