Q9Y342 PLLP_HUMAN
Gene name: PLLP
Protein name: Plasmolipin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- response to stress GO:0006950
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O95568 | METTL18 | 0.91837 | cellular protein modification process GO:0006464 |
| 2 | Q5MNZ9 | WIPI1 | 0.83768 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 3 | Q92503 | SEC14L1 | 0.79125 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 4 | Q96EB1 | ELP4 | 0.74681 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q7RTW8 | OTOA | 0.74527 | cell adhesion GO:0007155 nervous system process GO:0050877 |
| 6 | Q8NFJ9 | BBS1 | 0.73828 | cellular component assembly GO:0022607 homeostatic process GO:0042592 nervous system process GO:0050877 ... |
| 7 | P01893 | HLA-H | 0.73766 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 8 | P15814 | IGLL1 | 0.70874 | immune system process GO:0002376 membrane organization GO:0061024 response to stress GO:0006950 ... |
| 9 | Q14416 | GRM2 | 0.70673 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 10 | Q9ULP0 | NDRG4 | 0.69223 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPW STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM M DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD.......... ............ .......... CONSENSUS_MOBI: ................................... ............ .......... RICH_[AS]: SkvStrtSSpAqgAeASvSA RICH_[A]: AqgAeAsvsA RICH_[S]: SkvStrtSSpaqgaeaSvS
120 140 160 180 AA: PLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ......................................................................DDDDDDDDDDDD DO_IUPRED2A: .................................................................................. DO_SPOTD: ....................................................................DDDDDDDDDDDDDD CONSENSUS: ..................... ........DDDDDDDDDDDD CONSENSUS_MOBI: ..................... ....................