Q9Y3C0 WASC3_HUMAN

Gene name: WASHC3
Protein name: WASH complex subunit 3

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P57078 RIPK4 0.67001 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q9BSU3 NAA11 0.66167 cellular protein modification process GO:0006464
protein maturation GO:0051604
3 Q13316 DMP1 0.62217 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 Q9NY27 PPP4R2 0.60152 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
DNA metabolic process GO:0006259
...
5 Q8WYN3 CSRNP3 0.59722 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
6 Q2PPJ7 RALGAPA2 0.59095 signal transduction GO:0007165
7 A2A368 MAGEB16 0.58597
8 Q03014 HHEX 0.57543 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 Q7Z2X4 PID1 0.57401 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
10 Q96PQ7 KLHL5 0.57167 cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDD.........................................................................DD.DDDDDDDDDDDD
DO_IUPRED2A:             DD....................................................................................D..DDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD.........................................................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................................................................................DDDDDDDD

                                          120                 140                 160                 180      
AA:                      EATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD
STMI:                                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDD............................D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                             DpDllerpDapvpD                   
RICH_[E]:                                                                                            EsEktvEEssdsE     
RICH_[Q]:                     QpQQnstQdsglQ                                                                            
RICH_[S]:                                                                                             SektveeSSdSeSSfS 
RICH_[DL]:                                                                           LDpDLLerpD                        
RICH_[DP]:                                                                            DPDllerPDaPvPD                   
RICH_[ES]:                                                                                           ESEktvEESSdSESSfS 
RICH_fLPS_[Q]:              seQpQQnstQdsglQ                                                                            
RICH_fLPS_[S]:                                                                                              eSSdSeSSfS 
RICH_MOBI_[D]:                                                                        DpDllerpDapvpD                   
RICH_MOBI_[E]:                                                                                       EsEktvEEssdsE     
RICH_MOBI_[Q]:                QpQQnstQdsglQ                                                                            
RICH_MOBI_[S]:                                                                                        SektveeSSdSeSSfS 
RICH_MOBI_[DL]:                                                                      LDpDLLerpDapvpD                   
RICH_MOBI_[ES]:                                                                                      ESEktvEESSdSESSfS 
RICH_fLPS_MOBI_[Q]:         seQpQQnstQdsglQ