Q9Y421 FA32A_HUMAN

Gene name: FAM32A
Protein name: Protein FAM32A

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell death GO:0008219

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BXB7 SPATA16 0.94377 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
2 O95478 NSA2 0.93734 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
3 Q02878 RPL6 0.93666 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q9Y2R4 DDX52 0.93265 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 Q1ED39 KNOP1 0.9243
6 Q7Z388 DPY19L4 0.92158 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 Q86XH1 IQCA1 0.91505
8 Q96ND0 FAM210A 0.90298
9 Q9NWT1 PAK1IP1 0.89945 anatomical structure development GO:0048856
cell population proliferation GO:0008283
ribosome biogenesis GO:0042254
...
10 P29350 PTPN6 0.8964 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLT
STMI:                                                                                                                        
DO_DISOPRED3:            ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
DO_IUPRED2A:             DDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D................................
CONSENSUS:               DDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS_MOBI:          ......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
RICH_[K]:                              KgvaelgvtKrKKKKKdKdKaKlleamgtsKKneeeK                                                 
RICH_[EK]:                                              KdKaKllEamgtsKKnEEEK                                                 
RICH_fLPS_[K]:                                vtKrKKKKKdKdKaKlleamgtsKK                                                      
RICH_MOBI_[K]:                                  KrKKKKKdKdKaKlleamgtsKKneeeK                                                 
RICH_MOBI_[EK]:                                         KdKaKllEamgtsKKnEEEK                                                 
RICH_fLPS_MOBI_[K]:                            tKrKKKKKdKdKaKlleamgtsKK                                                      

                                 
AA:                      EHYDIPKVSWTK
STMI:                                
DO_DISOPRED3:            ...........D
DO_IUPRED2A:             ..D.........
DO_SPOTD:                .......DDDDD
CONSENSUS:               ...........D
CONSENSUS_MOBI:          ............