Q9Y5U9 IR3IP_HUMAN

Gene name: IER3IP1
Protein name: Immediate early response 3-interacting protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                  
AA:                      MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG
STMI:                     MMMMMMMMMMMMMMMMMMMMM                                       MMMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DD................................................................................
DO_IUPRED2A:             ..................................................................................
DO_SPOTD:                D..................................DDDDDD.D.......................................
CONSENSUS:               D                     .......................................                     
CONSENSUS_MOBI:          .                     .......................................