Q9Y6X1 SERP1_HUMAN
Gene name: SERP1
Protein name: Stress-associated endoplasmic reticulum protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- membrane organization GO:0061024
- plasma membrane organization GO:0007009
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8TDS4 | HCAR2 | 0.74329 |
catabolic process
GO:0009056 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
2 | Q8IZF3 | ADGRF4 | 0.74329 |
signal transduction
GO:0007165 |
3 | Q9BXY5 | CAPS2 | 0.68972 | |
4 | O00590 | ACKR2 | 0.6796 |
anatomical structure development
GO:0048856 homeostatic process GO:0042592 immune system process GO:0002376 ... |
5 | P49019 | HCAR3 | 0.67522 |
signal transduction
GO:0007165 |
6 | Q96BT7 | ALKBH8 | 0.65874 |
cellular nitrogen compound metabolic process
GO:0034641 response to stress GO:0006950 |
7 | P15036 | ETS2 | 0.64316 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
8 | P32780 | GTF2H1 | 0.62382 |
biosynthetic process
GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
9 | Q8N695 | SLC5A8 | 0.61345 |
biosynthetic process
GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
10 | O75317 | USP12 | 0.60637 |
catabolic process
GO:0009056 cellular protein modification process GO:0006464 |
20 40 60
AA: MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM
STMI: MMMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3: DD..............................D................................D
DO_IUPRED2A: ...........DDDDDDDDDDDDDDDDDDDD...................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDD
CONSENSUS: DD.........DDDDDDDDDDDDDDDDDDDDDD..... ......D
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....... .......
RICH_MOBI_[N]: NekhskNitqrgNvaktsrN
RICH_MOBI_[IM]: MvakqrIrManekhsknI