Q9Y6X1 SERP1_HUMAN

Gene name: SERP1
Protein name: Stress-associated endoplasmic reticulum protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- membrane organization GO:0061024
- plasma membrane organization GO:0007009
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8TDS4 HCAR2 0.74329 catabolic process GO:0009056
cell death GO:0008219
cell-cell signaling GO:0007267
...
2 Q8IZF3 ADGRF4 0.74329 signal transduction GO:0007165
3 Q9BXY5 CAPS2 0.68972
4 O00590 ACKR2 0.6796 anatomical structure development GO:0048856
homeostatic process GO:0042592
immune system process GO:0002376
...
5 P49019 HCAR3 0.67522 signal transduction GO:0007165
6 Q96BT7 ALKBH8 0.65874 cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
7 P15036 ETS2 0.64316 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 P32780 GTF2H1 0.62382 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
9 Q8N695 SLC5A8 0.61345 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
10 O75317 USP12 0.60637 catabolic process GO:0009056
cellular protein modification process GO:0006464

                                           20                  40                  60              
AA:                      MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM
STMI:                                                          MMMMMMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            DD..............................D................................D
DO_IUPRED2A:             ...........DDDDDDDDDDDDDDDDDDDD...................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDD
CONSENSUS:               DD.........DDDDDDDDDDDDDDDDDDDDDD.....                     ......D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......                     .......
RICH_MOBI_[N]:                     NekhskNitqrgNvaktsrN                                    
RICH_MOBI_[IM]:          MvakqrIrManekhsknI