HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T515B
Query:
T515_B.pdb B
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1twia2 Diaminopimelate decarboxylase LysA PLP-​binding barrel TIM beta/​alpha-​barrel α/β 11.79 2.076 1.00 20.6 11.7 0.55
2 d1knwa2 Diaminopimelate decarboxylase LysA PLP-​binding barrel TIM beta/​alpha-​barrel α/β 11.51 1.858 1.00 19.8 11.4 0.53
3 d7odca2 Eukaryotic ornithine decarboxylase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 11.45 2.100 1.00 19.4 11.2 0.53
4 d1hkva2 Diaminopimelate decarboxylase LysA PLP-​binding barrel TIM beta/​alpha-​barrel α/β 11.08 2.023 1.00 19.0 10.7 0.54
5 d1twia1 Diaminopimelate decarboxylase LysA Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 9.62 1.176 1.00 15.7 8.5 0.35
6 d1hkva1 Diaminopimelate decarboxylase LysA Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 9.44 1.456 1.00 15.4 8.2 0.35
7 d1knwa1 Diaminopimelate decarboxylase LysA Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 9.23 1.321 1.00 15.0 8.0 0.35
8 d7odca1 Eukaryotic ornithine decarboxylase (ODC) Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 7.24 1.636 1.00 13.1 5.9 0.30
9 d1bd0a2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 6.97 2.454 1.00 14.1 7.9 0.49
10 d1vfsa2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 6.95 2.281 1.00 14.8 7.4 0.49
11 d1rcqa2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 6.91 2.121 1.00 14.6 7.6 0.48
12 d1ct5a_ ​(​Hypothetical​(​ protein ybl036c PLP-​binding barrel TIM beta/​alpha-​barrel α/β 6.14 1.881 0.98 13.8 7.9 0.46
13 d1tqja_ D-​ribulose-​5-​phosphate 3-​epimerase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 4.35 2.347 0.21 13.0 7.3 0.43
14 d1q6oa_ 3-​keto-​L-​gulonate 6-​phosphate decarboxylase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 4.16 1.541 0.92 13.1 5.2 0.43
15 d1a49a2 Pyruvate kinase,​ N-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.96 2.314 0.10 11.1 5.8 0.44
16 d1m5wa_ Pyridoxine 5'​-​phosphate synthase Pyridoxine 5'​-​phosphate synthase TIM beta/​alpha-​barrel α/β 3.81 2.371 0.05 11.1 6.4 0.43
17 d1izca_ Macrophomate synthase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.77 1.007 0.93 9.6 5.0 0.44
18 d1qpoa1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain TIM beta/​alpha-​barrel α/β 3.67 2.274 0.47 8.3 4.1 0.37
19 d1fq0a_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 3.63 2.372 0.43 10.3 5.0 0.43
20 d1vlpa2 Nicotinate phosphoribosyltransferase,​ C-​terminal domain Nicotinate/​Quinolinate PRTase C-​terminal domain-​like alpha/​beta-​Hammerhead α+β 3.60 1.364 0.03 5.9 3.9 0.44
21 d1i4na_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.60 2.226 0.22 10.4 5.6 0.41
22 d1o1za_ Hypothetical protein TM1621 PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 3.59 2.372 0.02 10.3 5.4 0.33
23 d1nsja_ N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.57 2.371 0.08 9.9 6.2 0.41
24 d1a53a_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.56 2.326 0.19 10.1 6.0 0.42
25 d1r85a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.56 1.898 0.07 11.1 3.2 0.46
26 d1thfd_ Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.55 2.126 0.08 10.2 5.4 0.36
27 d1xyza_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.54 1.850 0.02 10.4 4.3 0.44
28 d1km4a_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.53 2.190 0.02 10.3 5.4 0.41
29 d1piia2 N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.51 2.194 0.07 9.3 5.4 0.39
30 d1ur1a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.51 0.894 0.93 11.0 4.4 0.42
31 d1vc4a_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.50 2.373 0.04 9.7 5.9 0.42
32 d1i1wa_ Xylanase A,​ catalytic core (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.47 1.572 0.01 10.4 5.0 0.42
33 d1muma_ 2-​methylisocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.45 2.372 0.05 9.8 3.9 0.45
34 d1dxea_ 2-​dehydro-​3-​deoxy-​galactarate aldolase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.44 0.861 0.91 8.8 5.2 0.42
35 d1qo2a_ Phosphoribosylformimino-​5-​aminoimidazole carboxamide ribotite isomerase HisA Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.44 2.296 0.11 9.9 3.7 0.37
36 d1v93a_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.44 2.285 0.01 10.1 5.3 0.40
37 d1n7ka_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 3.42 2.172 0.06 10.0 5.5 0.36
38 d1f6ya_ corrinoid/​iron-​sulfur protein methyltransferase MetR Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 3.42 0.676 0.91 8.7 4.8 0.44
39 d1rqba2 Transcarboxylase 5S subunit,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 3.41 2.372 0.02 8.4 4.9 0.44
40 d1t8qa_ Glycerophosphodiester phosphodiesterase GlpQ PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 3.41 1.443 0.01 8.2 4.4 0.35
41 d1foba_ Beta-​1,​4-​galactanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.40 0.720 0.95 9.8 4.3 0.42
42 d1aq0a_ Plant beta-​glucanases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.40 1.377 0.01 9.1 3.8 0.40
43 d1geqa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.38 2.058 0.07 9.7 5.7 0.43
44 d1vhca_ Hypothetical protein HI0047 Aldolase TIM beta/​alpha-​barrel α/β 3.38 0.820 0.92 9.5 4.7 0.42
45 d1ec7a1 D-​glucarate dehydratase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 3.37 1.456 0.01 8.9 4.0 0.44
46 d1s2wa_ Phosphoenolpyruvate mutase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.34 2.373 0.04 9.5 5.1 0.39
47 d1sgja_ Citrate lyase,​ beta subunit Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.32 1.512 0.20 9.0 4.7 0.41
48 d1ujpa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.31 2.035 0.04 9.2 5.5 0.36
49 d1twda_ Copper homeostasis protein CutC CutC-​like (Pfam 03932) TIM beta/​alpha-​barrel α/β 3.30 2.363 0.20 8.2 4.8 0.42
50 d1piia1 Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.30 2.197 0.02 9.8 4.0 0.41
51 d1dqua_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.30 1.268 0.01 9.8 4.2 0.37
52 d1p1xa_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 3.30 1.897 0.04 10.1 3.1 0.43
53 d1of8a_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 3.30 1.312 0.01 8.8 4.3 0.39
54 d1b5ta_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.29 1.847 0.02 9.2 5.0 0.43
55 d1k77a_ Hypothetical protein YgbM (EC1530) Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 3.29 0.807 0.96 8.5 3.8 0.42
56 d1nvma2 4-​hydroxy-​2-​oxovalerate aldolase DmpG,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 3.24 2.372 0.20 8.2 5.2 0.44
57 d1qopa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.24 2.232 0.08 8.8 5.0 0.43
58 d1nofa2 Glycosyl hydrolase family 5 xylanase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.23 1.273 0.02 9.7 4.3 0.43
59 d1gvfa_ Tagatose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 3.22 1.841 0.06 9.3 3.3 0.40
60 d1adoa_ Fructose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 3.22 1.436 0.02 7.7 4.2 0.45
61 d1cnva_ Seed storage protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.20 1.348 0.01 8.7 3.8 0.43
62 d1ub3a_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 3.20 1.922 0.09 9.2 5.7 0.33
63 d1pz1a_ Putative oxidoreductase YhdN NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.19 1.489 0.04 8.9 3.9 0.37
64 d1r5ya_ Queosine tRNA-​guanine transglycosylase tRNA-​guanine transglycosylase TIM beta/​alpha-​barrel α/β 3.18 1.565 0.03 9.2 4.2 0.36
65 d1aw1a_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 3.17 2.142 0.02 8.5 4.4 0.36
66 d1sr9a2 2-​isopropylmalate synthase LeuA,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 3.17 1.839 0.02 7.2 3.2 0.42
67 d1f61a_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 3.15 1.391 0.01 8.8 4.5 0.33
68 d1to3a_ Putative aldolase YihT Aldolase TIM beta/​alpha-​barrel α/β 3.13 1.736 0.07 7.5 4.8 0.36
69 d1egza_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.13 1.355 0.03 9.6 4.2 0.43
70 d1n55a_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 3.13 2.176 0.01 8.3 4.6 0.37
71 d1f74a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 3.11 2.214 0.07 8.7 4.6 0.40
72 d1gvea_ Aflatoxin aldehyde reductase (akr7a1) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.11 1.392 0.03 8.9 3.4 0.41
73 d1pe1a_ 3-​deoxy-​D-​manno-​octulosonate 8-​phosphate synthase (KDO8P synthase) Aldolase TIM beta/​alpha-​barrel α/β 3.11 1.830 0.03 9.0 4.3 0.40
74 d1vkfa_ Glycerol uptake operon antiterminator-​related protein TM1436 GlpP-​like TIM beta/​alpha-​barrel α/β 3.10 2.129 0.01 8.5 5.9 0.33
75 d1odza_ Mannanase A,​ ManA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.09 1.211 0.04 8.6 3.3 0.35
76 d1jpdx1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 3.09 1.895 0.07 7.8 4.3 0.38
77 d1luca_ Bacterial luciferase alpha chain,​ LuxA Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 3.08 1.371 0.05 8.1 4.3 0.39
78 d1q7za1 Cobalamin-​dependent methionine synthase MetH,​ C-​terminal domain Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 3.08 1.890 0.27 9.0 4.0 0.38
79 d1pbga_ 6-​phospho-​beta-​D-​galactosidase,​ PGAL (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.08 1.332 0.01 9.2 4.5 0.43
80 d2mnra1 Mandelate racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 3.07 1.821 0.04 8.2 4.7 0.38
81 d1k87a2 Proline dehydrohenase domain of bifunctional PutA protein FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.07 1.614 0.01 7.2 2.7 0.40
82 d1dosa_ Fructose-​bisphosphate aldolase (FBP aldolase) Aldolase TIM beta/​alpha-​barrel α/β 3.07 1.427 0.07 7.9 3.5 0.37
83 d1hw6a_ 2,​5-​diketo-​D-​gluconic acid reductase A NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.05 1.501 0.02 8.6 3.3 0.33
84 d1l6wa_ Fructose-​6-​phosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 3.05 1.915 0.06 8.6 3.2 0.37
85 d1xi3a_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 3.05 2.161 0.58 9.4 3.4 0.41
86 d1us0a_ Aldose reductase (aldehyde reductase) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 3.04 1.570 0.02 8.3 3.6 0.37
87 d1bhga3 beta-​Glucuronidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.03 1.340 0.02 9.0 3.1 0.38
88 d1uasa2 Melibiase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.03 1.190 0.08 7.8 4.4 0.42
89 d7a3ha_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.02 1.411 0.02 9.4 3.1 0.42
90 d1x7fa2 Outer surface protein,​ N-​terminal domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.02 1.955 0.11 9.0 2.4 0.41
91 d1rvka1 Hypothetical protein Atu3453 Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 3.02 2.026 0.03 8.1 4.4 0.40
92 d2tpsa_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 3.02 2.371 0.39 9.1 3.2 0.41
93 d1muca1 Muconate-​lactonizing enzyme Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 3.01 1.720 0.02 9.0 3.3 0.41
94 d1uuqa_ Exomannosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.01 1.559 0.02 8.8 4.3 0.38
95 d1ojxa_ Archaeal fructose 1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 3.01 2.373 0.05 8.6 4.8 0.33
96 d1vlia2 Spore coat polysaccharide biosynthesis protein SpsE,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 3.01 2.281 0.02 9.1 3.1 0.43
97 d1us3a2 Xylanase 10c (Trans)glycosidases TIM beta/​alpha-​barrel α/β 3.00 1.791 0.04 9.6 3.8 0.41
98 d1w0ma_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 3.00 2.371 0.13 9.0 3.6 0.36
99 d1dqwa_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 3.00 2.204 0.10 7.8 3.9 0.36
100 d1eyea_ Dihydropteroate synthetase Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 2.99 1.940 0.08 8.0 3.7 0.38
101 d1r6wa1 O-​succinylbenzoate synthase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 2.98 1.330 0.05 8.0 3.7 0.36
102 d1vlwa_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 2.97 2.372 0.19 9.5 3.3 0.35
103 d1e4mm_ Plant beta-​glucosidase (myrosinase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.97 1.339 0.01 8.7 4.1 0.49
104 d1h7wa2 Dihydropyrimidine dehydrogenase,​ domain 4 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.97 1.990 0.01 8.2 5.0 0.36
105 d1p0ka_ Isopentenyl-​diphosphate delta-​isomerase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.96 2.208 0.12 8.2 4.9 0.34
106 d1qwga_ (2r)-​phospho-​3-​sulfolactate synthase ComA (2r)-​phospho-​3-​sulfolactate synthase ComA TIM beta/​alpha-​barrel α/β 2.95 1.608 0.11 8.0 4.1 0.36
107 d1nara_ Seed storage protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.95 1.350 0.07 7.0 4.3 0.41
108 d1jz7a5 beta-​Galactosidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.95 1.302 0.02 7.9 3.5 0.45
109 d1dbta_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 2.94 1.980 0.03 7.4 4.8 0.35
110 d1qw9a2 Alpha-​L-​arabinofuranosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.94 1.430 0.04 9.3 3.0 0.36
111 d1rzma_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 2.93 2.273 0.03 8.6 3.7 0.41
112 d1jr1a1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 2.93 2.372 0.04 6.9 4.4 0.39
113 d1tx2a_ Dihydropteroate synthetase Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 2.93 2.371 0.07 8.6 3.8 0.34
114 d1w3ia_ 2-​keto-​3-​deoxy gluconate aldolase Eda Aldolase TIM beta/​alpha-​barrel α/β 2.93 1.686 0.06 8.3 2.4 0.43
115 d1qnra_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.92 1.385 0.01 8.3 4.2 0.45
116 d1ep3a_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.92 1.911 0.04 7.9 4.7 0.30
117 d1ur3m_ Hypothetical oxidoreductase YdhF NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.92 1.335 0.07 8.2 4.1 0.33
118 d1jnda1 Imaginal disc growth factor-​2 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.91 1.556 0.03 8.9 4.1 0.34
119 d1q7za2 Cobalamin-​dependent methionine synthase MetH,​ N-​terminal domain Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 2.91 2.179 0.01 8.8 4.8 0.30
120 d1ug6a_ Beta-​glucosidase A (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.91 1.606 0.01 8.7 4.2 0.41
121 d1a0ca_ D-​xylose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.91 1.266 0.01 8.2 3.4 0.31
122 d1uwsa_ beta-​Glycosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.91 1.518 0.01 8.5 3.9 0.42
123 d1lqaa_ Tas protein NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.90 1.520 0.04 8.3 3.8 0.38
124 d1exba_ Voltage-​dependent K+ channel beta subunit NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.90 1.500 0.06 9.3 2.3 0.42
125 d1r30a_ Biotin synthase Radical SAM enzymes TIM beta/​alpha-​barrel α/β 2.89 2.102 0.03 7.3 4.7 0.38
126 d1hl2a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 2.89 2.101 0.05 8.3 3.9 0.43
127 d1ezwa_ Coenzyme F420 dependent tetrahydromethanopterin reductase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 2.89 1.802 0.02 9.2 3.4 0.42
128 d1lt8a_ Betaine-​homocysteine S-​methyltransferase Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 2.89 1.855 0.05 7.4 3.8 0.40
129 d1pyfa_ Putative oxidoreductase IolS NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.87 1.653 0.02 9.6 3.1 0.32
130 d1h1na_ Endocellulase EngI (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.87 1.351 0.02 9.4 2.9 0.39
131 d1fcqa_ Bee venom hyaluronidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.86 1.256 0.01 7.6 3.4 0.37
132 d1r0ma1 N-​acylamino acid racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 2.85 1.664 0.01 8.0 2.9 0.39
133 d1eqca_ Exo-​beta-​(1,​3)-​glucanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.84 1.302 0.02 7.5 3.5 0.42
134 d1hl9a2 Putative alpha-​L-​fucosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.84 1.539 0.03 6.0 3.6 0.39
135 d1ta3a_ Xylanase inhibitor protein I,​ XIP-​I (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.83 1.349 0.01 8.7 2.5 0.43
136 d1iq8a1 Archaeosine tRNA-​guanine transglycosylase,​ N-​terminal domain tRNA-​guanine transglycosylase TIM beta/​alpha-​barrel α/β 2.83 1.583 0.01 6.9 4.3 0.42
137 d1d3ga_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.83 2.373 0.13 7.2 4.2 0.36
138 d1jpma1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 2.82 1.937 0.04 8.1 3.7 0.40
139 d1goia2 Chitinase B,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.82 1.294 0.03 7.8 3.8 0.33
140 d1u1ja1 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 2.81 1.943 0.15 5.6 3.7 0.44
141 d1kbla1 Pyruvate phosphate dikinase,​ C-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 2.81 1.899 0.06 7.4 3.0 0.31
142 d1rhca_ Coenzyme F420 dependent secondary alcohol dehydrogenase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 2.81 1.741 0.02 8.7 3.6 0.35
143 d1qtwa_ Endonuclease IV Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.81 0.332 0.95 6.9 3.2 0.34
144 d1un7a2 N-​acetylglucosamine-​6-​phosphate deacetylase,​ NagA,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.80 1.150 0.04 6.5 3.0 0.40
145 d1o94a1 Trimethylamine dehydrogenase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.80 1.672 0.10 8.6 4.5 0.34
146 d1p4ca_ Membrane-​associated (S)-​mandelate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.79 1.909 0.03 6.8 4.2 0.41
147 d1bqca_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.78 1.433 0.02 7.7 4.3 0.41
148 d1o4ua1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain TIM beta/​alpha-​barrel α/β 2.78 2.372 0.39 6.5 3.5 0.28
149 d1uhva2 Beta-​D-​xylosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.78 1.446 0.06 8.5 2.7 0.41
150 d1l6sa_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 2.77 2.208 0.01 9.0 4.9 0.30
151 d1geha1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 2.77 1.563 0.03 7.3 4.7 0.39
152 d1kwga2 A4 beta-​galactosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.76 1.349 0.02 8.6 3.8 0.34
153 d1bf6a_ Phosphotriesterase homology protein Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.76 1.087 0.04 7.0 2.2 0.40
154 d1ceoa_ Endoglucanase CelC (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.75 1.613 0.02 8.4 3.7 0.35
155 d1vjza_ Endoglucanase homologue TM1752 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.75 1.409 0.04 8.0 3.4 0.37
156 d1viza_ PcrB protein homolog YerE FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.73 1.667 0.08 6.9 4.8 0.37
157 d1itua_ Renal dipeptidase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.73 1.137 0.03 6.6 2.8 0.33
158 d1i60a_ Hypothetical protein IolI Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.72 0.634 0.97 8.0 2.7 0.33
159 d5ruba1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 2.72 1.557 0.01 7.0 4.1 0.40
160 d1zfja1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 2.71 1.760 0.02 7.0 4.1 0.39
161 d1hkka1 Chitotriosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.71 1.330 0.09 8.2 4.0 0.33
162 d1pvna1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 2.70 2.372 0.03 6.9 4.2 0.45
163 d1jaka1 beta-​N-​acetylhexosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.70 0.209 0.93 7.5 2.4 0.36
164 d1eoka_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.69 1.347 0.01 7.8 3.4 0.29
165 d1juba_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.68 1.973 0.16 6.9 4.5 0.35
166 d1ogsa2 Glucosylceramidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.67 1.342 0.02 8.6 2.7 0.34
167 d1vyra_ Pentaerythritol tetranirate reductase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.67 0.520 0.92 7.3 3.9 0.34
168 d1h09a2 N-​terminal domain of endolysin (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.66 1.106 0.01 6.5 3.1 0.35
169 d1tyga_ Thiazole biosynthesis protein ThiG ThiG-​like (Pfam 05690) TIM beta/​alpha-​barrel α/β 2.66 1.668 0.11 7.8 3.5 0.36
170 d1o5ka_ Dihydrodipicolinate synthase Aldolase TIM beta/​alpha-​barrel α/β 2.66 2.287 0.03 6.3 3.7 0.41
171 d1i0da_ Phosphotriesterase (parathion hydrolase,​ PTE) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.66 1.107 0.04 6.7 1.9 0.36
172 d1dysa_ Cellobiohydrolase II (Cel6) Cellulases 7-​stranded beta/​alpha barrel α/β 2.65 0.943 0.04 6.0 2.9 0.40
173 d1nqka_ Alkanesulfonate monooxygenase SsuD Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 2.65 1.497 0.01 7.7 2.4 0.36
174 d1k6wa2 Cytosine deaminase catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.64 1.059 0.01 6.0 2.9 0.35
175 d1j18a2 Bacterial beta-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.63 1.827 0.05 7.9 3.9 0.39
176 d1vhna_ Putative flavin oxidoreducatase TM0096 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.63 1.670 0.04 6.4 3.8 0.43
177 d1gqna_ Type I 3-​dehydroquinate dehydratase Aldolase TIM beta/​alpha-​barrel α/β 2.63 1.875 0.03 7.5 4.6 0.35
178 d1p1ma2 Hypothetical protein TM0936,​ probable catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.62 0.894 0.02 5.6 3.0 0.37
179 d1ecea_ Endocellulase E1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.62 1.340 0.02 8.0 2.0 0.34
180 d1ps9a1 2,​4-​dienoyl-​CoA reductase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.62 0.608 0.91 8.1 4.4 0.33
181 d1edga_ Endoglucanase CelA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.60 1.340 0.03 8.2 2.2 0.38
182 d1tmla_ Cellulase E2 Cellulases 7-​stranded beta/​alpha barrel α/β 2.59 1.064 0.04 6.0 3.3 0.37
183 d1tz9a_ Mannonate dehydratase UxuA Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.59 1.179 0.20 6.5 3.1 0.42
184 d7reqb1 Methylmalonyl-​CoA mutase beta subunit,​ domain 1 Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 2.58 1.095 0.01 6.9 3.2 0.38
185 d1d8wa_ L-​rhamnose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.57 1.319 0.04 6.5 3.1 0.39
186 d1kbia1 Flavocytochrome b2,​ C-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.57 2.354 0.03 6.6 3.6 0.32
187 d1gqia1 alpha-​D-​glucuronidase catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.57 1.089 0.01 7.2 2.6 0.47
188 d1r3sa_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 2.57 1.786 0.12 6.8 3.4 0.38
189 d1k1xa3 4-​alpha-​glucanotransferase,​ N-​terminal domain Glycoside hydrolase/​deacetylase 7-​stranded beta/​alpha barrel α/β 2.54 0.816 0.07 5.0 2.5 0.35
190 d1d2ka1 Chitinase 1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.54 1.304 0.05 8.2 2.3 0.35
191 d1oyba_ Old yellow enzyme (OYE) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.54 1.673 0.04 7.1 3.4 0.37
192 d1edqa2 Chitinase A,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.53 1.512 0.04 7.7 3.4 0.32
193 d1itxa1 Chitinase A1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.52 1.306 0.02 8.0 2.2 0.33
194 d1tvla_ Putative monooxygenase YtnJ Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 2.52 1.503 0.01 7.1 2.2 0.42
195 d1o12a2 N-​acetylglucosamine-​6-​phosphate deacetylase,​ NagA,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.52 1.513 0.02 5.1 3.1 0.40
196 d1gk8a1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 2.51 1.561 0.01 7.2 3.2 0.33
197 d1j6oa_ Hypothetical protein TM0667 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.51 1.116 0.09 6.2 3.4 0.36
198 d1v3ha_ beta-​Amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.49 1.664 0.02 7.6 2.7 0.44
199 d1kkoa1 beta-​Methylaspartase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 2.49 1.649 0.02 7.5 3.2 0.27
200 d1jfxa_ Streptomyces lysozyme (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.47 1.087 0.01 6.2 2.6 0.35
201 d1gzga_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 2.46 2.308 0.01 8.5 3.3 0.30
202 d1ccwb_ Glutamate mutase,​ large subunit Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 2.46 1.309 0.02 8.1 2.4 0.35
203 d1ufaa2 Hypothetical protein TT1467,​ N-​terminal domain Glycoside hydrolase/​deacetylase 7-​stranded beta/​alpha barrel α/β 2.45 0.745 0.01 4.5 2.7 0.36
204 d1u1ja2 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 2.45 1.381 0.02 6.4 3.1 0.42
205 d1onra_ Transaldolase Aldolase TIM beta/​alpha-​barrel α/β 2.44 1.442 0.03 5.6 2.7 0.36
206 d1kcxa2 Dihydropyrimidinase related protein-​1 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.43 1.169 0.03 5.4 2.9 0.39
207 d1m3ua_ Ketopantoate hydroxymethyltransferase PanB Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 2.42 2.327 0.03 6.2 3.2 0.37
208 d1j5sa_ Uronate isomerase TM0064 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.42 0.926 0.06 5.9 2.8 0.30
209 d1ntha_ Monomethylamine methyltransferase MtmB Monomethylamine methyltransferase MtmB TIM beta/​alpha-​barrel α/β 2.42 1.086 0.01 6.6 2.6 0.34
210 d7reqa1 Methylmalonyl-​CoA mutase alpha subunit,​ domain 1 Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 2.41 1.007 0.25 6.4 2.2 0.38
211 d1ohla_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 2.41 2.126 0.01 8.3 2.7 0.30
212 d1edta_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.39 1.348 0.04 6.2 3.2 0.29
213 d1v77a_ Ribonuclease P protein component 3,​ Rnp3 PHP domain-​like 7-​stranded beta/​alpha barrel α/β 2.39 1.080 0.08 5.5 3.5 0.36
214 d2ebna_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.38 1.351 0.02 5.7 3.1 0.37
215 d1qbaa3 Bacterial chitobiase (beta-​N-​acetylhexosaminidase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.37 1.340 0.05 6.6 2.0 0.33
216 d1nowa1 beta-​hexosaminidase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.37 0.257 0.93 7.2 2.3 0.34
217 d1tv8a_ Molybdenum cofactor biosynthesis protein A MoaA Radical SAM enzymes TIM beta/​alpha-​barrel α/β 2.35 0.273 0.94 4.5 2.9 0.35
218 d1m7ja3 N-​acyl-​D-​aminoacid amidohydrolase,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.34 1.055 0.01 5.6 2.4 0.42
219 d1gkra2 L-​hydantoinase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.33 1.077 0.09 5.5 3.0 0.40
220 d1eexa_ Diol dehydratase,​ alpha subunit Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 2.32 0.964 0.02 6.7 2.5 0.39
221 d1q45a_ 12-​oxophytodienoate reductase (OPR,​ OYE homolog) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 2.31 1.675 0.04 6.5 3.5 0.31
222 d1onwa2 Isoaspartyl dipeptidase,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.30 1.143 0.01 5.8 2.3 0.40
223 d1kfwa1 Psychrophilic chitinase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.29 1.344 0.05 6.4 3.6 0.41
224 d1m65a_ Hypothetical protein YcdX PHP domain-​like 7-​stranded beta/​alpha barrel α/β 2.28 0.953 0.14 4.6 2.0 0.33
225 d1lucb_ Bacterial luciferase beta chain,​ LuxB Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 2.28 1.444 0.04 5.6 2.2 0.39
226 d1uoka2 Oligo-​1,​6,​ glucosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.27 1.341 0.01 6.0 3.4 0.37
227 d1r7aa2 Sucrose phosphorylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.27 1.217 0.01 5.9 2.6 0.35
228 d1a4ma_ Adenosine deaminase (ADA) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.25 1.410 0.08 4.4 2.5 0.41
229 d1j79a_ Dihydroorotase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.25 1.359 0.02 4.7 2.6 0.41
230 d4ubpc2 alpha-​subunit of urease,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.24 0.781 0.01 4.5 2.6 0.34
231 d1m7xa3 1,​4-​alpha-​glucan branching enzyme,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.24 1.340 0.01 6.1 2.9 0.35
232 d1gkpa2 D-​hydantoinase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.22 1.135 0.04 4.9 3.1 0.39
233 d1eswa_ Amylomaltase MalQ (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.21 1.176 0.01 6.4 2.5 0.32
234 d1nfga2 D-​hydantoinase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.20 1.039 0.04 5.6 2.6 0.38
235 d1ny1a_ Probable polysaccharide deacetylase PdaA Glycoside hydrolase/​deacetylase 7-​stranded beta/​alpha barrel α/β 2.20 1.191 0.07 4.2 2.4 0.29
236 d1ua7a2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.18 1.319 0.01 5.7 2.8 0.32
237 d1hx0a2 Animal alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.16 1.342 0.01 5.7 3.0 0.31
238 d1j93a_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 2.14 1.585 0.13 6.2 1.8 0.40
239 d1h3ga3 Cyclomaltodextrinase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.13 1.330 0.01 6.1 2.6 0.41
240 d1ji2a3 Maltogenic amylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.12 1.340 0.01 7.5 2.5 0.33
241 d1sfsa_ Unnamed hypothetical protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.12 0.815 0.01 5.4 2.5 0.34
242 d1jqna_ Phosphoenolpyruvate carboxylase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 2.10 1.033 0.01 6.6 2.0 0.54
243 d1eh9a3 Glycosyltrehalose trehalohydrolase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.08 1.291 0.03 5.8 2.7 0.36
244 d1onea1 Enolase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 2.07 1.370 0.02 4.5 3.2 0.37
245 d1olta_ Oxygen-​independent coproporphyrinogen III oxidase HemN Radical SAM enzymes TIM beta/​alpha-​barrel α/β 2.07 1.609 0.31 3.3 2.1 0.33
246 d1ht6a2 Plant alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.04 1.340 0.01 6.7 3.0 0.31
247 d1e43a2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.02 1.340 0.01 6.3 2.4 0.33
248 d1gcya2 G4-​amylase (1,​4-​alpha-​D-​glucan maltotetrahydrolase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.01 1.307 0.02 5.7 3.1 0.32
249 d1oc7a_ Cellobiohydrolase II (Cel6) Cellulases 7-​stranded beta/​alpha barrel α/β 2.01 1.152 0.05 4.6 2.1 0.42
250 d1qhoa4 Cyclodextrin glycosyltransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.96 1.340 0.01 6.5 3.3 0.33
251 d1ji1a3 Maltogenic amylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.96 1.341 0.01 6.4 3.0 0.35
252 d7taaa2 Fungal alpha-​amylases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.94 1.331 0.01 6.0 3.0 0.32
253 d1g5aa2 Amylosucrase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.94 1.406 0.01 5.8 2.2 0.38
254 d1mxga2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.91 1.339 0.02 5.7 3.5 0.33
255 d1qasa3 Phospholipase C isozyme D1 (PLC-​D1) PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.91 0.751 0.01 3.9 2.2 0.34
256 d1bf2a3 Isoamylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.91 1.154 0.01 5.0 1.8 0.42
257 d1gjwa2 Maltosyltransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.89 1.369 0.01 6.1 1.7 0.32
258 d1ofda2 Alpha subunit of glutamate synthase,​ central and FMN domains FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.83 1.664 0.03 5.6 2.3 0.36
259 d1d8ca_ Malate synthase G Malate synthase G TIM beta/​alpha-​barrel α/β 1.83 0.830 0.01 3.7 2.1 0.49
260 d1lwha2 4-​alpha-​glucanotransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.81 1.302 0.01 5.7 2.5 0.34
261 d1nfpa_ Non-​fluorescent flavoprotein (luxF,​ FP390) Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.79 0.613 0.04 3.8 2.4 0.31
262 d1o7d.3 Lysosomal alpha-​mannosidase Glycoside hydrolase/​deacetylase 7-​stranded beta/​alpha barrel α/β 1.78 0.751 0.01 2.9 2.2 0.33
263 d1iexa1 Beta-​D-​glucan exohydrolase,​ N-​terminal domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.78 1.320 0.01 2.8 2.4 0.33
264 d2plca_ Phosphatidylinositol-​specific phospholipase C PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.74 0.646 0.01 2.9 1.9 0.35
265 d1vi9a_ Pyridoxamine kinase Ribokinase-​like Ribokinase-​like α/β 1.65 0.804 0.01 3.8 1.9 0.31
266 d1j31a_ Hypothetical protein PH0642 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 1.65 0.854 0.01 3.3 1.8 0.31
267 d1bd0a1 Alanine racemase Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 1.63 1.627 0.37 4.9 2.0 0.25
268 d1iv8a2 Maltooligosyl trehalose synthase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.60 1.196 0.01 5.9 1.3 0.36
269 d1jlra_ Uracil PRTase,​ Upp PRTase-​like PRTase-​like α/β 1.50 0.842 0.01 3.4 2.1 0.27
270 d1v8aa_ Hydroxyethylthiazole kinase (THZ kinase,​ ThiK) Ribokinase-​like Ribokinase-​like α/β 1.50 1.033 0.01 3.4 2.6 0.28
271 d1qwna3 Golgi alpha-​mannosidase II Glycoside hydrolase/​deacetylase 7-​stranded beta/​alpha barrel α/β 1.50 0.603 0.01 2.6 1.5 0.35
272 d1vm7a_ Ribokinase Ribokinase-​like Ribokinase-​like α/β 1.43 0.866 0.02 3.6 1.8 0.29
273 d1muwa_ D-​xylose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.42 -0.872 0.97 4.1 1.9 0.31
274 d1jrla_ Thioesterase I,​ TAP SGNH hydrolase Flavodoxin-​like α/β 1.42 0.834 0.07 2.7 2.1 0.27
275 d1rcqa1 Alanine racemase Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 1.38 1.225 0.70 3.8 1.6 0.22
276 d1rkda_ Ribokinase Ribokinase-​like Ribokinase-​like α/β 1.38 0.638 0.02 3.4 2.0 0.30
277 d1vfsa1 Alanine racemase Alanine racemase C-​terminal domain-​like Domain of alpha and beta subunits of F1 ATP synthase-​like All β 1.37 1.377 0.49 4.2 1.7 0.17
278 d1j5va_ 2-​keto-​3-​deoxygluconate kinase Ribokinase-​like Ribokinase-​like α/β 1.31 0.739 0.01 2.7 1.9 0.31
279 d1vk4a_ Hypothetical protein TM0415 Ribokinase-​like Ribokinase-​like α/β 1.20 0.736 0.01 2.5 1.8 0.28
280 d2ptda_ Phosphatidylinositol-​specific phospholipase C PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.15 0.650 0.01 2.3 1.4 0.27
281 d1t1ra2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.15 1.207 0.02 2.8 2.2 0.22
282 d1dkra1 Phosphoribosylpyrophosphate synthetase PRTase-​like PRTase-​like α/β 1.14 1.036 0.01 3.2 2.6 0.25
283 d1vjga_ Hypothetical protein alr1529 SGNH hydrolase Flavodoxin-​like α/β 1.14 0.744 0.02 2.7 1.9 0.27
284 d1puia_ Probable GTPase EngB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.09 0.930 0.01 2.9 1.4 0.25
285 d1o14a_ Putative sugar kinase TM0828 Ribokinase-​like Ribokinase-​like α/β 1.07 0.706 0.01 2.1 1.2 0.29
286 d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.07 0.871 0.02 2.5 1.4 0.21
287 d1r0ka2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.05 1.114 0.03 2.7 1.9 0.25
288 d7reqa2 Methylmalonyl-​CoA mutase alpha subunit,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 1.05 1.142 0.12 2.8 2.2 0.24
289 d1svia_ Probable GTPase EngB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.04 0.646 0.01 3.0 1.4 0.27
290 d1lnqa1 Potassium channel-​related protein MthK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.03 0.855 0.02 2.2 1.8 0.23
291 d1ub0a_ 4-​amino-​5-​hydroxymethyl-​2-​methylpyrimidine phosphate kinase (HMP-​phosphate kinase,​ ThiD) Ribokinase-​like Ribokinase-​like α/β 1.01 0.696 0.01 1.2 2.0 0.31
292 d1k66a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 1.00 1.037 0.01 3.1 1.8 0.22
293 d1e8ca2 UDP-​N-​acetylmuramyl tripeptide synthetase MurE MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 0.99 0.762 0.02 2.3 2.0 0.22
294 d1m6sa_ Low-​specificity threonine aldolase PLP-​dependent transferases PLP-​dependent transferases α/β 0.98 0.907 0.07 1.8 1.7 0.36
295 d1a04a2 Nitrate/​nitrite response regulator (NarL),​ receiver domain CheY-​like Flavodoxin-​like α/β 0.97 1.040 0.01 3.1 2.2 0.21
296 d1ls1a2 GTPase domain of the signal sequence recognition protein Ffh P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.97 0.670 0.03 2.2 1.2 0.29
297 d1r2qa_ Rab5a P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.96 0.640 0.01 2.0 2.0 0.25
298 d1svva_ Low-​specificity threonine aldolase PLP-​dependent transferases PLP-​dependent transferases α/β 0.90 0.758 0.03 2.3 1.2 0.35
299 d1o5oa_ Uracil PRTase,​ Upp PRTase-​like PRTase-​like α/β 0.89 0.753 0.01 2.1 1.6 0.27
300 d1dbqa_ Purine repressor (PurR),​ C-​terminal domain Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.88 0.622 0.02 1.6 1.3 0.34
301 d1ax4a_ Tryptophan indol-​lyase (tryptophanase) PLP-​dependent transferases PLP-​dependent transferases α/β 0.87 0.907 0.01 2.4 1.3 0.36
302 d1o98a1 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain α/β 0.86 0.864 0.02 1.1 0.9 0.28
303 d1vc1a_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 0.84 1.140 0.03 2.4 2.4 0.20
304 d1eg7a_ Formyltetrahydrofolate synthetase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.82 0.676 0.05 2.2 0.9 0.32
305 d1s0aa_ Adenosylmethionine-​8-​amino-​7-​oxononanoate aminotransferase,​ BioA PLP-​dependent transferases PLP-​dependent transferases α/β 0.82 0.647 0.02 2.1 1.1 0.36
306 d1eg5a_ NifS-​like protein/​selenocysteine lyase PLP-​dependent transferases PLP-​dependent transferases α/β 0.81 0.728 0.02 1.6 1.4 0.34
307 d1a2oa1 Methylesterase CheB,​ N-​terminal domain CheY-​like Flavodoxin-​like α/β 0.81 1.019 0.02 2.4 2.2 0.23
308 d1dz3a_ Sporulation response regulator Spo0A CheY-​like Flavodoxin-​like α/β 0.81 0.925 0.01 2.3 2.0 0.22
309 d1nata_ Sporulation response regulator Spo0F CheY-​like Flavodoxin-​like α/β 0.80 1.036 0.02 2.8 2.3 0.21
310 d1oxbb_ Response regulator Sin1 CheY-​like Flavodoxin-​like α/β 0.80 1.037 0.04 2.7 2.0 0.22
311 d1drka_ D-​ribose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.79 0.624 0.03 1.9 1.1 0.32
312 d1bmta2 Methionine synthase,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.78 1.328 0.04 2.5 1.6 0.21
313 d1gc0a_ Methionine gamma-​lyase,​ MGL PLP-​dependent transferases PLP-​dependent transferases α/β 0.77 0.616 0.10 2.1 1.3 0.32
314 d1s8na_ Probable two-​component system transcriptional regulator Rv1626 CheY-​like Flavodoxin-​like α/β 0.77 1.034 0.02 2.2 0.8 0.22
315 d1u0sy_ CheY protein CheY-​like Flavodoxin-​like α/β 0.77 0.994 0.02 2.5 2.2 0.21
316 d1dcfa_ Receiver domain of the ethylene receptor CheY-​like Flavodoxin-​like α/β 0.76 1.029 0.05 2.8 2.1 0.21
317 d1ny5a1 Transcriptional activator sigm54 (NtrC1),​ N-​terminal domain CheY-​like Flavodoxin-​like α/β 0.75 1.036 0.01 2.3 2.0 0.21
318 d1nria_ Hypothetical protein HI0754 SIS domain SIS domain α/β 0.74 0.681 0.01 1.5 1.0 0.26
319 d1dbwa_ Transcriptional regulatory protein FixJ,​ receiver domain CheY-​like Flavodoxin-​like α/β 0.73 0.995 0.02 2.6 1.7 0.21
320 d1oi7a1 Succinyl-​CoA synthetase,​ alpha-​chain,​ N-​terminal (CoA-​binding) domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.73 0.727 0.02 2.5 1.9 0.21
321 d1v6sa_ Phosphoglycerate kinase Phosphoglycerate kinase Phosphoglycerate kinase α/β 0.71 0.775 0.03 0.7 0.6 0.36
322 d1k68a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 0.71 1.035 0.01 2.8 1.5 0.22
323 d1n8pa_ Cystathionine gamma-​lyase (CYS3) PLP-​dependent transferases PLP-​dependent transferases α/β 0.71 1.109 0.01 0.5 0.9 0.33
324 d1oi7a2 Succinyl-​CoA synthetase,​ alpha-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.70 0.818 0.07 2.1 1.4 0.21
325 d1qv9a_ F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) α/β 0.70 0.716 0.01 2.4 1.3 0.28
326 d1p2fa2 Response regulator DrrB CheY-​like Flavodoxin-​like α/β 0.69 0.882 0.01 2.6 1.7 0.20
327 d1ibja_ Cystathionine beta-​lyase,​ CBL PLP-​dependent transferases PLP-​dependent transferases α/β 0.68 0.660 0.02 1.9 0.9 0.31
328 d1p3wa_ Cysteine desulfurase IscS PLP-​dependent transferases PLP-​dependent transferases α/β 0.68 0.826 0.04 1.6 1.3 0.34
329 d1jbea_ CheY protein CheY-​like Flavodoxin-​like α/β 0.68 1.037 0.02 2.6 1.7 0.21
330 d1vjoa_ Alanine-​glyoxylate aminotransferase PLP-​dependent transferases PLP-​dependent transferases α/β 0.67 0.826 0.02 1.0 0.9 0.30
331 d1nu0a_ Hypothetical protein YqgF (RuvX) Ribonuclease H-​like Ribonuclease H-​like motif α/β 0.63 0.898 0.02 0.9 1.6 0.18
332 d1ccwa_ Glutamate mutase,​ small subunit Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.62 0.877 0.11 1.6 1.9 0.22
333 d1ta0a_ Carboxy-​terminal domain RNA polymerase II polypeptide A small phosphatase 1,​ NRAMP1 HAD-​like HAD-​like α/β 0.62 0.622 0.02 1.0 1.0 0.23
334 d1qkka_ Transcriptional regulatory protein DctD,​ receiver domain CheY-​like Flavodoxin-​like α/β 0.61 1.033 0.02 2.2 1.1 0.21
335 d1g5ca_ beta-​carbonic anhydrase beta-​carbonic anhydrase,​ cab Resolvase-​like α/β 0.60 0.793 0.04 1.7 1.3 0.19
336 d1mb3a_ Cell division response regulator DivK CheY-​like Flavodoxin-​like α/β 0.59 0.993 0.01 2.4 2.1 0.19
337 d1qcza_ N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) Flavodoxin-​like α/β 0.57 0.804 0.01 1.5 1.6 0.21
338 d2piaa1 Phthalate dioxygenase reductase Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.54 0.933 0.06 2.3 1.4 0.17
339 d1g8ma2 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC Cytidine deaminase-​like α/β 0.54 0.747 0.01 1.4 0.6 0.31
340 d1kgsa2 PhoB receiver domain CheY-​like Flavodoxin-​like α/β 0.52 0.985 0.02 1.9 1.4 0.20
341 d1ml4a1 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.52 0.814 0.02 1.5 1.8 0.16
342 d1fdra1 Ferredoxin reductase (flavodoxin reductase) N-​terminal domain Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.49 0.940 0.01 1.9 1.5 0.17
343 d1qx4a1 cytochrome b5 reductase Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.49 0.681 0.01 1.7 1.3 0.18
344 d1q3qa2 Thermosome,​ A-​domain GroEL apical domain-​like The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 0.47 0.655 0.09 0.7 1.1 0.18
345 d1krha1 Benzoate dioxygenase reductase Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.41 0.990 0.01 2.0 1.4 0.16
346 d1cqxa2 Flavohemoglobin,​ central domain Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.41 0.651 0.01 2.1 0.3 0.17
347 d1qz5a1 Actin Actin-​like ATPase domain Ribonuclease H-​like motif α/β 0.41 0.667 0.01 0.4 1.8 0.18
348 d1b00a_ PhoB receiver domain CheY-​like Flavodoxin-​like α/β 0.40 0.917 0.03 1.6 1.2 0.20
349 d1a8pa1 Ferredoxin reductase (flavodoxin reductase) N-​terminal domain Riboflavin synthase domain-​like Reductase/​isomerase/​elongation factor common domain All β 0.39 1.236 0.01 2.7 0.3 0.17
350 d1xe1a_ Hypothetical protein PF0907 Translation proteins Reductase/​isomerase/​elongation factor common domain All β 0.39 1.023 0.02 2.1 1.6 0.17
351 d1u3da2 Cryptochrome Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 0.33 0.606 0.06 0.4 1.0 0.22
352 d1vl6a2 Malate oxidoreductase (malic enzyme) Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 0.29 0.688 0.01 0.9 1.5 0.18
353 d1jjcb3 Domain B2 of PheRS-​beta,​ PheT Nucleic acid-​binding proteins OB-​fold All β 0.12 0.626 0.02 0.5 1.0 0.14
354 d1hh2p1 S1 domain of NusA Nucleic acid-​binding proteins OB-​fold All β 0.08 0.603 0.01 1.2 1.1 0.12
355 d1vhoa1 Putative endoglucanase TM1048 Aminopeptidase/​glucanase lid domain Domain of alpha and beta subunits of F1 ATP synthase-​like All β -0.13 1.292 0.01 1.0 0.4 0.12
SCOP domains with score worse than the threshold
356 d1uf3a_ Hypothetical protein TT1561 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.85 -0.754 0.01 3.4 2.2 0.35
357 d1f89a_ hypothetical protein yl85 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 1.78 0.546 0.02 3.3 1.7 0.33
358 d1uf5a_ N-​carbamoyl-​D-​aminoacid amidohydrolase Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 1.70 -0.870 0.01 3.0 1.8 0.33
359 d1akoa_ DNA-​repair enzyme exonuclease III DNase I-​like DNase I-​like α+β 1.66 -0.892 0.02 1.9 1.8 0.31
360 d1hp1a2 5'​-​nucleotidase (syn. UDP-​sugar hydrolase),​ N-​terminal domain Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.63 0.495 0.01 2.6 1.4 0.39
361 d1kbla2 Pyruvate phosphate dikinase,​ central domain Phosphohistidine domain The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 1.60 -0.903 0.04 4.4 2.7 0.22
362 d1tf7a2 Circadian clock protein KaiC P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.58 0.498 0.05 2.8 1.8 0.29
363 d1s3la_ Putative phosphodiesterase MJ0936 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.57 -0.763 0.01 1.8 1.8 0.28
364 d1ihua2 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.54 0.487 0.01 3.2 1.6 0.29
365 d1cr1a_ Gene 4 protein (g4p,​ DNA primase),​ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.54 0.501 0.04 3.1 2.2 0.26


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1twia2 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.76  Contact: 2586
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.33 LBcontacta:1.00 LBcontactb:1.00 LHM:0.15
id:1.00 blosum:0.92 compass:0.99 pearson:1.00
Scaled scores:
dali:0.75 daliz:0.55 gdtts:0.63 tmscore:0.81 rmsd:0.83 AHM:0.70 LBcontacta:0.48 LBcontactb:0.69 LHM:0.52
id:0.12 blosum:0.18 compass:0.46 pearson:0.47

hit structure      alignment
DALI alignment (Z-score: 20.6 Raw score:1900.40)
Query          1 mietpyyliDKAKLTRNMERIAHVREKSG------AKALLALKCFATWSVFDLMRDYMDG     54
d1twia2        1 ---------SEEQIKINYNRYIEAFKRWEeetgkeFIVAYAYKANANLAITRLLAKLGCG     51

Query         55 TTSSSLFEVRLGRERFGK--ETHAYSVAYGDNEIDEVVSH-ADKIIFNSISQLERFADKA    111
d1twia2       52 ADVVSGGELYIAKLSNVPskKIVFNGNCKTKEEIIMGIEAnIRAFNVDSISELILINETA    111

Query        112 ----AGIARGLRLNPQ----------------RLGEW----DVPKVERVMD-----RING    142
d1twia2      112 kelgETANVAFRINPNvnpkthpkistglkknKFGLDvesgIAMKAIKMALemeyvNVVG    171

Query        143 FMIHNNCENKDFGLFDRMLGEIEERFGAL---iARVDWVSLGGGIH----ftgDDYPVDA    195
d1twia2      172 VHCHIGSQLTDISPFIEETRKVMDFVVELkeegIEIEDVNLGGGLGipyykdkQIPTQKD    231

Query        196 FSARLRAFSDR-----YGVQIYLEPGEASITKSttlevtvldtlynknlaivdssieahm    250
d1twia2      232 LADAIINTMLKykdkvEMPNLILEPGRSLVATA---------------------------    264

Query        251 ldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmv    310
d1twia2      265 ------------------------------------------------------------    265

Query        311 kknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1twia2      265 --------------------------------------    265


hit structure      alignment
FAST alignment (Normalized score: 11.66 Raw score:3534.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS-------GAKALLALKCFATWSVFDLMRDYM-     52
d1twia2        1 ---------SEEQIKINYNRYIEAFKR-WEEETGKEFIVAYAYKANANLAITRLLAK--L     48

Query         53 -DGTTSSSLFEVRLGRERFGK------ETHAYSVAYGDNEIDEVVS-HADKIIFNSISQL    104
d1twia2       49 GCGADVVSGGELYIAKL----SNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISEL    104

Query        105 ERFADKAA-----GIARGLRLNP-----------------QRLGEWDV----PKVERVMD    138
d1twia2      105 ILINETA-KELGETANVAFRIN-PNVNPKTHPKISTGLKKNKFGL---DVESGIAMKAIK    159

Query        139 --------RINGFMIHNNCENKDFGLFDRMLGEIEERFGALIA-------RVDWVSLGGG    183
d1twia2      160 MALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVV----ELKEEGIEIEDVNLGGG    215

Query        184 IHFTGDDY-----------PVDAFSARLRAFSDRY------GVQIYLEPGEASITKSTTL    226
d1twia2      216 L-------GIPYYKDKQIPTQKDLADAIINTMLK-YKDKVEMPNLILEPGRSLVA-----    262

Query        227 EVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGE    286
d1twia2      263 ------------------------------------------------------------    263

Query        287 FRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1twia2      263 ------------------------------------------------------------    263

Query        347 LS--    348
d1twia2      263 --TA    264


hit structure      alignment
TMalign alignment (TM-score: 0.55 Raw score:190.21)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSG------AKALLALKCFATWSVFDLMRDYMDG     54
d1twia2        1 ---------SEEQIKINYNRYIEAFKRWEEETGKEFIVAYAYKANANLAITRLLAKLGCG     51

Query         55 TTSSSLFEVRLGRERFGK--ETHAYSVAYGDNEIDEVVSH-ADKIIFNSISQLERFADKA    111
d1twia2       52 ADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETA    111

Query        112 ----AGIARGLRLNP-------------Q---RLGEW--DV--PKVERVMD----R-ING    142
d1twia2      112 KELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMALEMEYVNVVG    171

Query        143 FMIHNNCENKDFGLFDRMLGEIEERFGALI---ARVDWVSLGGGIHFTG----DDYPVDA    195
d1twia2      172 VHCHIGSQLTDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYYKDKQIPTQKD    231

Query        196 FSARLRA-FS-DR--Y-GVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHM    250
d1twia2      232 LADAIINTMLKYKDKVEMPNLILEPGRSLVATA---------------------------    264

Query        251 LDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMV    310
d1twia2      265 ------------------------------------------------------------    265

Query        311 KKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1twia2      265 --------------------------------------    265


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       *******************       **********************************
Query         10 DKAKLTRNMERIAHVREKS------GAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEV     63
d1twia2        1 SEEQIKINYNRYIEAFKRWEEETGKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGEL     60

DALI match       ********* ....... *************.. *****************    *****
Query         64 RLGRERFGK-ETHAYSV-AYGDNEIDEVVSHAD-KIIFNSISQLERFADKA----AGIAR    116
d1twia2       61 YIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANV    120

DALI match       ******                 *****..     ........    *************
Query        117 GLRLNP----------------QRLGEWDV-----PKVERVMD----RINGFMIHNNCEN    151
d1twia2      121 AFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMALEMEYVNVVGVHCHIGSQL    180

DALI match       ********************    *************   ...    *************
Query        152 KDFGLFDRMLGEIEERFGAL---IARVDWVSLGGGIHFTGDDY----PVDAFSARLRAFS    204
d1twia2      181 TDISPFIEETRKVMDFVVELKEEGIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTM    240

DALI match              *****************
Query        205 -----DRYGVQIYLEPGEASITKS    223
d1twia2      241 LKYKDKVEMPNLILEPGRSLVATA    264



top
2: d1knwa2 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.74  Contact: 2435
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.33 LBcontacta:1.00 LBcontactb:1.00 LHM:0.12
id:1.00 blosum:1.00 compass:0.99 pearson:1.00
Scaled scores:
dali:0.75 daliz:0.54 gdtts:0.60 tmscore:0.79 rmsd:0.82 AHM:0.72 LBcontacta:0.45 LBcontactb:0.68 LHM:0.58
id:0.13 blosum:0.23 compass:0.46 pearson:0.47

hit structure      alignment
DALI alignment (Z-score: 19.8 Raw score:1758.40)
Query          1 mietpyylidkaKLTRNMERIAHVRekSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d1knwa2        1 ------------DAQIIRRQIAALK--QFDVVRFAQKACSNIHILRLMREQGVKVDSVSL     46

Query         61 FEVRLGRERFGK------ETHAYSVAYGDNEIDEVVSHaDKIIFNSISQLERFADKAAGI    114
d1knwa2       47 GEIERALAAGYNpqthpdDIVFTADVIDQATLERVSELqIPVNAGSVDMLDQLGQVSPGH    106

Query        115 ARGLRLNPQ----------------RLGEW--DVPKVERVMD----RINGFMIHNNCeNK    152
d1knwa2      107 RVWLRVNPGfghghsqktntggensKHGIWytDLPAALDVIQrhhlQLVGIHMHIGS-GV    165

Query        153 DFGLFDRMLGEIEERFGALIARVDWVSLGGGIHF----tgDDYPVDAFSARLRAFSDRYG    208
d1knwa2      166 DYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVpyqqgeEAVDTEHYYGLWNAAREQIA    225

Query        209 ------VQIYLEPGEASITKsttlevtvldtlynknlaivdssieahmldlliyretakv    262
d1knwa2      226 rhlghpVKLEIEPGRFLVAQ----------------------------------------    245

Query        263 lpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpa    322
d1knwa2      246 ------------------------------------------------------------    246

Query        323 iaireldgsvrtvreftyadyeqsls    348
d1knwa2      246 ------------------------sg    247


hit structure      alignment
FAST alignment (Normalized score: 11.38 Raw score:3336.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSG--AKALLALKCFATWSVFDLMRDYM--DGTT     56
d1knwa2        1 ---------DAQIIRRQIAALK-------QFDVVRFAQKACSNIHILRLMRE--QGVKVD     42

Query         57 SSSLFEVRLGRERFGK-----------ETHAYSVAYGDNEIDEVVSHA--DKIIFNSISQ    103
d1knwa2       43 SVSLGEIERAL-----AAGYNPQTHPDDIVFTADVIDQATLERVSE--LQIPVNAGSVDM     95

Query        104 LERFADKAAGIARGLRLNP-----------------QRLGEW---DVPKVERVMD-----    138
d1knwa2       96 LDQLGQVSPGHRVWLRVN-PGFGHGHSQKTNTGGENSKHGI-WYTDLPAALDV--IQRHH    151

Query        139 -RINGFMIHNNCE---NKDFGLFDRMLGEIEERFGALIA----RVDWVSLGGGIHFTGD-    189
d1knwa2      152 LQLVGIHMH----IGSGVDYAHLEQVCGAMVRQVI----EFGQDLQAISAGGG------L    197

Query        190 ---------DYPVDAFSARLRAFSDRY-------GVQIYLEPGEASITKSTTLEVTVLDT    233
d1knwa2      198 SVPYQQGEEAVDTEHYYGLWNAAREQ-IARHLGHPVKLEIEPGRFLVAQ-----------    245

Query        234 LYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEEL    293
d1knwa2      246 ------------------------------------------------------------    246

Query        294 KVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--    348
d1knwa2      246 -------------------------------------------------------SG    247


hit structure      alignment
TMalign alignment (TM-score: 0.53 Raw score:185.85)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d1knwa2        1 ---------DAQIIRRQIAAL-KQF---D-VVRFAQKACSNIHILRLMREQGVKVDSVSL     46

Query         61 FEVRLGRERFG----K--ETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKAAGI    114
d1knwa2       47 GEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGH    106

Query        115 ARGLRLNPQ----------------RLGE-WD-VPKVERVMD---RIN-GFMIHNNCENK    152
d1knwa2      107 RVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGS-GV    165

Query        153 DFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFT----GDDYPVDAFSARLRAFSDRYG    208
d1knwa2      166 DYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIA    225

Query        209 ------VQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKV    262
d1knwa2      226 RHLGHPVKLEIEPGRFLVAQSG--------------------------------------    247

Query        263 LPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d1knwa2      248 ------------------------------------------------------------    248

Query        323 IAIRELDGSVRTVREFTYADYEQSLS    348
d1knwa2      248 --------------------------    248


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       .  .............     ***************************************
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRER     69
d1knwa2        1 DAQIIRRQIAALKQFD-----VVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAA     55

DALI match       ***        ****************** ******************************
Query         70 FGKET------HAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKAAGIARGLRLNPQ    123
d1knwa2       56 GYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPG    115

DALI match                       *****.....      .....***********.. *********
Query        124 ----------------RLGEWDVPKV------ERVMDRINGFMIHNNCENKDFGLFDRML    161
d1knwa2      116 FGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGV-DYAHLEQVC    174

DALI match       *************************  ..    *****************       ***
Query        162 GEIEERFGALIARVDWVSLGGGIHFTGDD----YPVDAFSARLRAFSDRY------GVQI    211
d1knwa2      175 GAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKL    234

DALI match       ***********  
Query        212 YLEPGEASITKST    224
d1knwa2      235 EIEPGRFLVAQSG    247



top
3: d7odca2 Eukaryotic ornithine decarboxylase (hh: 1.000)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.69  Contact: 2470
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.31 AHM:0.35 LBcontacta:1.00 LBcontactb:1.00 LHM:0.12
id:1.00 blosum:0.92 compass:0.99 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.51 gdtts:0.56 tmscore:0.76 rmsd:0.80 AHM:0.67 LBcontacta:0.44 LBcontactb:0.66 LHM:0.56
id:0.09 blosum:0.18 compass:0.45 pearson:0.47

hit structure      alignment
DALI alignment (Z-score: 19.4 Raw score:1731.40)
Query          1 mietpyyliDKAKLTRNMERIAHVREksGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d7odca2        1 ---------DLGDILKKHLRWLKALP--RVTPFYAVKCNDSRAIVSTLAAIGTGFDCASK     49

Query         61 FEVRLGRE-RFGK-ETHAYSVAYGDNEIDEVV-SHADKIIFNSISQLERFADKAAGIARG    117
d7odca2       50 TEIQLVQGlGVPAeRVIYANPCKQVSQIKYAAsNGVQMMTFDSEIELMKVARAHPKAKLV    109

Query        118 LRLNPqRLGEW--DVPKVERVMD----RINGFMIHNNCENkdfGLFDrMLGEIEERFGAL    171
d7odca2      110 LRIAT-KFGATlkTSRLLLERAKelniDVIGVSFHVGSGC---TDPD-TFVQAVSDARCV    164

Query        172 IA-------RVDWVSLGGGIHfTGDDY--PVDAFSARLRAFSDRYG-----VQIYLEPGE    217
d7odca2      165 FDmatevgfSMHLLDIGGGFP-GSEDTklKFEEITSVINPALDKYFpsdsgVRIIAEPGR    223

Query        218 ASITKSttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgks    277
d7odca2      224 YYVASA------------------------------------------------------    229

Query        278 clagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvre    337
d7odca2      230 ------------------------------------------------------------    230

Query        338 ftyadyeqsls    348
d7odca2      230 -----------    230


hit structure      alignment
FAST alignment (Normalized score: 11.24 Raw score:3173.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREK--SGAKALLALKCFATWSVFDLMRDYM--DGTT     56
d7odca2        1 ---------DLGDILKKHLRWLK----ALPRVTPFYAVKCNDSRAIVSTLAA--IGTGFD     45

Query         57 SSSLFEVRLGRERFGK------ETHAYSVAYGDNEIDEVVS-HADKIIFNSISQLERFAD    109
d7odca2       46 CASKTEIQLVQG----LGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVAR    101

Query        110 KAAGIARGLRLNPQRLGEWDVPKVERVMD-------RINGFMIHNN--CENKDFGLFDRM    160
d7odca2      102 AHPKAKLVLRIA-TKFG-ATLKTSRLLLERAKELNIDVIGVSFH--VGSGCTDPDTFVQA    157

Query        161 LGEIEERFGALIA----------RVDWVSLGGGIHFTG------DDYPVDAFSARLRAFS    204
d7odca2      158 VSDARC-------VFDMATEVGFSMHLLDIGGG-----FPGSEDTKLKFEEITSVINPAL    205

Query        205 DR-----YGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRET    259
d7odca2      206 DKYFPSDSGVRIIAEPGRYYVAS-------------------------------------    228

Query        260 AKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVK    319
d7odca2      229 ------------------------------------------------------------    229

Query        320 MPAIAIRELDGSVRTVREFTYADYEQSLS-    348
d7odca2      229 -----------------------------A    229


hit structure      alignment
TMalign alignment (TM-score: 0.53 Raw score:182.79)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d7odca2        1 ---------DLGDILKKHLRWLKAL-PR-VTPFYAVKCNDSRAIVSTLAAIGTGFDCASK     49

Query         61 FEVRLGRERFGK--ETHAYSVAYGDNEIDEVVSH-ADKIIFNSISQLERFADKAAGIARG    117
d7odca2       50 TEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLV    109

Query        118 LRLNPQRLGEW--DVPKVERVMD---R-INGFMIHNNCENKDFGLFDRMLGEIEERFGAL    171
d7odca2      110 LRIAT-KFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARC-VFDM    167

Query        172 IA----RVDWVSLGGGIHFTG----DDYP-VDAFSARLRAFSDR-YGVQIYLEPGEASIT    221
d7odca2      168 ATEVGFSMHLLDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVA    227

Query        222 KSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAG    281
d7odca2      228 SA----------------------------------------------------------    229

Query        282 DVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYA    341
d7odca2      230 ------------------------------------------------------------    230

Query        342 DYEQSLS    348
d7odca2      230 -------    230


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ****************  .****************************************.
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRER     69
d7odca2        1 DLGDILKKHLRWLKAL--PRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGL     58

DALI match       ...........  **********.... **************************** ***
Query         70 FGKETHAYSVA--YGDNEIDEVVSHAD-KIIFNSISQLERFADKAAGIARGLRLNPQRLG    126
d7odca2       59 GVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIAT-KFG    117

DALI match       **..........       ************.  .... .......          ****
Query        127 EWDVPKVERVMDR------INGFMIHNNCENKDFGLFDRMLGEIEE---RFGALIARVDW    177
d7odca2      118 ATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHL    177

DALI match       ********..... .****************      ***************
Query        178 VSLGGGIHFTGDD-YPVDAFSARLRAFSDRY-----GVQIYLEPGEASITKS    223
d7odca2      178 LDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASA    229



top
4: d1hkva2 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.66  Contact: 2410
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.15
id:1.00 blosum:0.92 compass:0.99 pearson:1.00
Scaled scores:
dali:0.75 daliz:0.54 gdtts:0.60 tmscore:0.78 rmsd:0.81 AHM:0.73 LBcontacta:0.50 LBcontactb:0.71 LHM:0.50
id:0.11 blosum:0.18 compass:0.48 pearson:0.49

hit structure      alignment
DALI alignment (Z-score: 19.0 Raw score:1797.70)
Query          1 mietpyyliDKAKLTRNMERIAHVREksgaKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d1hkva2        1 ---------DEDDFRSRCRETAAAFG-sgaNVHYAAKAFLCSEVARWISEEGLCLDVCTG     50

Query         61 FEVRLGRERFGK--ETHAYSVAYGDNEIDEVV-SHADKIIFNSISQLERFADKA----AG    113
d1hkva2       51 GELAVALHASFPpeRITLHGNNKSVSELTAAVkAGVGHIVVDSMTEIERLDAIAgeagIV    110

Query        114 IARGLRLNPQ----------------RLGEW----DVPKVERVMD-----RINGFMIHNN    148
d1hkva2      111 QDVLVRLTVGveahthefistahedqKFGLSvasgAAMAAVRRVFatdhlRLVGLHSHIG    170

Query        149 CENKDFGLFDRMLGEIEERFGAL--------iaRVDWVSLGGGIH----ftgDDYPVDAF    196
d1hkva2      171 SQIFDVDGFELAAHRVIGLLRDVvgefgpektaQIATVDLGGGLGisylpsdDPPPIAEL    230

Query        197 SARLRAFSDR-------YGVQIYLEPGEASITKSTtlevtvldtlynknlaivdssieah    249
d1hkva2      231 AAKLGTIVSDestavglPTPKLVVEPGRAIAGPGT-------------------------    265

Query        250 mldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytm    309
d1hkva2      266 ------------------------------------------------------------    266

Query        310 vkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1hkva2      266 ---------------------------------------    266


hit structure      alignment
FAST alignment (Normalized score: 10.67 Raw score:3241.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGA-----KALLALKCFATWSVFDLMRDYM--D     53
d1hkva2        1 ---------DEDDFRSRCRETAAA------FGSGANVHYAAKAFLCSEVARWISE--EGL     43

Query         54 GTTSSSLFEVRLGRERFGK------ETHAYSVAYGDNEIDEVVS-HADKIIFNSISQLER    106
d1hkva2       44 CLDVCTGGELAVALH----ASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIER     99

Query        107 FADKAA-----GIARGLRLNP-----------------QRLGEWDV----PKVERVMD--    138
d1hkva2      100 LDAIA-GEAGIVQDVLVRLT-VGVEAHTHEFISTAHEDQKFGL---SVASGAAMAAVRRV    154

Query        139 ------RINGFMIHNNCENKDFGLFDRMLGEIEERFGALIAR----------------VD    176
d1hkva2      155 FATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIG--------LLRDVVGEFGPEKTAQIA    206

Query        177 WVSLGGGIHFTGDDY------------PVDAFSARLRAFSDRY--------GVQIYLEPG    216
d1hkva2      207 TVDLGGG--------LGISYLPSDDPPPIAELAAKLGTIVSD-ESTAVGLPTPKLVVEPG    257

Query        217 EASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGK    276
d1hkva2      258 RAIAGPG-----------------------------------------------------    264

Query        277 SCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVR    336
d1hkva2      265 ------------------------------------------------------------    265

Query        337 EFTYADYEQSLS-    348
d1hkva2      265 ------------T    265


hit structure      alignment
TMalign alignment (TM-score: 0.54 Raw score:186.58)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d1hkva2        1 ---------DEDDFRSRCRETAAAFG-SGANVHYAAKAFLCSEVARWISEEGLCLDVCTG     50

Query         61 FEVRLGRER-FG-KETHAYSVAYGDNEIDEVVSH-ADKIIFNSISQLERFADKAA---G-    113
d1hkva2       51 GELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIV    110

Query        114 IARGLRLNPQ----------------RLGEW---D-VPKVERVMD-R---IN-GFMIHNN    148
d1hkva2      111 QDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIG    170

Query        149 CENKDFGLFDRMLGEIEERFGALI----A--R--VDWVSLGGGIHFT-----GDDYPVDA    195
d1hkva2      171 SQIFDVDGFELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAEL    230

Query        196 FSARLRAFS--DR----YGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAH    249
d1hkva2      231 AAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGT-------------------------    265

Query        250 MLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTM    309
d1hkva2      266 ------------------------------------------------------------    266

Query        310 VKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1hkva2      266 ---------------------------------------    266


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       *****************    ***************************************
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRER     69
d1hkva2        1 DEDDFRSRCRETAAAFG-SGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHA     59

DALI match       ***......  ************.... *****************....    *******
Query         70 FGKETHAYS--VAYGDNEIDEVVSHAD-KIIFNSISQLERFADKAAGIA----RGLRLNP    122
d1hkva2       60 SFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTV    119

DALI match                        *****...  .......        ******************
Query        123 ----------------QRLGEWDVP--KVERVMDR-------INGFMIHNNCENKDFGLF    157
d1hkva2      120 GVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGF    179

DALI match       **************          ************   ....    *************
Query        158 DRMLGEIEERFGAL--------IARVDWVSLGGGIHFTGDDYP----VDAFSARLRAFSD    205
d1hkva2      180 ELAAHRVIGLLRDVVGEFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVS    239

DALI match       *        ****************
Query        206 RY-------GVQIYLEPGEASITKS    223
d1hkva2      240 DESTAVGLPTPKLVVEPGRAIAGPG    264



top
5: d1twia1 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: Alanine racemase C-​terminal domain-​like  |  SCOP Fold: Domain of alpha and beta subunits of F1 ATP synthase-​like  |  SCOP Class: All beta proteins

Consensus: 0.71  Contact: 1423
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.22 AHM:0.27 LBcontacta:1.00 LBcontactb:0.99 LHM:0.14
id:1.00 blosum:1.00 compass:0.99 pearson:1.00
Scaled scores:
dali:0.85 daliz:0.68 gdtts:0.80 tmscore:0.87 rmsd:0.89 AHM:0.81 LBcontacta:0.68 LBcontactb:0.78 LHM:0.51
id:0.19 blosum:0.29 compass:0.52 pearson:0.51

hit structure      alignment
DALI alignment (Z-score: 15.7 Raw score:1022.10)
Query          1 --------------------------MIETPYYLIdkakltrnmeriahvreksgakall     34
d1twia1        1 mlgndtveikdgrffidgydaielaeKFGTPLYVM-------------------------     35

Query         35 alkcfatwsvfdlmrdymdgttssslfevrlgrerfgkethaysvaygdneidevvshad     94
d1twia1       36 ------------------------------------------------------------     36

Query         95 kiifnsisqlerfadkaagiarglrlnpqrlgewdvpkvervmdringfmihnncenkdf    154
d1twia1       36 ------------------------------------------------------------     36

Query        155 glfdrmlgeieerfgaliarvdwvslgggihftgddypvdafsarlrafsdrygvqiyle    214
d1twia1       36 ------------------------------------------------------------     36

Query        215 pgeasitksTTLEVTVLDTLYN--KNLAIVDSSIeAHMLDLLIYRETAKVL---pneGSH    269
d1twia1       36 ---------GYLLGKVHHIKETpvTKWVMIDAGM-NDMMRPAMYEAYHHIInckvknEKE     85

Query        270 SYMICGKSCLAGDVFGE-FRFAeELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL    328
d1twia1       86 VVSIAGGLCESSDVFGRdRELD-KVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSK    144

Query        329 DgSVRTVRE-FTYADYeQSLS-------    348
d1twia1      145 K-GVFLIRErETYADL-IAKDivpphll    170


hit structure      alignment
FAST alignment (Normalized score: 8.50 Raw score:2067.00)
Query          1 --------------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALL     34
d1twia1        1 MLGNDTVEIKDGRFFIDGYDAIELAEKFGTPLY---------------------------     33

Query         35 ALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHAD     94
d1twia1       34 ------------------------------------------------------------     34

Query         95 KIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDF    154
d1twia1       34 ------------------------------------------------------------     34

Query        155 GLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLE    214
d1twia1       34 ------------------------------------------------------------     34

Query        215 PGEASITKS--TTLEVTVLDTLY---NKNLAIVDSSIEAHMLDLLIYRETAKVLPNEG--    267
d1twia1       34 ---------VMGYLLGKVHHIK-ETPVTKWVMIDAG-MNDMMRPAMYEAYHH------II     76

Query        268 -------SHSYMICGKSCLAGDVF-GEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVK    319
d1twia1       77 NCKVKNEKEVVSIAGGLCESSDVFGRDREL-DKVEVGDVLAIFDVGAYGISMANNYNARG    135

Query        320 MPAIAIRELDGSVRTV-REFTYADYEQSLS-------    348
d1twia1      136 RPRMVLTSK-KGVFLIRERETYADLIAKD-IVPPHLL    170


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:122.00)
Query          1 --------------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALL     34
d1twia1        1 MLGNDTVEIKDGRFFIDGYDAIELAEKFGTPLYVM-------------------------     35

Query         35 ALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHAD     94
d1twia1       36 ------------------------------------------------------------     36

Query         95 KIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDF    154
d1twia1       36 ------------------------------------------------------------     36

Query        155 GLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLE    214
d1twia1       36 ------------------------------------------------------------     36

Query        215 PGEASITKSTTLEVTVLDTLYN--KNLAIVDSSIEAHMLDLLIYRETAKVLP--NE--GS    268
d1twia1       36 ---------GYLLGKVHHIKETPVTKWVMIDAGM-NDMMRPAMYEAYHHIINCK-VKNEK     84

Query        269 HSYMICGKSCLAGDVFGE-FRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRE    327
d1twia1       85 EVVSIAGGLCESSDVFGRDRELDK-VEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTS    143

Query        328 LDGSVRTVREF-TYADYEQSLS------    348
d1twia1      144 KK-GVFLIRERETYADLIAKDIVPPHLL    170


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match                       ************  .**********. ***************  
Query        208 GVQIYLEPGEASITKSTTLEVTVLDTLY--NKNLAIVDSSIEAHMLDLLIYRETAKVLP-    264
d1twia1       21 AIELAEKFGTPLYV-MGYLLGKVHHIKETPVTKWVMIDAGMN-DMMRPAMYEAYHHIINC     78

DALI match           ********************.... *******************************
Query        265 --NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d1twia1       79 KVKNEKEVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPR    138

DALI match       *******........******...
Query        323 IAIRELDGSVRTVREFTYADYEQS    346
d1twia1      139 MVLTSKKGVFLIRERETYADLIAK    162



hit structures. 
top
6: d1hkva1 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: Alanine racemase C-​terminal domain-​like  |  SCOP Fold: Domain of alpha and beta subunits of F1 ATP synthase-​like  |  SCOP Class: All beta proteins

Consensus: 0.71  Contact: 1374
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.21 AHM:0.24 LBcontacta:1.00 LBcontactb:0.99 LHM:0.16
id:1.00 blosum:0.98 compass:0.94 pearson:1.00
Scaled scores:
dali:0.85 daliz:0.68 gdtts:0.80 tmscore:0.88 rmsd:0.90 AHM:0.82 LBcontacta:0.70 LBcontactb:0.80 LHM:0.47
id:0.14 blosum:0.23 compass:0.39 pearson:0.39

hit structure      alignment
DALI alignment (Z-score: 15.4 Raw score:1032.10)
Query          1 -----------------------------------MIETPYYLIdkakltrnmeriahvr     25
d1hkva1        1 nellhlapnvwprnttrdevgvvciagipltqlaqEYGTPLFVI----------------     44

Query         26 eksgakallalkcfatwsvfdlmrdymdgttssslfevrlgrerfgkethaysvaygdne     85
d1hkva1       45 ------------------------------------------------------------     45

Query         86 idevvshadkiifnsisqlerfadkaagiarglrlnpqrlgewdvpkvervmdringfmi    145
d1hkva1       45 ------------------------------------------------------------     45

Query        146 hnncenkdfglfdrmlgeieerfgaliarvdwvslgggihftgddypvdafsarlrafsd    205
d1hkva1       45 ------------------------------------------------------------     45

Query        206 rygvqiylepgeasitkstTLEVTVLDTLYN-------KNLAIVDSSIeAHMLDLLIYRE    258
d1hkva1       45 -------------------ITLYEVGTVKDVdvsatahRRYVSVDGGM-SDNIRTALYGA     84

Query        259 TAKVL-----pneGSHSYMICGKSCLAGDVFG-EFRFAEELKVGDRISFQDAAGYTMVKK    312
d1hkva1       85 QYDVRlvsrvsdaPPVPARLVGKHCESGDIIVrDTWVPDDIRPGDLVAVAATGAYCYSLS    144

Query        313 NWFNGVKMPAIAIRELDgSVRTVRE-FTYADYEQSLS-    348
d1hkva1      145 SRYNMVGRPAVVAVHAG-NARLVLRrETVDDLLSLEVr    181


hit structure      alignment
FAST alignment (Normalized score: 8.24 Raw score:2069.00)
Query          1 -----------------------------------MIETPYYLIDKAKLTRNMERIAHVR     25
d1hkva1        1 NELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLF------------------     42

Query         26 EKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNE     85
d1hkva1       43 ------------------------------------------------------------     43

Query         86 IDEVVSHADKIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMI    145
d1hkva1       43 ------------------------------------------------------------     43

Query        146 HNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSD    205
d1hkva1       43 ------------------------------------------------------------     43

Query        206 RYGVQIYLEPGEASITKS-TTLEVTVLDTLYN---------KNLAIVDSSIEAHMLDLLI    255
d1hkva1       43 ------------------VIITLYEVGTVK--DVDVSATAHRRYVSVDG-GMSDNIRTAL     81

Query        256 YRETAKVLPNEG----------SHSYMICGKSCLAGDV-FGEFRFAEELKVGDRISFQDA    304
d1hkva1       82 YGAQYDV-----RLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAAT    136

Query        305 AGYTMVKKNWFNGVKMPAIAIRELDGSVRTV-REFTYADYEQSLS---    348
d1hkva1      137 GAYCYSLSSRYNMVGRPAVVAVH-AGNARLVLRRETVDDLLSL--EVR    181


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:122.20)
Query          1 -----------------------------------MIETPYYLIDKAKLTRNMERIAHVR     25
d1hkva1        1 NELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVI----------------     44

Query         26 EKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNE     85
d1hkva1       45 ------------------------------------------------------------     45

Query         86 IDEVVSHADKIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMI    145
d1hkva1       45 ------------------------------------------------------------     45

Query        146 HNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSD    205
d1hkva1       45 ------------------------------------------------------------     45

Query        206 RYGVQIYLEPGEASITKSTTLEVTVLDTLYN-------KNLAIVDSSIEAHMLDLLIYRE    258
d1hkva1       45 -------------------ITLYEVGTVKDVDVSATAHRRYVSVDGGM-SDNIRTALYGA     84

Query        259 TAKVLP------NEGSHSYMICGKSCLAGDVFG-EFRFAEELKVGDRISFQDAAGYTMVK    311
d1hkva1       85 QYDVRLVSRVSD-APPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSL    143

Query        312 KNWFNGVKMPAIAIRELDGSVRTVRE-FTYADYEQSLS-    348
d1hkva1      144 SSRYNMVGRPAVVAVHAG-NARLVLRRETVDDLLSLEVR    181


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match                                            . ..               ****
Query        189 DDYPVDAFSARLRAFSDRYG---VQIYLEPGEASITKSTTL---EVTVLDTLYN--KNLA    240
d1hkva1        8 PNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIITLYEVGTVKDVDVSATAHRRYV     67

DALI match       ******. ***************        *******************....... **
Query        241 IVDSSIEAHMLDLLIYRETAKVL-----PNEGSHSYMICGKSCLAGDVFGEFRFAEE-LK    294
d1hkva1       68 SVDGGMS-DNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDDIR    126

DALI match       ***********************************........*********
Query        295 VGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1hkva1      127 PGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSL    178



top
7: d1knwa1 Diaminopimelate decarboxylase LysA (hh: 1.000)

SCOP Superfamily: Alanine racemase C-​terminal domain-​like  |  SCOP Fold: Domain of alpha and beta subunits of F1 ATP synthase-​like  |  SCOP Class: All beta proteins

Consensus: 0.66  Contact: 1336
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.21 AHM:0.23 LBcontacta:1.00 LBcontactb:0.99 LHM:0.20
id:1.00 blosum:1.00 compass:0.98 pearson:1.00
Scaled scores:
dali:0.85 daliz:0.68 gdtts:0.79 tmscore:0.86 rmsd:0.89 AHM:0.83 LBcontacta:0.69 LBcontactb:0.79 LHM:0.43
id:0.14 blosum:0.26 compass:0.47 pearson:0.47

hit structure      alignment
DALI alignment (Z-score: 15.0 Raw score:988.00)
Query          1 ---------------------MIETPYYLIdkakltrnmeriahvreksgakallalkcf     39
d1knwa1        1 phslfstdtdltaenllrlpaEFGCPVWVY------------------------------     30

Query         40 atwsvfdlmrdymdgttssslfevrlgrerfgkethaysvaygdneidevvshadkiifn     99
d1knwa1       31 ------------------------------------------------------------     31

Query        100 sisqlerfadkaagiarglrlnpqrlgewdvpkvervmdringfmihnncenkdfglfdr    159
d1knwa1       31 ------------------------------------------------------------     31

Query        160 mlgeieerfgaliarvdwvslgggihftgddypvdafsarlrafsdrygvqiylepgeas    219
d1knwa1       31 ------------------------------------------------------------     31

Query        220 itkstTLEVTVLDTLYN--KNLAIVDSSIeAHMLDLLIYRETAKVL---------pneGS    268
d1knwa1       31 -----VLITQVRSVKQMgsRHFVLVDAGF-NDLMRPAMYGSYHHISalaadgrslehaPT     84

Query        269 HSYMICGKSCLAGDVFG--------EFRFaEELKVGDRISFQDAAGYTMVKKNWFNGVKM    320
d1knwa1       85 VETVVAGPLCESGDVFTqqeggnveTRAL-PEVKAGDYLVLHDTGAYGASMSSNYNSRPL    143

Query        321 PAIAIRELdGSVRTVREFTYadYEQSLS------    348
d1knwa1      144 LPEVLFDN-GQARLIRRRQT--IEELLAlellhh    174


hit structure      alignment
FAST alignment (Normalized score: 8.04 Raw score:1978.00)
Query          1 ---------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF     39
d1knwa1        1 PHSLFSTDTDLTAENLLRLPAEFGCPVW--------------------------------     28

Query         40 ATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFN     99
d1knwa1       29 ------------------------------------------------------------     29

Query        100 SISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDR    159
d1knwa1       29 ------------------------------------------------------------     29

Query        160 MLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEAS    219
d1knwa1       29 ------------------------------------------------------------     29

Query        220 ITKS-TTLEVTVLDTLYN----KNLAIVDSSIEAHMLDLLIYRETAKVLPNEG-------    267
d1knwa1       29 ----VYVLITQVRSVK--QMGSRHFVLVDAG-FNDLMRPAMYGSYHHI-----SALAADG     76

Query        268 -------SHSYMICGKSCLAGDV--------FGEFRFAEELKVGDRISFQDAAGYTMVKK    312
d1knwa1       77 RSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRAL-PEVKAGDYLVLHDTGAYGASMS    135

Query        313 NWFNGVKMPAIAIRELDGSVRTV-REFTYADYEQSLS-----    348
d1knwa1      136 SNYNSRPLLPEVLFD-NGQARLIRRRQTIEELLAL--ELLHH    174


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:120.59)
Query          1 ---------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF     39
d1knwa1        1 PHSLFSTDTDLTAENLLRLPAEFGCPVWVY------------------------------     30

Query         40 ATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFN     99
d1knwa1       31 ------------------------------------------------------------     31

Query        100 SISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDR    159
d1knwa1       31 ------------------------------------------------------------     31

Query        160 MLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEAS    219
d1knwa1       31 ------------------------------------------------------------     31

Query        220 ITKSTTLEVTVLDTLYN--KNLAIVDSSIEAHMLDLLIYRETAKVLP--------NE-GS    268
d1knwa1       31 -----VLITQVRSVKQMGSRHFVLVDAGF-NDLMRPAMYGSYHHISALAADGRSLEHAPT     84

Query        269 HSYMICGKSCLAGDVFG--------EFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKM    320
d1knwa1       85 VETVVAGPLCESGDVFTQQEGGNVETRALP-EVKAGDYLVLHDTGAYGASMSSNYNSRPL    143

Query        321 PAIAIRELDGSVRTVRE-FTYADYEQSLS---    348
d1knwa1      144 LPEVLFDN-GQARLIRRRQTIEELLALELLHH    174


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match                                     . ............**********. ****
Query        193 VDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLD    252
d1knwa1        1 PHSLFSTDTDLTAENLLRLPAEFGCPVWVYVLITQVRSVKQMGSRHFVLVDAGFN-DLMR     59

DALI match       ***********            *******************         .. ******
Query        253 LLIYRETAKVLP---------NEGSHSYMICGKSCLAGDVFGEF-------RFAEELKVG    296
d1knwa1       60 PAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAG    119

DALI match       ********************************............  ....
Query        297 DRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1knwa1      120 DYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLAL    169



top
8: d7odca1 Eukaryotic ornithine decarboxylase (ODC) (hh: 1.000)

SCOP Superfamily: Alanine racemase C-​terminal domain-​like  |  SCOP Fold: Domain of alpha and beta subunits of F1 ATP synthase-​like  |  SCOP Class: All beta proteins

Consensus: 0.69  Contact: 1212
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:0.99 rmsd:0.25 AHM:0.38 LBcontacta:1.00 LBcontactb:0.98 LHM:0.43
id:1.00 blosum:0.99 compass:0.85 pearson:0.99
Scaled scores:
dali:0.82 daliz:0.62 gdtts:0.75 tmscore:0.81 rmsd:0.85 AHM:0.71 LBcontacta:0.65 LBcontactb:0.77 LHM:0.23
id:0.18 blosum:0.25 compass:0.32 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 13.1 Raw score:776.40)
Query          1 ---------------------------mIETPYYLIdkakltrnmeriahvreksgakal     33
d7odca1        1 ssftkdefdchildegftakdildqkinDKDAFYVA------------------------     36

Query         34 lalkcfatwsvfdlmrdymdgttssslfevrlgrerfgkethaysvaygdneidevvsha     93
d7odca1       37 ------------------------------------------------------------     37

Query         94 dkiifnsisqlerfadkaagiarglrlnpqrlgewdvpkvervmdringfmihnncenkd    153
d7odca1       37 ------------------------------------------------------------     37

Query        154 fglfdrmlgeieerfgaliarvdwvslgggihftgddypvdafsarlrafsdrygvqiyl    213
d7odca1       37 ------------------------------------------------------------     37

Query        214 epgeasitksTTLEVTVLDTLYN---KNLAIVDSSIEAHMLDLLIYRETAKVL------p    264
d7odca1       37 ----------FTLAVNIIAKKTVweqTFMYYVNDGVYGSFNCILYDHAHVKALlqkrpkp     86

Query        265 neGSHSYMICGKSCLAGDVFG-EFRFaEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAI    323
d7odca1       87 deKYYSSSIWGPTCDGLDRIVeRCNL-PEMHVGDWMLFENMGAYTVAAASTFNGFQRPNI    145

Query        324 AIRELDgsvrtvreftyadyeqsls    348
d7odca1      146 YYVMSR------------pmwqlmk    158


hit structure      alignment
FAST alignment (Normalized score: 5.87 Raw score:1377.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSL     60
d7odca1        1 ------------------------------------------------------------      1

Query         61 FEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKAAGIARGLRL    120
d7odca1        1 ------------------------------------------------------------      1

Query        121 NPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVSL    180
d7odca1        1 ------------------------------------------------------------      1

Query        181 GGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK------------------    222
d7odca1        1 ------------------------------------------SSFTKDEFDCHILDEGFT     18

Query        223 -----------------STTLEVTVLDTLYN-----KNLAIVDSSIEAHMLDLLIYRETA    260
d7odca1       19 AKDILDQKINDKDAFYVAFTLAVNIIAKK--TVWEQTFMYYVNDGVYGSFNCILYDHAHV     76

Query        261 KVLPNEG-----------SHSYMICGKSCLAGDVF-GEFRFAEELKVGDRISFQDAAGYT    308
d7odca1       77 KA-----LLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNL-PEMHVGDWMLFENMGAYT    130

Query        309 MVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS---------    348
d7odca1      131 VAAASTFNGFQRPNIYYVM---------------------SRPMWQLMK    158


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:102.83)
Query          1 -------------------------MI--ETPYYLIDKAKLTRNMERIAHVREKSGAKAL     33
d7odca1        1 SSFTKDEFDCHILDEGFTAKDILDQKINDKDAFYVA------------------------     36

Query         34 LALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHA     93
d7odca1       37 ------------------------------------------------------------     37

Query         94 DKIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKD    153
d7odca1       37 ------------------------------------------------------------     37

Query        154 FGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYL    213
d7odca1       37 ------------------------------------------------------------     37

Query        214 EPGEASITKSTTLEVTVLDTLYN---KNLAIVDSSIEAHMLDLLIYRETAKVLP---NE-    266
d7odca1       37 ----------FTLAVNIIAKKTVWEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKR-PK     85

Query        267 ---GSHSYMICGKSCLAGDVFG-EFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d7odca1       86 PDEKYYSSSIWGPTCDGLDRIVERCNL-PEMHVGDWMLFENMGAYTVAAASTFNGFQRPN    144

Query        323 IAIRELD-------GSVRTVREFTYADYEQSLS    348
d7odca1      145 IYYVMSRPMWQLMK-------------------    158


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match                                    ***********  ....... ****** ...
Query        197 SARLRAFSDRYGV--QIYLEPGEASITKSTTLEVTVLDTL--YNKNLAI-VDSSIEAHML    251
d7odca1       10 CHILDEGFTAKDILDQKINDKDAFYV--AFTLAVNIIAKKTVWEQTFMYYVNDGVY-GSF     66

DALI match       ............          *******************.... **************
Query        252 DLLIYRETAKVLP-------NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDA    304
d7odca1       67 NCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENM    126

DALI match       *************************   
Query        305 AGYTMVKKNWFNGVKMPAIAIRELDGSV    332
d7odca1      127 GAYTVAAASTFNGFQRPNIYYVMSRPMW    154



top
9: d1bd0a2 Alanine racemase (hh: 0.997)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.66  Contact: 1905
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.31 LBcontacta:0.99 LBcontactb:0.99 LHM:0.10
id:1.00 blosum:0.74 compass:0.72 pearson:1.00
Scaled scores:
dali:0.71 daliz:0.46 gdtts:0.55 tmscore:0.74 rmsd:0.79 AHM:0.68 LBcontacta:0.41 LBcontactb:0.66 LHM:0.57
id:0.10 blosum:0.15 compass:0.30 pearson:0.33

hit structure      alignment
DALI alignment (Z-score: 14.1 Raw score:1260.00)
Query          1 mietpyylidkAKLTRNMERIAHVReKSGAKALLALKCFA---TWSV-FDLMRD-YMDGT     55
d1bd0a2        1 --------vdlDAIYDNVENLRRLL-PDDTHIMAVVKANAyghGDVQvARTALEaGASRL     51

Query         56 TSSSLFEVRLGRE-RFGKETHAYSVAYGDnEIDEVVSHADKIIFNSISQLERFAD---ka    111
d1bd0a2       52 AVAFLDEALALREkGIEAPILVLGASRPA-DAALAAQQRIALTVFRSDWLEEASAlysgp    110

Query        112 aGIARGLRLNPQ--RLGEWDVPKVER-VMDR-------INGFMIHNNceNKDFGL--FDR    159
d1bd0a2      111 fPIHFHLKMDTGmgRLGVKDEEETKRiVALIerhphfvLEGLYTHFA-tADEVNTdyFSY    169

Query        160 MLGEIEERFGALiARVDWVSLGG-GIHFtgddypvdaFSARLrafsdrygvQIYLEPGEA    218
d1bd0a2      170 QYTRFLHMLEWLpSRPPLVHCANsAASL--------rFPDRT---------FNMVRFGIA    212

Query        219 SITKsttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksc    278
d1bd0a2      213 MYGL--------------------------------------------------------    216

Query        279 lagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvref    338
d1bd0a2      217 -----------------------------------------------------apspgik    223

Query        339 tyadyeqsls    348
d1bd0a2      224 pllpyplkea    233


hit structure      alignment
FAST alignment (Normalized score: 7.91 Raw score:2253.00)
Query          1 MIETPYYLIDKA-KLTRNMERIAHVREK--SGAKALLALKCFA---------TWSVFDLM     48
d1bd0a2        1 ------------VDLDAIYDNVENLRRLLPDDTHIMAV-----VKANAYGHGDVQVARTA     43

Query         49 RD-YMDGTTSSSLFEVRLGRE-RFGKETHAYSVAYGDNEIDEVVSHA--DKIIFNSISQL    104
d1bd0a2       44 LEAGASRLAVAFLDEALALREKGIEAPILV-LGASRPADAALAAQ--QRIALTVFRSDWL    100

Query        105 ERFADKAA----GIARGLRLNP--QRLGEWDVPKVERVMD--------RINGFMIHNNCE    150
d1bd0a2      101 EEASALY-SGPFPIHFHLKMDTGMGRLGVKDEEETKRIVALIERHPHFVLEGLYT-HFAT    158

Query        151 N--KDFGLFDRMLGEIEERFGALIA---RVDWVSLGGGIHFTGDDYPVDA---------F    196
d1bd0a2      159 ADEVNTDYFSYQYTRFLH-MLEW--LPSRPPLVH----------------CANSAASLRF    199

Query        197 SARLRAFSDRYGVQ--IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLL    254
d1bd0a2      200 PDR-----------TFNMVRFGIAM-----------------------------------    213

Query        255 IYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNW    314
d1bd0a2      214 ------------------------------------------------------------    214

Query        315 FNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------------------    348
d1bd0a2      214 ----------------------------------YGLAPSPGIKPLLPYPLKEA    233


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:170.45)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC-F--AT-WSVFDLMRD-YMDGT     55
d1bd0a2        1 --------VDLDAIYDNVENLRRLL-PDDTHIMAVVKANAYGHGDVQVARTALEAGASRL     51

Query         56 TSSSLFEVRLGRE-RFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFA-DKAA-    112
d1bd0a2       52 AVAFLDEALALREKGIEAPILVLGASRPA-DAALAAQQRIALTVFRSDWLEEASALYSGP    110

Query        113 -GIARGLRLNPQ--RLGEWDVPKVERVMD-RI------N-GFMIHNNCENKDFGL-FDRM    160
d1bd0a2      111 FPIHFHLKMDTGMGRLGVKDEEETKRIVALIERHPHFVLEGLYTHFATADEVNTDYFSYQ    170

Query        161 LGEIEERFGALIARVD-WVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEAS    219
d1bd0a2      171 YTRFLH-MLEWLPSRPPLVHCAN-SAAS---LR---FPDRT---F------NMVRFGIAM    213

Query        220 ITKS-------------TTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNE    266
d1bd0a2      214 YGLAPSPGIKPLLPYPL-------------------------------------------    230

Query        267 GSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIR    326
d1bd0a2      231 -----------------------------------KE-A---------------------    233

Query        327 ELDGSVRTVREFTYADYEQSLS    348
d1bd0a2      234 ----------------------    234


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match          **************. *************    ....******.. ***********
Query          9 IDKAKLTRNMERIAHVREKSGAKALLALKCFA----TWSVFDLMRDYM-DGTTSSSLFEV     63
d1bd0a2        1 VDLDAIYDNVENLRRLLP-DDTHIMAVVKANAYGHGDVQVARTALEAGASRLAVAFLDEA     59

DALI match       *****............... *************************   .   *******
Query         64 RLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKAAG---IARGLRL    120
d1bd0a2       60 LALREKGIEAPILVLGASRPADAALAAQQRIALTVFRSDWLEEASALYSGPFPIHFHLKM    119

DALI match       ***  ************....          ******* .. .....*************
Query        121 NPQ--RLGEWDVPKVERVMDRIN--------GFMIHNNCEN-KDFGLFDRMLGEIEERFG    169
d1bd0a2      120 DTGMGRLGVKDEEETKRIVALIERHPHFVLEGLYTHFATADEVNTDYFSYQYTRFLHMLE    179

DALI match       ** *********
Query        170 ALIARVDWVSLG    181
d1bd0a2      180 WLPSRPPLVHCA    191



top
10: d1vfsa2 Alanine racemase (hh: 0.997)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.67  Contact: 2062
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.31 AHM:0.32 LBcontacta:0.99 LBcontactb:0.99 LHM:0.11
id:0.99 blosum:0.22 compass:0.70 pearson:1.00
Scaled scores:
dali:0.71 daliz:0.47 gdtts:0.54 tmscore:0.73 rmsd:0.79 AHM:0.71 LBcontacta:0.42 LBcontactb:0.64 LHM:0.58
id:0.04 blosum:0.10 compass:0.30 pearson:0.34

hit structure      alignment
DALI alignment (Z-score: 14.8 Raw score:1354.10)
Query          1 mietpyyliDKAKLTRNMERIAHVREksGAKALLALKCFA----TWSVFDLMRD-YMDGT     55
d1vfsa2        1 ---------DLDAVRANVRALRARAP--RSALMAVVKSNAyghgAVPCARAAQEaGAAWL     49

Query         56 TSSSLFEVRLGRER-FGKETHAYSVAYGDnEIDEVVSHADKIIFNSISQLERFADKA---    111
d1vfsa2       50 GTATPEEALELRAAgIQGRIMCWLWTPGG-PWREAIETDIDVSVSGMWALDEVRAAAraa    108

Query        112 -AGIARGLRLNPQ--RLGEW--DVPKVER-VMDR-------INGFMIHNNceNKDFGL--    156
d1vfsa2      109 gRTARIQLXADTGlgRNGCQpaDWAELVGaAVAAqaegtvqVTGVWSHFA-cADEPGHps    167

Query        157 FDRMLGEIEERFGALIA---RVDWVSLGG-GIHFtgddypvdaFSARLrafsdrygvQIY    212
d1vfsa2      168 IRLQLDAFRDMLAYAEKegvDPEVRHIANsPATL---------TLPET--------hFDL    210

Query        213 LEPGEASIT--------------KSTTlevtvldtlynknlaivdssieahmldlliyre    258
d1vfsa2      211 VRTGLAVYGvspspelgtpaqlgLRPA---------------------------------    237

Query        259 takvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngv    318
d1vfsa2      238 ------------------------------------------------------------    238

Query        319 kmpaiaireldgsvrtvreftyadyeqsls    348
d1vfsa2      238 ------------------------------    238


hit structure      alignment
FAST alignment (Normalized score: 7.44 Raw score:2136.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFA---------TWSVFDLMRD-     50
d1vfsa2        1 ---------DLDAVRANVRALRARA--PRSALMAV-----VKSNAYGHGAVPCARAAQEA     44

Query         51 YMDGTTSSSLFEVRLGRE-RFGKETHAYSVAYGDN-EIDEVVSHA--DKIIFNSISQLER    106
d1vfsa2       45 GAAWLGTATPEEALELRAAGIQGRIMC--WLWTPGGPWREAIE--TDIDVSVSGMWALDE    100

Query        107 FADKAA----GIARGLRLNP--QRLGEW-------DVPKVERVMD-----RINGFMIHNN    148
d1vfsa2      101 VRAAARAAGRTARIQLXADTGLGRNGC-QPADWAELVGAAVAAQ-AEGTVQVTGVWS-HF    157

Query        149 CENKDF--GLFDRMLGEIEERFGALIA---RVDWVSLGGGIHFTGDDYPVDAFSARLRAF    203
d1vfsa2      158 ACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRH------------------------    193

Query        204 SDRYGVQ---------------IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEA    248
d1vfsa2      194 -------IANSPATLTLPETHFDLVRTGLAV-----------------------------    217

Query        249 HMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYT    308
d1vfsa2      218 ------------------------------------------------------------    218

Query        309 MVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------------------    348
d1vfsa2      218 ----------------------------------------YGVSPSPELGTPAQLGLRPA    237


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:169.09)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC-F--AT-WSVFDLMRD-YMDGT     55
d1vfsa2        1 ---------DLDAVRANVRALRARA-PR-SALMAVVKSNAYGHGAVPCARAAQEAGAAWL     49

Query         56 TSSSLFEVRLGRER-FGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKA---    111
d1vfsa2       50 GTATPEEALELRAAGIQGRIMCWLWTPGG-PWREAIETDIDVSVSGMWALDEVRAAARAA    108

Query        112 -AGIARGLRLNPQ--RLGEW--DVPKVERVMD-R------IN-GFMIHNNCENKDFGLFD    158
d1vfsa2      109 GRTARIQLXADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSI    168

Query        159 R-MLGEIEERFGALIA--RVD-WVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLE    214
d1vfsa2      169 RLQLDAFRDMLAYAEKEGVDPEVRHIANSPAT----LT--LP--ETH--F------DLVR    212

Query        215 PGEASITKS-------------TTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1vfsa2      213 TGLAVYGVSPSPELGTPAQLGL--------------------------------------    234

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMP    321
d1vfsa2      235 ----------------------------------------RP-A----------------    237

Query        322 AIAIRELDGSVRTVREFTYADYEQSLS    348
d1vfsa2      238 ---------------------------    238


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match       ****************  .************    **********.. ************
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFA----TWSVFDLMRDYM-DGTTSSSLFEVR     64
d1vfsa2        1 DLDAVRANVRALRARA--PRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEAL     58

DALI match       *****.............. ***************************....    *****
Query         65 LGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADKAAGIA----RGLRL    120
d1vfsa2       59 ELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLXA    118

DALI match       ***  *****.........            ********* ...........    ....
Query        121 NPQ--RLGEWDVPKVERVM----------DRINGFMIHNNCENKDFGLFDRM----LGEI    164
d1vfsa2      119 DTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDM    178

DALI match       .........*********
Query        165 EERFGALIARVDWVSLGG    182
d1vfsa2      179 LAYAEKEGVDPEVRHIAN    196



hit structures. 
top
11: d1rcqa2 Alanine racemase (hh: 0.997)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.62  Contact: 2084
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.31 AHM:0.37 LBcontacta:0.99 LBcontactb:0.99 LHM:0.15
id:1.00 blosum:0.93 compass:0.58 pearson:1.00
Scaled scores:
dali:0.70 daliz:0.45 gdtts:0.51 tmscore:0.72 rmsd:0.78 AHM:0.66 LBcontacta:0.40 LBcontactb:0.63 LHM:0.48
id:0.12 blosum:0.18 compass:0.27 pearson:0.33

hit structure      alignment
DALI alignment (Z-score: 14.6 Raw score:1308.30)
Query          1 mietpyylidkAKLTRNMERIAHVREKSGAKALLALKCFA----TWSVFDLMRDYMDGTT     56
d1rcqa2        1 -----------IDLQALRHNYRLAREATGARALAVIKADAyghgAVRCAEALAAEADGFA     49

Query         57 SSSLFEVRLGRER-FGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFADK--aaG    113
d1rcqa2       50 VACIEEGLELREAgIRQPILLLEGFFEASELELIVAHDFWCVVHCAWQLEAIERAslarP    109

Query        114 IARGLRLNPQ--RLGEWDVpKVERVMDRI--------NGFMIHNNceNKDFGLfdRMLGE    163
d1rcqa2      110 LNVWLXMDSGmhRVGFFPE-DFRAAHERLrasgkvakIVMMSHFS-rADELDC--PRTEE    165

Query        164 IEERFGALIA-RVDWVSLGGGIhftgddypvdaFSARlRAFSdrygvQIYLEPGEASI--    220
d1rcqa2      166 QLAAFSAASQgLEGEISLRNSP----------aVLGW-PKVP-----SDWVRPGILLYga    209

Query        221 -------------TKSTtlevtvldtlynknlaivdssieahmldlliyretakvlpneg    267
d1rcqa2      210 tpferahpladrlRPVM-------------------------------------------    226

Query        268 shsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaire    327
d1rcqa2      227 ------------------------------------------------------------    227

Query        328 ldgsvrtvreftyadyeqsls    348
d1rcqa2      227 ---------------------    227


hit structure      alignment
FAST alignment (Normalized score: 7.57 Raw score:2124.00)
Query          1 MIETPYYLIDKA-KLTRNMERIAHVREKSGAKALLALKCFA---------TWSVFDLMRD     50
d1rcqa2        1 ------------IDLQALRHNYRLAREATGARALAV-----IKADAYGHGAVRCAEALAA     43

Query         51 YMDGTTSSSLFEVRLGRE-RFGKETHAYSVA----YGDNEIDEVVSHA--DKIIFNSISQ    103
d1rcqa2       44 EADGFAVACIEEGLELREAGIRQPILL----LEGFFEASELELIVA--HDFWCVVHCAWQ     97

Query        104 LERFADKAA------GIARGLRLNP--QRLGEWDVPKVERV------MDRI--NGFMIHN    147
d1rcqa2       98 LEAIE----RASLARPLNVWLXMDSGMHRVG-FFPEDFRAAHERLRASGKVAKIVMMS-H    151

Query        148 NCENKDF--GLFDRMLGEIEERFGALIAR-VDWVSLGGGIHFTGDDYPVDAFSARLRAFS    204
d1rcqa2      152 FSRADELDCPRTEEQLAAFSAASQG----LEGEIS-------------------------    182

Query        205 DRYGVQ---------------IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAH    249
d1rcqa2      183 ------LRNSPAVLGWPKVPSDWVRPGILL------------------------------    206

Query        250 MLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTM    309
d1rcqa2      207 ------------------------------------------------------------    207

Query        310 VKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------------------    348
d1rcqa2      207 ---------------------------------------YGATPFERAHPLADRLRPVM    226


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:167.26)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC-F---ATWSVFDLMRDYMDGTT     56
d1rcqa2        1 --------IDLQALRHNYRLAREAT--G-ARALAVIKADAYGHGAVRCAEALAAEADGFA     49

Query         57 SSSLFEVRLGRE-RFGKETHAYSVAYGDNEIDEVVSHADKIIFNSISQLERFA-DKA-AG    113
d1rcqa2       50 VACIEEGLELREAGIRQPILLLEGFFEASELELIVAHDFWCVVHCAWQLEAIERASLARP    109

Query        114 IARGLRLNPQ--RLGEWDVPKVERVMD-RI-------NGFMIHNNCENKDFGLFDRMLGE    163
d1rcqa2      110 LNVWLXMDSGMHRVGFFPE-DFRAAHERLRASGKVAKIVMMSHFSRADEL-DC-PRT-EE    165

Query        164 IEERFGA-LIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK    222
d1rcqa2      166 QLAAFSAASQGLEGEISLRNSPAV----LG--WP--KV--PS------DWVRPGILLYGA    209

Query        223 S------------TTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHS    270
d1rcqa2      210 TPFERAHPLADRL-----------------------------------------------    222

Query        271 YMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDG    330
d1rcqa2      223 -------------------------------RPVM-------------------------    226

Query        331 SVRTVREFTYADYEQSLS    348
d1rcqa2      227 ------------------    227


hit structure      alignment
HHsearch alignment (Probability: 0.98 E-value:0.00)
DALI match       .  .............   *************    ************************
Query          9 IDKAKLTRNMERIAHVREKSGAKALLALKCFA----TWSVFDLMRDYMDGTTSSSLFEVR     64
d1rcqa2        1 IDLQALRHNYRLAREA---TGARALAVIKADAYGHGAVRCAEALAAEADGFAVACIEEGL     57

DALI match       *****............ *****************************    *********
Query         65 LGRERFGKETHAYSVAY-GDNEIDEVVSHADKIIFNSISQLERFADKA--AGIARGLRLN    121
d1rcqa2       58 ELREAGIRQPILLLEGFFEASELELIVAHDFWCVVHCAWQLEAIERASLARPLNVWLXMD    117

DALI match       *  .*******......           ******** .. .....  .............
Query        122 P--QRLGEWDVPKVERV-------MDRINGFMIHNNCEN-KDFGLFDRMLGEIEERFGAL    171
d1rcqa2      118 SGMHRVGFFPEDFRAAHERLRASGKVAKIVMMSHFSRADELDCPRTEEQLAAFSAASQGL    177

DALI match       .............                
Query        172 IARVDWVSLGGGIHFTGDDYPVDAFSARL    200
d1rcqa2      178 EGEISLRNSPAVLGWPKVPSDWVRPGILL    206



top
12: d1ct5a_ ​(​Hypothetical​(​ protein ybl036c (hh: 0.985)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.61  Contact: 1990
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.31 AHM:0.30 LBcontacta:1.00 LBcontactb:0.99 LHM:0.13
id:1.00 blosum:0.73 compass:0.44 pearson:1.00
Scaled scores:
dali:0.70 daliz:0.46 gdtts:0.54 tmscore:0.71 rmsd:0.78 AHM:0.71 LBcontacta:0.45 LBcontactb:0.66 LHM:0.52
id:0.06 blosum:0.14 compass:0.25 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 13.8 Raw score:1257.60)
Query          1 mietpyyLIDK-AKLTRNMERIAHVREKS----GAKALLALKcFATWSVFDLMR-DYMDG     54
d1ct5a_        1 --tgityDEDRkTQLIAQYESVREVVNAEaknvKILLLVVSK-LKPASDIQILYdHGVRE     57

Query         55 TTSSSLFEVRLGRERFG--KETHAYSVAYGDnEIDEVVSH--ADKII-FNSISQLERFAD    109
d1ct5a_       58 FGENYVQELIEKAKLLPddIKWHFIGGLQTN-KCKDLAKVpnLYSVEtIDSLKKAKKLNE    116

Query        110 KAA-------GIARGLRLNPQ----RLGEWDVPKVER-VMDR---------INGFMIHNN    148
d1ct5a_      117 SRAkfqpdcnPILCNVQINTShedqKSGLNNEAEIFEvIDFFlseeckyikLNGLMTIGS    176

Query        149 CenkdfglfDRMLGEIEERFGALI---aRVDWVSLGGGIhftgddypvdafsARLRAFSd    205
d1ct5a_      177 W--------NRDFATLVEWKKKIDakfgTSLKLSMGMSA-----------dfREAIRQG-    216

Query        206 rygvqIYLEPGEASITksttlevtvldtlynknlaivdssieahmldlliyretakvlpn    265
d1ct5a_      217 ----tAEVRIGTDIFG--------------------------------------------    228

Query        266 egshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiai    325
d1ct5a_      229 ------------------------------------------------------------    229

Query        326 reldgsvrtvreftyadyeqsls    348
d1ct5a_      229 -----------------------    229


hit structure      alignment
FAST alignment (Normalized score: 7.94 Raw score:2236.00)
Query          1 MIETPYYLI--------DKAKLTRNMERIAHVREK----SGAKALLALKCFATWSVFDLM     48
d1ct5a_        1 ---------TGITYDEDRKTQLIAQYESVREVVNAEAKNVKILLLVVSKL-KPASDIQIL     50

Query         49 RD-YMDGTTSSSLFEVRLGRERFG---KETHAYSVAYGDNEIDEVV--SHADKI-IFNSI    101
d1ct5a_       51 YDHGVREFGENYVQELIEKAKLL-PDDIKWHFIG-GLQTNKCKDLAKVPNLYSVETIDSL    108

Query        102 SQLERFADKAA--------GIARGLRLNP-----QRLGEWDVPKVERVMD----------    138
d1ct5a_      109 KKAKKLNESR-AKFQPDCNPILCNVQIN-TSHEDQKSGLNNEAEIFEVIDFFLSEECKYI    166

Query        139 RINGFMIHNNCENKDFGL-FDRMLGEIEERFGALIARVDWV---------SLGGGIHFTG    188
d1ct5a_      167 KLNGLMTIG---------SWNRDFATLVEWKKKIDA-----KFGTSLKLSMGMS------    206

Query        189 DDYPVDAFSA-RLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIE    247
d1ct5a_      207 ----------ADFREAIR-QGT-AEVRIGTDIF---------------------------    227

Query        248 AHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGY    307
d1ct5a_      228 ------------------------------------------------------------    228

Query        308 TMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS-    348
d1ct5a_      228 -----------------------------------------G    228


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:159.99)
Query          1 -----MIETPYYLIDKAKLTRNMERIAHVREK-S---GAKALLALKCFATWSVFDLMR-D     50
d1ct5a_        1 TGITY------DEDRKTQLIAQYESVREVVNAEAKNVKILLLVVSKLK-PASDIQILYDH     53

Query         51 YMDGTTSS-SLFEVRLGRERF-GKETHAY-SVAY-GDNEIDEVVSHADKII-FNSISQLE    105
d1ct5a_       54 GVREFGENYVQELIEKAKLLPDDIKWHFIGGLQTNKCKDLAKV-PNLYSVETIDSLKKAK    112

Query        106 RFADKAA-------GIARGLRLNPQ----RLGEWDVPKVERVMD-R---------INGFM    144
d1ct5a_      113 KLNESRAKFQPDCNPILCNVQINTSHEDQKSGLNNEAEIFEVIDFFLSEECKYIKLNGLM    172

Query        145 IHNNCENKDFGLFDRMLGEIEERFGALIA---RVDWVSLGGGIHFTGDDYPVDAFSARLR    201
d1ct5a_      173 TIGSW--------NRDFATLVEWKKKIDAKFGTSLKLSMGMSADF---------RE-AIR    214

Query        202 AFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1ct5a_      215 QGT------AEVRIGTDIFG----------------------------------------    228

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMP    321
d1ct5a_      229 ------------------------------------------------------------    229

Query        322 AIAIRELDGSVRTVREFTYADYEQSLS    348
d1ct5a_      229 ---------------------------    229


hit structure      alignment
HHsearch alignment (Probability: 0.69 E-value:0.00)
DALI match       .***************    ..*********............*****************
Query         11 KAKLTRNMERIAHVRE----KSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLG     66
d1ct5a_       10 KTQLIAQYESVREVVNAEAKNVKILLLVVSKLKPASDIQILYDHGVREFGENYVQELIEK     69

DALI match       *****.........    ... .............***************          
Query         67 RERFGKETHAYSVA----YGDNEIDEVVSHADKIIFNSISQLERFADKAAGIA-------    115
d1ct5a_       70 AKLLPDDIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPIL    129

DALI match       ******    ..************..     ..               .  .........
Query        116 RGLRLN----PQRLGEWDVPKVERVM-----DRINGFMIHNNCENKDFGLFDRMLGEIEE    166
d1ct5a_      130 CNVQINTSHEDQKSGLNNEAEIFEVIDFFLSEECKYIKLNGLMTIGSWNRDFATLVEWKK    189

DALI match       ...... ********
Query        167 RFGALIARVDWVSLG    181
d1ct5a_      190 KIDAKFGTSLKLSMG    204



top
13: d1tqja_ D-​ribulose-​5-​phosphate 3-​epimerase (svm: 2.347)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.66  Contact: 1922
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.31 AHM:0.32 LBcontacta:0.99 LBcontactb:0.99 LHM:0.16
id:1.00 blosum:0.89 compass:0.66 pearson:1.00
Scaled scores:
dali:0.71 daliz:0.47 gdtts:0.56 tmscore:0.72 rmsd:0.78 AHM:0.68 LBcontacta:0.45 LBcontactb:0.68 LHM:0.43
id:0.10 blosum:0.18 compass:0.29 pearson:0.31

hit structure      alignment
DALI alignment (Z-score: 13.0 Raw score:1145.60)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALKCF---aTWSVFDLMRD-YMDGTT     56
d1tqja_        1 ---------------------------kNIVVAPSILSAdfsrLGEEIKAVDEaGADWIH     33

Query         57 SSS------------LFEVRLGRERFGKETHAYSV--AYGDnEIDEVVS-HADKIIFNS-    100
d1tqja_       34 VDVmdgrfvpnitigPLIVDAIRPLTKKTLDVHLMivEPEK-YVEDFAKaGADIISVHVe     92

Query        101 ---ISQLERFADKAA--GIARGLRLNPQrlgeWDVPKVERVMDRINGFMIHN-NCENkdf    154
d1tqja_       93 hnaSPHLHRTLCQIRelGKKAGAVLNPS----TPLDFLEYVLPVCDLILIMSvNPQS---    145

Query        155 glFDRMLGEIEeRFGALIA---RVDWVSLGGGIHFtgddypvdaFSARLRAFSdrygvqI    211
d1tqja_      146 -fIPEVLPKIR-ALRQMCDergLDPWIEVDGGLKP--------nNTWQVLEAG-----aN    190

Query        212 YLEPGEASITKsttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsy    271
d1tqja_      191 AIVAGSAVFNA-------------------------------------------------    201

Query        272 micgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgs    331
d1tqja_      202 ------------------------------------------------------------    202

Query        332 vrtvreftyadyeqsls    348
d1tqja_      202 --pnyaeaiagvrnskr    216


hit structure      alignment
FAST alignment (Normalized score: 7.32 Raw score:2007.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS-GAKALLALK-CFA--TWSVFDLMRD-YMDGT     55
d1tqja_        1 ----------------------------KNIVVAPSILSADFSRLGEEIKAVDEAGADWI     32

Query         56 TS------------SSLFEVRLGRERFGKETHAYSVAY----GDNEIDEVVS-HADKIIF     98
d1tqja_       33 HVDVMDGRFVPNITIGPLIVDAIRPLTKKTLDVHL---MIVEPEKYVEDFAKAGADIISV     89

Query         99 N--SISQ---LERFADKA---AGIARGLRLNPQRLGE-WDVPKVERVMDRINGFMIHNNC    149
d1tqja_       90 -HVEHNASPHLHRTLCQ-IRELGKKAGAVLNP-----STPLDFLEYVLPVCDLILIMS--    140

Query        150 ENKD------FGLFDRMLGEIEERFGALIARV----DWVSLGGGIHFTGDDYPVDA---F    196
d1tqja_      141 ----VNPQSFIPEVLPKIRALRQMCDE-----RGLDPWIEVDGGL-----------KPNN    180

Query        197 SARLRAFSDRYGVQ---IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDL    253
d1tqja_      181 TWQVLE--------AGANAIVAGSAV----------------------------------    198

Query        254 LIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKN    313
d1tqja_      199 ------------------------------------------------------------    199

Query        314 WFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS------------------    348
d1tqja_      199 -----------------------------------FNAPNYAEAIAGVRNSKR    216


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:149.23)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF-A--TWSVFDLMRD-YMDGTT     56
d1tqja_        1 ---------------------------KNIVVAPSILSADFSRLGEEIKAVDEAGADWIH     33

Query         57 S-S-----------SLFEVRLGRERFGKETHAYSVA--YGDNEIDEVVS-HADKIIFNS-    100
d1tqja_       34 VDVMDGRFVPNITIGPLIVDAIRPLTKKTLDVHLMIVEPEK-YVEDFAKAGADIISVHVE     92

Query        101 ---ISQLERFADKAA--GIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNN--CENKD    153
d1tqja_       93 HNASPHLHRTLCQIRELGKKAGAVLNPS---TPLD-FLEYVLPVCDLILIMSVNPQSF--    146

Query        154 FGLFDRMLGEIEERFGALIA---RVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQ    210
d1tqja_      147 ---I-PEVLPKIRALRQMCDERGLDPWIEVDGGLKP----NNT--WQ-VL-EAG-----A    189

Query        211 IYLEPGEASITKST-------------TLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYR    257
d1tqja_      190 NAIVAGSAVFNAPNYAEAIAGVRNSKR---------------------------------    216

Query        258 ETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNG    317
d1tqja_      217 ------------------------------------------------------------    217

Query        318 VKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1tqja_      217 -------------------------------    217


hit structure      alignment
HHsearch alignment (Probability: 0.21 E-value:0.01)
DALI match       ......... ...............  .************.  **********    ***
Query         75 HAYSVAYGDNEIDEVVSHADKIIFN--SISQLERFADKAAG--IARGLRLNPQRLGEWDV    130
d1tqja_       68 MIVEPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLNPS----TPL    123

DALI match       *****************....  .  ......... ........... ....
Query        131 PKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDW-VSLG    181
d1tqja_      124 DFLEYVLPVCDLILIMSVNPQSFIPEVLPKIRALRQMCDERGLDPWIEVDGG    175



top
14: d1q6oa_ 3-​keto-​L-​gulonate 6-​phosphate decarboxylase (hh: 0.916)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.72  Contact: 1830
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.34 AHM:0.37 LBcontacta:0.98 LBcontactb:0.99 LHM:0.15
id:1.00 blosum:0.46 compass:0.29 pearson:0.99
Scaled scores:
dali:0.70 daliz:0.46 gdtts:0.52 tmscore:0.71 rmsd:0.77 AHM:0.66 LBcontacta:0.39 LBcontactb:0.62 LHM:0.47
id:0.08 blosum:0.12 compass:0.23 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 13.1 Raw score:1148.30)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALKC---fATWSVFDLMRDYMDGTTS     57
d1q6oa_        1 ----------------------------LPMLQVALDNqtmdSAYETTRLIAEEVDIIEV     32

Query         58 S-------SLFEVRLGRERFG-KETHAYS-VAYG-DNEIDEVVS-HADKIIFNS---ISQ    103
d1q6oa_       33 GtilcvgeGVRAVRDLKALYPhKIVLADAkIADAgKILSRMCFEaNADWVTVICcadINT     92

Query        104 LERFADKAA--GIARGLRLNPQrlgeWDVPKVERVM-DRINGFMIHNNCE-NKDFgLFDR    159
d1q6oa_       93 AKGALDVAKefNGDVQIELTGY----WTWEQAQQWRdAGIGQVVYHRSRDaQAAG-VAWG    147

Query        160 mlGEIEERFGALIARVDWVSLGGGIHFtgddypvdAFSARLRAFSdrygvQIYLEPGEAS    219
d1q6oa_      148 --EADITAIKRLSDMGFKVTVTGGLAL--------EDLPLFKGIP-----IHVFIAGRSI    192

Query        220 -ITKSttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksc    278
d1q6oa_      193 rDAAS-------------------------------------------------------    197

Query        279 lagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvref    338
d1q6oa_      198 ------------------------------------------------------pveaar    203

Query        339 tyadyeqsls    348
d1q6oa_      204 qfkrsiaelw    213


hit structure      alignment
FAST alignment (Normalized score: 5.19 Raw score:1413.00)
Query          1 MIETPYYL----------IDKAKLTRNMERIAHVREKSGAKALLALKCFA----TWSVFD     46
d1q6oa_        1 --------LPMLQVALDNQTMDSAYETTR---LIAEEV-DIIEV-GTIL-CVGEGVRAVR     46

Query         47 LMRDYM-----DGTTSS-----SLFEVRLGRERF--GKETHAYSVAYGDNEIDEVVSHA-     93
d1q6oa_       47 DLKAL-YPHKIVLADA-KIADAGKILSRMCFE--ANADWVT-VICCADINTAKGALDV-A    100

Query         94 ----DKIIF-----NSISQLERFADKAAGIARGLRLNPQRLGEW---------------D    129
d1q6oa_      101 KEFNGDVQIELTGYWTWEQAQQWRD--AGI-GQVVYH-------RSRDAQAAGVAWGEAD    150

Query        130 VPKVERVMDRI--NGFMIHNNCENKDFGL---FDRMLGEIEERFGALIARVDWVSLGGGI    184
d1q6oa_      151 ITAIKRLSD--MGFKVTVT----------GGLALEDL----PLFKG--IPIHVFI-----    187

Query        185 HFTGDD--------YPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYN    236
d1q6oa_      188 ------AGRSIRDAASPVEAARQFKRSIAEL-----------------------------    212

Query        237 KNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVG    296
d1q6oa_      213 ------------------------------------------------------------    213

Query        297 DRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS-    348
d1q6oa_      213 ----------------------------------------------------W    213


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:149.47)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF---ATWSVFDLMRDYMDGTTS     57
d1q6oa_        1 ----------------------------LPMLQVALDNQTMDSAYETTRLIAEEVDIIEV     32

Query         58 -S--S----LFEVRLGRERFG-KETHAYSVAY-G-DNEIDEVVS-HADKIIFN--S-ISQ    103
d1q6oa_       33 GTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINT     92

Query        104 LERFADKAA--GIARGLRLNPQRLGEWDVPKVERVMD-RINGFMIHNNCE-NK--DFGLF    157
d1q6oa_       93 AKGALDVAKEFNGDVQIELT---G-YWTWEQAQQWRDAGIGQVVYHRSRDAQAAG--VAW    146

Query        158 DRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGE    217
d1q6oa_      147 -G--EADITAIKRLSDMGFKVTVTGGLAL-----E---DLPLFKGIP----IH-VFIAGR    190

Query        218 ASITKST----------------TLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1q6oa_      191 SIRDAASPVEAARQFKRSIAELW-------------------------------------    213

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMP    321
d1q6oa_      214 ------------------------------------------------------------    214

Query        322 AIAIRELDGSVRTVREFTYADYEQSLS    348
d1q6oa_      214 ---------------------------    214


hit structure      alignment
HHsearch alignment (Probability: 0.38 E-value:0.02)
DALI match                                                                   
Query         16 RNMERIAHVREKSGAKALLALKCFATWSV-FDLMRDYMDGTTSSS--------LFEVRLG     66
d1q6oa_       43 RAVRDLKALY--PHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVA    100

DALI match                                                                   
Query         67 RERFGKETHAYSVAYGDNEIDEVVSHADKIIF-------------NSISQLERFADKAAG    113
d1q6oa_      101 KEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRL-SD    159

DALI match                                                                 
Query        114 IARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGAL    171
d1q6oa_      160 MGFKVTVTGGLALEDLPLFKGIPIHVFI-----AGRSIRDAASPVEAARQFKRSIAEL    212



top
15: d1a49a2 Pyruvate kinase,​ N-​terminal domain (svm: 2.314)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.48  Contact: 1884
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.98 tmscore:0.99 rmsd:0.37 AHM:0.37 LBcontacta:0.98 LBcontactb:0.98 LHM:0.14
id:0.85 blosum:0.03 compass:0.10 pearson:0.98
Scaled scores:
dali:0.69 daliz:0.42 gdtts:0.44 tmscore:0.62 rmsd:0.73 AHM:0.65 LBcontacta:0.38 LBcontactb:0.62 LHM:0.45
id:-0.00 blosum:0.05 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 11.1 Raw score:1131.40)
Query          1 ---mietpyylidkakltrnmeriahvreKSGAKALLALKC-FATWSVFDLMRD-YMDGT     55
d1a49a2        1 iqtqqlhaamadtflehmcrldidsapitARNTGIICTIGPaSRSVETLKEMIKsGMNVA     60

Query         56 TSSS----LFEVRLGRERFG---------------KETHAYSVA-----yGDNEIDEVVS     91
d1a49a2       61 RMNFshgtHEYHAETIKNVRtatesfasdpilyrpVAVALDTKGpavsekDIQDLKFGVE    120

Query         92 H-ADKIIFNS---ISQLERFADKA----AGIARGLRLNPQrlgEWDVpkVERVMDRINGF    143
d1a49a2      121 QdVDMVFASFirkAADVHEVRKILgekgKNIKIISKIENH--eGVRR--FDEILEASDGI    176

Query        144 MIHNNcenkdfglfdRMLGEIEeRFGALIA-RVDWVSLGGGIHFTG--DDYPVDAFSARL    200
d1a49a2      177 MVARG-dlgieipaeKVFLAQK-MIIGRCNrAGKPVICATQMLESMikKPRPTRAEGSDV    234

Query        201 RAFSDRYgvQIYLEPGEAS-ITKSttlevtvldtlynknlaivdssieahmldlliyret    259
d1a49a2      235 ANAVLDG--ADCIMLSGETaKGDY------------------------------------    256

Query        260 akvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvk    319
d1a49a2      257 ------------------------------------------------------------    257

Query        320 mpaiaireldgsvrtvreftyadyeqsls    348
d1a49a2      257 ---pleavrmqhliareaeaamfhrklfe    282


hit structure      alignment
FAST alignment (Normalized score: 5.85 Raw score:1832.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVRE-----------------------------KSGAK     31
d1a49a2        1 --------------------------IQTQQLHAAMADTFLEHMCRLDIDSAPITARNTG     34

Query         32 ALLAL-KCFATWSVFDLMRD-YMDGTTSS---------SLFEVRLGRERFG---------     71
d1a49a2       35 IICTIGPASRSVETLKEMIKSGMNVARM-NFSHGTHEYHAETIKNVRT---ATESFASDP     90

Query         72 -----KETHAYSVAY--------GDNEIDEVVS-HADKIIFN---SISQLERFADK----    110
d1a49a2       91 ILYRPVAVALDT---KGPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEK    147

Query        111 AAGIARGLRLNPQRLGEW----DVPKVERVMDRINGFMIHNNCENKDFGLFDRM------    160
d1a49a2      148 GKNIKIISKI--------ENHEGVRRFDEILEASDGIMVA--------------RGDLGI    185

Query        161 ---LGEIEERFGALIARV-----DWVSLGGGIHFTGDDYP-----------VDAFSARLR    201
d1a49a2      186 EIPAEKVFLAQKMIIGR-CNRAGKPVICATQ---------MLESMIKKPRPTRAEGSDVA    235

Query        202 AFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1a49a2      236 NAVL-DGA-DCIMLSGE-------------------------------------------    250

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMP    321
d1a49a2      251 ------------------------------------------------------------    251

Query        322 AIAIRELDGSVRTVREFTYADYEQSLS--------------------------------    348
d1a49a2      251 ---------------------------TAKGDYPLEAVRMQHLIAREAEAAMFHRKLFE    282


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:151.70)
Query          1 --------------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALL     34
d1a49a2        1 IQTQQLHAAMADTFLEHMCRLDIDSA-----------------------PITARNTGIIC     37

Query         35 ALKCFATWS-VFDLMRDY-MDGTTSSS----LFEVRLGRERFG---------------KE     73
d1a49a2       38 TIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVA     97

Query         74 THAYSVA-----YGDNEIDEVV-SHADKIIFN-S-I-SQLERFAD-K---AAGIARGLRL    120
d1a49a2       98 VALDTKGPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKI    157

Query        121 NPQRLGEWDVPKVERVMDRINGFMIHNNC-EN----KDFGLFDRMLGEIEERFGALIA-R    174
d1a49a2      158 ENH--EGVRR--FDEILEASDGIMVARGDL-GIEIP-----AEKVFLAQKM-IIGRCNRA    206

Query        175 VDWVSLGGGIHF-T--G-DDYP-VDAFSARLRAFSDRYGVQIYLEPGEASITKST-----    224
d1a49a2      207 GKPVICATQMLESMIKKPRPTRAEGSDVANAVLDG----ADCIMLSGETAKGDYPLEAVR    262

Query        225 --------------------TLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLP    264
d1a49a2      263 MQHLIAREAEAAMFHRKLFE----------------------------------------    282

Query        265 NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIA    324
d1a49a2      283 ------------------------------------------------------------    283

Query        325 IRELDGSVRTVREFTYADYEQSLS    348
d1a49a2      283 ------------------------    283


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.08)
DALI match                                                                   
Query         82 GDNEIDEVVSHADKII-FN----SISQLERFADKAAGI------------ARGLRLNPQR    124
d1a49a2       45 SVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKG    104

DALI match                                                             
Query        125 LGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWV    178
d1a49a2      105 PAVSEKDIQDLKFGVEQDVDMVFASFIRKAAD----VHEVRKILGEKGKNIKII    154



hit structures. 
top
16: d1m5wa_ Pyridoxine 5'​-​phosphate synthase (svm: 2.371)

SCOP Superfamily: Pyridoxine 5'​-​phosphate synthase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.60  Contact: 1877
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.37 AHM:0.39 LBcontacta:0.99 LBcontactb:0.99 LHM:0.23
id:1.00 blosum:0.75 compass:0.53 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.41 gdtts:0.51 tmscore:0.68 rmsd:0.74 AHM:0.64 LBcontacta:0.42 LBcontactb:0.64 LHM:0.36
id:0.09 blosum:0.15 compass:0.27 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 11.1 Raw score:1066.10)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALKCFA------------TWSVFDLM     48
d1m5wa_        1 ---------------------------aELLLGVNIDHIAtlrnargtaypdPVQAAFIA     33

Query         49 RD-YMDGTTSSS--------LFEVRLGRERFGKETHAYSVaYGDNEIDEVVSH-ADKIIF     98
d1m5wa_       34 EQaGADGITVHLredrrhitDRDVRILRQTLDTRMNLEMA-VTEEMLAIAVETkPHFCCL     92

Query         99 N-----------------sISQLERFADKAA--GIARGLRLNPqrlgewDVPKVERVMD-    138
d1m5wa_       93 VpekrqevtteggldvagqRDKMRDACKRLAdaGIQVSLFIDA------DEEQIKAAAEv    146

Query        139 RINGFMIHNNceNKDFG--LFDRMLGEIEERFGALIARVDWVSLGGGIHFtgddypvdaF    196
d1m5wa_      147 GAPFIEIHTGcyADAKTdaEQAQELARIAKAATFAASLGLKVNAGHGLTY--------hN    198

Query        197 SARLRAFSdrygVQIYLEPGEASITKSTtlevtvldtlynknlaivdssieahmldlliy    256
d1m5wa_      199 VKAIAAIP----EMHELNIGHAIIGRAV--------------------------------    222

Query        257 retakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfQDAAgytmvkknwfn    316
d1m5wa_      223 ---------------------------------------------MTGL-----------    226

Query        317 gvkmpaiaireldgsvrtvreftyadyeqsls    348
d1m5wa_      227 ----------------kdavaemkrlmlearg    242


hit structure      alignment
FAST alignment (Normalized score: 6.41 Raw score:1859.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS-GAKALLALKCFA--------------TWSVF     45
d1m5wa_        1 ----------------------------AELLLGVNIDH--IATLRNARGTAYPDPVQAA     30

Query         46 DLMR-DYMDGTTS--------SSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVS-HADK     95
d1m5wa_       31 FIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEM-AVTEEMLAIAVETKPHF     89

Query         96 IIFN------------------SISQLERFADKA---AGIARGLRLNPQRLGEW----DV    130
d1m5wa_       90 CCL-VPEKRQEVTTEGGLDVAGQRDKMRDACKR-LADAGIQVSLFID-------ADEEQI    140

Query        131 PKVERVMD-RINGFMI--HNNCENKDFGLFDRMLGEIEERFGALIARV--DWVSLGGGIH    185
d1m5wa_      141 KAAAE---VGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAAS--LGLKVNAGHGL-    194

Query        186 FTGDDYPVDA---FSARLRAFSDRYGVQ----IYLEPGEASITKSTTLEVTVLDTLYNKN    238
d1m5wa_      195 ----------TYHNVKAIAA--------IPEMHELNIGHAI-------------------    217

Query        239 LAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDR    298
d1m5wa_      218 ------------------------------------------------------------    218

Query        299 ISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS----------    348
d1m5wa_      218 --------------------------------------------------IGRAVMTGLK    227

Query        349 ---------------    349
d1m5wa_      228 DAVAEMKRLMLEARG    242


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:150.40)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFA------------TWSVFDLM     48
d1m5wa_        1 ---------------------------AELLLGVNIDHIATLRNARGTAYPDPVQAAFIA     33

Query         49 RD-YMDGTTSSS-------LF-EVRLGRERFGKETHAYSVAYGDNEIDEVV-SHADKIIF     98
d1m5wa_       34 EQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVT-EEMLAIAVETKPHFCCL     92

Query         99 -------------NSI--S--QLERFADKAA--GIARGLRLNPQRLGEWDVPKVERVMDR    139
d1m5wa_       93 VPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDA-----DEEQIKAAAEVG    147

Query        140 INGFMIHNNCENKD--FG-LFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAF    196
d1m5wa_      148 APFIEIHTGCYADAKT-DAEQAQELARIAKAATFAASLGLKVNAGHGLTY----HNV--K    200

Query        197 SARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIY    256
d1m5wa_      201 A-IAA-IP--E--MHELNIGHAIIGRAV--------------------------------    222

Query        257 RETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAG----------    306
d1m5wa_      223 ----------------------------------------------MTGLKDAVAEMKRL    236

Query        307 ------YTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1m5wa_      237 MLEARG------------------------------------------    242


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.11)
DALI match       ...**********      ..........**********  *****..     .......
Query        110 KAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLF-----DRMLGEI    164
d1m5wa_      123 ADAGIQVSLFIDAD-----EEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKA    177

DALI match       ...........   ******
Query        165 EERFGALIARVDWVSLGGGI    184
d1m5wa_      178 ATFAASLGLKV---NAGHGL    194



top
17: d1izca_ Macrophomate synthase (hh: 0.932)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 1674
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.32 AHM:0.32 LBcontacta:0.97 LBcontactb:0.98 LHM:0.13
id:0.96 blosum:0.55 compass:0.30 pearson:0.98
Scaled scores:
dali:0.69 daliz:0.44 gdtts:0.52 tmscore:0.67 rmsd:0.77 AHM:0.65 LBcontacta:0.39 LBcontactb:0.64 LHM:0.46
id:0.04 blosum:0.12 compass:0.19 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 9.6 Raw score:991.50)
Query          1 -----------mietpyylidkakltrnmeriahvrekSGAKALLALKcFATWSVFDLMR     49
d1izca_        1 aksyseqpelhakapyrsamltypgnlrqalkdamadpSKTLMGVAHG-IPSTFVTKVLA     59

Query         50 -DYMDGTTSSS------lfevRLGRERFG------KETHAYSVAYGDNEIDEVVS-HADK     95
d1izca_       60 aTKPDFVWIDVehgmfnrlelHDAIHAAQhhsegrSLVIVRVPKHDEVSLSTALDaGAAG    119

Query         96 IIFNS---ISQLERFADKAA------------------------------------GIAR    116
d1izca_      120 IVIPHvetVEEVREFVKEMYygpigrrsfspwtfspgiadaslfpndpynvatsnnHVCI    179

Query        117 GLRLNPQrlgEWDV-PKVERvMDRINGFMIHNN---------cenkdfglfdrmlGEIEE    166
d1izca_      180 IPQIESV--kGVENvDAIAA-MPEIHGLMFGPGdymidagldlngalsgvphptfVEAMT    236

Query        167 RFGALIA-RVDWVSLGgGIHFtgddypvdaFSARLRAFSdrygvQIYLE-PGEA-SITKs    223
d1izca_      237 KFSTAAQrNGVPIFGG-ALSV--------dMVPSLIEQG-----YRAIAvQFDVwGLSR-    281

Query        224 ttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksclagdv    283
d1izca_      282 ------------------------------------------------------------    282

Query        284 fgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvreftyady    343
d1izca_      282 -----------------------------------------------lvhgslaqarasa    294

Query        344 eqsls    348
d1izca_      295 kqfag    299


hit structure      alignment
FAST alignment (Normalized score: 5.02 Raw score:1621.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREK---------------------------------     27
d1izca_        1 ---------------------------AKSYSEQPELHAKAPYRSAMLTYPGNLRQALKD     33

Query         28 -----SGAKALLALKCFATWSVFDLMRD-YMDGTTSS-----------SLFEVRLGRERF     70
d1izca_       34 AMADPSKTLMGVAH-GIPSTFVTKVLAATKPDFVWI-DVEHGMFNRLELHDAIHAAQHHS     91

Query         71 G---KETHAYSVA--YGDNEIDEVVS-HADKIIFN---SISQLERFADKA----------    111
d1izca_       92 -EGRSLVIVRV--PKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKE-MYYGPIGRRS    147

Query        112 ---------------------------AGIARGLRLNPQRLGEW--------DVPKVERV    136
d1izca_      148 FSPWTFSPGIADASLFPNDPYNVATSNNHVCIIPQ---------IESVKGVENVDAIAA-    197

Query        137 MDRINGFMIHNNCENKD--------------------FGLFDRMLGEIEERFGALIARV-    175
d1izca_      198 MPEIHGLMFG-------PGDYMIDAGLDLNGALSGVPHPTFVEAMTKFSTAAQR-----N    245

Query        176 -DWVSLGGGIHFTGDDYPV--DAFSARLRAFSDRYGVQ---IYLE--PGEASITKSTTLE    227
d1izca_      246 GVPIFGGA-----------LSVDMVPSLIE--------QGYRAIAVQFDVWG--------    278

Query        228 VTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEF    287
d1izca_      279 ------------------------------------------------------------    279

Query        288 RFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSL    347
d1izca_      279 ------------------------------------------------------------    279

Query        348 S---------------------    348
d1izca_      279 -LSRLVHGSLAQARASAKQFAG    299


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:153.57)
Query          1 ---------------------------------MIETPYYLIDKAKLTRNMERIAHVR--     25
d1izca_        1 AKSYSEQPELHAKAPYRSAMLTYPGNLRQALKD------------------------AMA     36

Query         26 EKSGAKALLALKCFATWSVFDLMRDYMDGTTSSS----LF--EVRLGRERFG------KE     73
d1izca_       37 DPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLELHDAIHAAQHHSEGRSL     96

Query         74 THAYSVAYGDNEIDEVVS-HADKIIFN-S-I-SQLERFADKAA-----------------    112
d1izca_       97 VIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPG    156

Query        113 -----------------G--IARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNN-----    148
d1izca_      157 IADASLFPNDPYNVATSNNHVCIIPQIESV--KGVENVDAIAAMPEIHGLMFGPGDYMID    214

Query        149 ----CEN---KDFGLF-DRMLGEIEERFGALIA-RVDWVSLGGGIHFTGDDYPVDAFSAR    199
d1izca_      215 AGLDLNGALS---GVPH-PTFVEAMTKFSTAAQRNGVPIFGGA-LSV------D--MVPS    261

Query        200 LRAFSDRYGVQIYLEPG-EASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRE    258
d1izca_      262 LIEQG----YRAIAVQFDVWGLSRLVHGS-------------------------------    286

Query        259 TAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGV    318
d1izca_      287 -LAQARASAK-------------------QFAG---------------------------    299

Query        319 KMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1izca_      300 ------------------------------    300


hit structure      alignment
HHsearch alignment (Probability: 0.42 E-value:0.00)
DALI match                .......... ***********......               .  .....
Query         19 ERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGT----------TSSSLFEVRLGRE     68
d1izca_       29 QALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLELHDAIHAAQ     88

DALI match       .....   ******************.....    ....************       
Query         69 RFGKE---THAYSVAYGDNEIDEVVSHADKI----IFNSISQLERFADKAAGIARGLR    119
d1izca_       89 HHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRR    146



top
18: d1qpoa1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain (svm: 2.274)

SCOP Superfamily: Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.64  Contact: 1283
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.33 LBcontacta:0.97 LBcontactb:0.97 LHM:0.14
id:0.96 blosum:0.53 compass:0.19 pearson:0.98
Scaled scores:
dali:0.71 daliz:0.40 gdtts:0.54 tmscore:0.66 rmsd:0.78 AHM:0.71 LBcontacta:0.39 LBcontactb:0.59 LHM:0.49
id:0.04 blosum:0.11 compass:0.19 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 8.3 Raw score:767.20)
Query          1 mietpyylidkakLTRNMERIAHVREKSGAKALLAlKCFA--TWSVF-DLMRD-YMDGTT     56
d1qpoa1        1 -------------IATATAAWVDAVRGTKAKIRDT-RKTLpgLRALQkYAVRTgGGVNHR     46

Query         57 SSSlfevrlgrerfgkethaysvaygdneidevvshADKIIFN---------SISQLERF    107
d1qpoa1       47 LGL---------------------------------GDAALIKdnhvaaagsVVDALRAV     73

Query        108 ADKAAGIARGLRLNPQrlgEWDVpkVERVMdrINGFMIHNncenkdfglfdrMLGEIEEr    167
d1qpoa1       74 RNAAPDLPCEVEVDSL--eQLDA--VLPEK--PELILLDN-----------fAVWQTQT-    115

Query        168 FGALIA---RVDWVSLGGGIHFtgddypvdaFSARLRAFsdrygvqIYLEPGeASITKST    224
d1qpoa1      116 AVQRRDsraPTVMLESSGGLSL-------qtAATYAETG------vDYLAVG-ALTHSVR    161

Query        225 tlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksclagdvf    284
d1qpoa1      162 ------------------------------------------------------------    162

Query        285 gefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaIRELDgsvrtvreftyadye    344
d1qpoa1      162 ----------------------------------------VLDIG---------------    166

Query        345 qsls    348
d1qpoa1      167 -ldm    169


hit structure      alignment
FAST alignment (Normalized score: 4.12 Raw score:999.60)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFA------TWSVFDLMRDYMDG     54
d1qpoa1        1 -------------IATATAAWVDAVRGTKAKIRDTR----KTLPGLRALQKYAVRT----     39

Query         55 TTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSH----------ADKIIFN-----     99
d1qpoa1       40 --------------------------------------GGGVNHRLGLGDAALI-KDNHV     60

Query        100 -----SISQLERFADKAAGIARGLRLNPQRLGEWDV---PKVERVMD-RINGFMIHNNCE    150
d1qpoa1       61 AAAGSVVDALRAVRNAAPDLPCEVEV----------DSLEQLDAVLPEKPELILL-----    105

Query        151 N--KDFGLFDRMLGEIEERFGALIARV---DWVSLGGGIHFTGDDY---PVDAFSARLRA    202
d1qpoa1      106 -DNFAVWQTQTAVQRRDSR--------APTVMLESSGGL-------SLQTAATYAE----    145

Query        203 FSDRYGVQ---IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRET    259
d1qpoa1      146 --------TGVDYLAVG-ALTH--------------------------------------    158

Query        260 AKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVK    319
d1qpoa1      159 ------------------------------------------------------------    159

Query        320 MPAIAIRELDGSVRTVREFTYADYEQSLS-----------    348
d1qpoa1      159 -----------------------------SVRVLDIGLDM    169


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:127.60)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFA--TW-SVFDLMRD-YMDGTT     56
d1qpoa1        1 -------------IATATAAWVDAVRGTKAKIRDTRK-TLPGLRALQKYAVRTGGGVNHR     46

Query         57 SSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFN---------SISQLERF    107
d1qpoa1       47 -----LGL------------------------G--DA--ALIKDNHVAAAGSVVDALRAV     73

Query        108 ADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEER    167
d1qpoa1       74 RNAAPDLPCEVEVDSL---EQLD--AV-LPEKPELILLDNF-----------AVWQTQT-    115

Query        168 FGALIA-RV-D-WVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKST    224
d1qpoa1      116 AVQRRDSRAPTVMLESSGGLSL----QTA--AT-YAE-TG-----VDYLAVGALTHSVRV    162

Query        225 TLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVF    284
d1qpoa1      163 ------------------------------------------------------------    163

Query        285 GEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGS-VRTVREFTYADY    343
d1qpoa1      163 -----------------------------------------LDIGLDM------------    169

Query        344 EQSLS    348
d1qpoa1      170 -----    170


hit structure      alignment
HHsearch alignment (Probability: 0.47 E-value:0.00)
DALI match       **********************.....................                 
Query         14 LTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTT-----------------     56
d1qpoa1        1 IATATAAWVDAVRGTKAKIRDTRKTLPGLRALQKYAVRTGGGVNHRLGLGDAALIKDNHV     60

DALI match                                                                   
Query         57 --SSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHA-DKIIFNSIS--QLERFADKA    111
d1qpoa1       61 AAAGSVVDALRAVRNAAPDLPCEVEVDSLEQLDAVLPEKPELILLDNFAVWQTQTAVQRR    120

DALI match                                         
Query        112 AGIARGLRLNPQRLGEWDVPKVERVMDRINGFMI    145
d1qpoa1      121 DSRAPTVMLESS-GGLSLQTAATYAETGVDYLAV    153



top
19: d1fq0a_ KDPG aldolase (svm: 2.372)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 1464
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.32 AHM:0.32 LBcontacta:0.97 LBcontactb:0.97 LHM:0.16
id:0.92 blosum:0.05 compass:0.09 pearson:0.96
Scaled scores:
dali:0.68 daliz:0.42 gdtts:0.50 tmscore:0.68 rmsd:0.78 AHM:0.70 LBcontacta:0.38 LBcontactb:0.57 LHM:0.40
id:0.02 blosum:0.05 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 10.3 Raw score:937.90)
Query          1 -----------mietpyylidkakLTRNMERIAHVREKSGA-KALLALKC-FATWsvFDL     47
d1fq0a_        1 mknwktsaesilttgpvvpvivvkKLEHAVPMAKALVAGGVrVLEVTLRTeCAVD-aIRA     59

Query         48 MRDY----MDGTTSSSL-FEVRLGRERFGKETHAYSvaYGDNEIDEVVS--HADKIIFNS    100
d1fq0a_       60 IAKEvpeaIVGAGTVLNpQQLAEVTEAGAQFAISPG--LTEPLLKAATEgtIPLIPGIST    117

Query        101 ISQLERFADKaAGIARGL-RLNPqrlgEWDVPKVERVM----DRINGFMIHnncenkdfg    155
d1fq0a_      118 VSELMLGMDY-GLKEFKFfPAEA----NGGVKALQAIAgpfsQVRFCPTGG---------    163

Query        156 lfdrmLGEIEerfGALIAR--VDWVSLG--ggIHFTGDdYPVDAFSARLRAFSDRYGvqi    211
d1fq0a_      164 ----iSPANY---RDYLALksVLCIGGSwlvpADALEA-GDYDRITKLAREAVEGAK---    212

Query        212 ylepgeasitksttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsy    271
d1fq0a_      213 ------------------------------------------------------------    213

Query        272 micgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgs    331
d1fq0a_      213 ------------------------------------------------------------    213

Query        332 vrtvreftyadyeqsls    348
d1fq0a_      213 ----------------l    213


hit structure      alignment
FAST alignment (Normalized score: 5.02 Raw score:1366.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGA---------------KALLALKCF---ATW     42
d1fq0a_        1 ------------------------------MKNWKTSAESILTTGPVVPV----IVVKKL     26

Query         43 SVFDLMRD-----YMDGTTSS------SLFEVRLGRERFG-KETHA-YSVAYGDNEIDEV     89
d1fq0a_       27 EHAVPMAKALVAGGVRVLEV-TLRTECAVDAIRAIAKEVPEAIVGAGTVL--NPQQLAEV     83

Query         90 VS-HADKIIFN--SISQLERFADKAAGIARGLRLNPQRLGEW----DVPKVERVMD-RIN    141
d1fq0a_       84 TEAGAQFAISPGLTEPLLKAATE--GTIPLIPGI--------STVSELMLGMD---YGLK    130

Query        142 GFMIHNNCENKDFGLFDR------MLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDA    195
d1fq0a_      131 EFKFF-------------PAEANGGVKALQAIAGP-FSQ-VRFCPTGGI-----------    164

Query        196 FSARLRAFSDRYGVQ-----IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHM    250
d1fq0a_      165 SPANYRDYL------ALKSVLCIGGSWL--------------------------------    186

Query        251 LDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMV    310
d1fq0a_      187 ------------------------------------------------------------    187

Query        311 KKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS----------------------    348
d1fq0a_      187 --------------------------------------VPADALEAGDYDRITKLAREAV    208

Query        349 -----    349
d1fq0a_      209 EGAKL    213


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:149.21)
Query          1 ------------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLAL     36
d1fq0a_        1 MKNWKTSAESILTTGPVVPVIVVK------------KLEHAVPMAKALVAGGVRVLEVTL     48

Query         37 KCFATWSVFDLMR-DY--M-DGTTSSSL-FEVRLGRERFGKETHAYSVAYGDNEIDEVVS     91
d1fq0a_       49 RTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTE-AGAQFAISPGLT-EPLLKAATE    106

Query         92 H-ADKIIFNS-ISQLERFADKAAGIARGLRLNPQRLGEW--DVPKVERVMDRINGFMIHN    147
d1fq0a_      107 GTIPLIPGISTVSELMLGMDY-G-LKEFKFFPAE-ANGGVKALQAIAGPFSQVRFCPTGG    163

Query        148 NCENKDFGLFDRMLGEIEERFGALIARVDWVSLGG-GIH-FTGD-DY-PVDAFSARLRAF    203
d1fq0a_      164 I-----------SPANYRD-YLAL-KSVLCIGGSWLVPADALEAGDYDRITKLAREAVEG    210

Query        204 SDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVL    263
d1fq0a_      211 A-KL--------------------------------------------------------    213

Query        264 PNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAI    323
d1fq0a_      214 ------------------------------------------------------------    214

Query        324 AIRELDGSVRTVREFTYADYEQSLS    348
d1fq0a_      214 -------------------------    214


hit structure      alignment
HHsearch alignment (Probability: 0.43 E-value:0.03)
DALI match                                                                   
Query          7 YLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLG     66
d1fq0a_       46 VTLRTECAVDAIRAIAKEVPE----AIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLL    101

DALI match                                                                   
Query         67 RERFGKETHAYSVAYGDNEIDEVVSHADKI-------IFNSISQLERFADKAAGIARGLR    119
d1fq0a_      102 KAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFC--    159

DALI match                                                                 
Query        120 LNPQRLGEWDVPKVERVMDRINGFMIHNNCENK--------DFGLFDRMLGEIEERFG    169
d1fq0a_      160 ----PTGGISPANYRDYL-ALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAK    212



top
20: d1vlpa2 Nicotinate phosphoribosyltransferase,​ C-​terminal domain (svm: 1.364)

SCOP Superfamily: Nicotinate/​Quinolinate PRTase C-​terminal domain-​like  |  SCOP Fold: alpha/​beta-​Hammerhead  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.36  Contact: 1405
Modified z-scores:
dali:0.99 daliz:0.95 gdtts:0.99 tmscore:0.99 rmsd:0.38 AHM:0.38 LBcontacta:0.97 LBcontactb:0.98 LHM:0.11
id:0.96 blosum:0.22 compass:0.13 pearson:0.98
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.47 tmscore:0.63 rmsd:0.78 AHM:0.71 LBcontacta:0.32 LBcontactb:0.54 LHM:0.56
id:0.02 blosum:0.10 compass:0.17 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 5.9 Raw score:745.30)
Query          1 mietpYYLIDKaKLTRNMERIAHVREKsGAKALLA-LKCF---aTWSV-FDLMRD-----     50
d1vlpa2        1 -----DWDYEN-QLEQAEKKAETLFDN-GIRFSEFgTRRRrslkAQDLiMQGIMKavngn     53

Query         51 ------yMDGTTssslfeVRLGRERfGKETHAY-SVAYgdneidevvshadkiifnSISQ    103
d1vlpa2       54 pdrnkslLLGTS-----nILFAKKY-GVKPIGTvAHEWvmgvasisedylhanknaMDCW    107

Query        104 LERFAdkaagiARGLRLNPQR-lgeWDVPkVERVMdrINGFMIHNNcenkdfgLFDRMLG    162
d1vlpa2      108 INTFG----akNAGLALTDTFgtddFLKS-FRPPYsdAYVGVRQDS------gDPVEYTK    156

Query        163 EIEERFG--ALIArvDWVSLGGGIHFTgddYPVDAFSARLRAFSdrygvQIYLEPGEASI    220
d1vlpa2      157 KISHHYHdvLKLPkfSKIICYSDSLNV---EKAITYSHAAKENG----mLATFGIGTNFT    209

Query        221 TKsTTLEVtvldtlynknlaivdssieaHMLDLliyretakvlpnegshsymicgkscla    280
d1vlpa2      210 ND-FRKKS--------------epqvksEPLNI---------------------------    227

Query        281 gdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvrefty    340
d1vlpa2      228 -----------------------------vikllevngnhaikisdnlgknmgdpatvkr    258

Query        341 adyeqsls    348
d1vlpa2      259 vkeelgyt    266


hit structure      alignment
FAST alignment (Normalized score: 3.94 Raw score:1200.00)
Query          1 MIETPYYLIDK-----AKLTRNMERIAHVREKSGAKALLALKCFA-----------TWSV     44
d1vlpa2        1 -----------DWDYENQLEQAEKKAETLF-DNGIRFSE------FGTRRRRSLKAQDLI     42

Query         45 FDLMRDY------------MDGTTSS-SLFEVRLGRERFGKETHAYSVAYGDNEIDEVVS     91
d1vlpa2       43 MQGIMK-AVNGNPDRNKSLLLGT---SNILFAK----KYGVKPIGT--------------     80

Query         92 HADKIIFN-------------------SISQLERFADKAAGIA------RGLRLNPQRLG    126
d1vlpa2       81 --------VAHEWVMGVASISEDYLHANKNAMDCWINT-----FGAKNAGLAL-------    120

Query        127 EW----DVPKVER-----VMDRINGFMIHNNCENKDFGLFDR---MLGEIEERFGALIAR    174
d1vlpa2      121 --TDTFGTDDFLKSFRPPYSDAYVGVRQ--------------DSGDPVEYTKKISHHY--    162

Query        175 V----------DWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK--    222
d1vlpa2      163 -HDVLKLPKFSKIICYSDSL--------NVEKAITYSHAAKENGMLATFGIGTNF---TN    210

Query        223 STTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGD    282
d1vlpa2      211 DFRK--------------------------------------------------------    214

Query        283 VFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYAD    342
d1vlpa2      215 ------------------------------------------------------------    215

Query        343 YEQSLS----------------------------------------------------    348
d1vlpa2      215 ------KSEPQVKSEPLNIVIKLLEVNGNHAIKISDNLGKNMGDPATVKRVKEELGYT    266


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:154.05)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLA-LKCF-AT--WSV-FDLMRDY----     51
d1vlpa2        1 -----DWDYE-NQLEQAEKKAETLFDN-GIRFSEFGTRRRRSLKAQDLIMQGIMKAVNGN     53

Query         52 -------MDGTTSSSLFEVRLGRERFGKETHAY-SVAYG------------DNEIDEVVS     91
d1vlpa2       54 PDRNKSLLLGTS-----N-ILFAKKYGVKPIGTVAHEWVMGVASISEDYLH---------     98

Query         92 HADKIIFNSISQLERFADKAA-GIARGLRLNPQRLGEWD-VPKVER-VMDRINGFMIHNN    148
d1vlpa2       99 -------ANKNAMDCWINTFGAKNAGLALTD--TFGTDDFLKSFRPPYSDAYVGVRQDSG    149

Query        149 CENKDFGLFDRMLGEIEERFGALIA----R---VDWVSLGGGIHFTGDDYPVDAFSARLR    201
d1vlpa2      150 -----------DPVEYTKKISHHYHDVLKLPKFSKIICYSDSLNV------E-KAITYSH    191

Query        202 AFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1vlpa2      192 AAKENGML-ATFGIGTNFTNDFRK-K----------------------------------    215

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVK----------    311
d1vlpa2      216 SEPQ-----------------------------------VKSE-PLNIVIKLLEVNGNHA    239

Query        312 ---------------------------KNWFNGVKMPAIAIRELDGSVRTVREFTYADYE    344
d1vlpa2      240 IKISDNLGKNMGDPATVKRVKEELGYT---------------------------------    266

Query        345 QSLS    348
d1vlpa2      267 ----    267


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.37)
DALI match                                                                   
Query         15 TRNMERIAHVREKSGAKAL----LALKCFATWSVFDLMRDY-MDGTTSSSLFEVR-----     64
d1vlpa2      101 KNAMDCWINTFGAKNAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISH    160

DALI match                                        
Query         65 LGRERFGKET----HAYSVAYGDNEIDEVVSHA     93
d1vlpa2      161 HYHDVLKLPKFSKIICYSDSLNVEKAITYSHAA    193



hit structures. 
top
21: d1i4na_ Indole-​3-​glycerophosphate synthase,​ IPGS (svm: 2.226)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.48  Contact: 1616
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.30 AHM:0.31 LBcontacta:0.98 LBcontactb:0.98 LHM:0.15
id:0.99 blosum:0.71 compass:0.39 pearson:0.99
Scaled scores:
dali:0.69 daliz:0.45 gdtts:0.56 tmscore:0.71 rmsd:0.78 AHM:0.66 LBcontacta:0.41 LBcontactb:0.63 LHM:0.39
id:0.08 blosum:0.14 compass:0.24 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 10.4 Raw score:1010.00)
Query          1 -----------mietpyylidkakltrnmeriahvrekSGAKALLALKC----------f     39
d1i4na_        1 rrlweiveakkkdileidgenlivqrrnhrflevlsgkERVKIIAEFKKaspsagdinad     60

Query         40 aTWSV-FDLMRDYMDGTTSSS--------LFEVRLGRERFGKETHAYSVAYGDNEIDEVV     90
d1i4na_       61 aSLEDfIRMYDELADAISILTekhyfkgdPAFVRAARNLTCRPILAKDFYIDTVQVKLAS    120

Query         91 S-HADKIIFNS----ISQLERFADKAA--GIARGLRLNPQrlgEWDVpkVERVMdrINGF    143
d1i4na_      121 SvGADAILIIAriltAEQIKEIYEAAEelGMDSLVEVHSR--eDLEK-vFSVIR--PKII    175

Query        144 MIHNNcenkdfglFDRMLGEIEERFgalIARVdWVSLGGGIHFTgddypvdAFSARLRAF    203
d1i4na_      176 GINTR-dldtfeiKKNVLWELLPLV---PDDT-VVVAESGIKDP-------RELKDLRGK    223

Query        204 SdrygvqIYLEPGEASITKSTtlevtvldtlynknlaivdssieahmldlliyretakvl    263
d1i4na_      224 V------NAVLVGTSIMKAEN---------------------------------------    238

Query        264 pnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpai    323
d1i4na_      239 ------------------------------------------------------------    239

Query        324 aireldgsvrtvreftyadyeqsls    348
d1i4na_      239 ------------prrfleemrawse    251


hit structure      alignment
FAST alignment (Normalized score: 5.64 Raw score:1667.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS--------------------------------     28
d1i4na_        1 ----------------------------RRLWEIVEAKKKDILEIDGENLIVQRRNHRFL     32

Query         29 -------GAKALLALKCFATWS------------------VFDLMRDYMDGTTS------     57
d1i4na_       33 EVLSGKERVKIIAEF-------KKASPSAGDINADASLEDFIRMYDELADAISILTEKHY     85

Query         58 --SSLFEVRLGRERFGKETHAYSVA--YGDNEIDEVVS-HADKIIF----NSISQLERFA    108
d1i4na_       86 FKGDPAFVRAARNLTCRPILAKD--FYIDTVQVKLASSVGADAILIIARILTAEQIKEIY    143

Query        109 DKA--AGIARGLRLNPQRLGEW----DVPKVERVMD--RINGFMIHNNCENKDFGL----    156
d1i4na_      144 EAAEELGMDSLVEV--------HSREDLEKVFS---VIRPKIIGIN----------TRDL    182

Query        157 -----FDRMLGEIEERFGALIARV----DWVSLGGGIHFTGDDYPVDAFSARLRAFSDRY    207
d1i4na_      183 DTFEIKKNVLWELLPL--------VPDDTVVVAESGIK-------DPRELKDLRG-----    222

Query        208 GVQ--IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPN    265
d1i4na_      223 ---KVNAVLVGTSI----------------------------------------------    233

Query        266 EGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAI    325
d1i4na_      234 ------------------------------------------------------------    234

Query        326 RELDGSVRTVREFTYADYEQSLS------------------    348
d1i4na_      234 -----------------------MKAENPRRFLEEMRAWSE    251


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:143.58)
Query          1 ----------------------------------------------------------MI      2
d1i4na_        1 RRLWEIVEAKKKDILEIDGENLIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDIN--     58

Query          3 ETPYYLIDKAKLTRNMERIAHVREKSGAKALLALK---CFATWSVFDLMRDYM---DGTT     56
d1i4na_       59 ----------ADASLEDFIRMYDE-LADAISILTEKHYFKGDPAFVRAARNLTCRPILAK    107

Query         57 SSSLF-EVRLGRERFGKETHAYS-VAYGDNEIDEVVS-H-----ADKIIFNSISQLERFA    108
d1i4na_      108 DFYIDTVQVKLASSVGADAILIIARILTAEQIKEIYEAAEELGMDSLVEVHSREDLEKVF    167

Query        109 DKAAGIARGLRLNP---QRLGEWDVPKVERVMDR-INGFMIHNNCENKDFGLFDRMLGEI    164
d1i4na_      168 SVIRPKIIGINTRDLDTFEIKKNVLWELLPLVPDDTVVVAESGI--------K-D-PR-E    216

Query        165 EERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKST    224
d1i4na_      217 LK--DL-RGKVNAVLV-GTSIM-K-AENPRRFLEEMRAWS-E------------------    251

Query        225 TLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVF    284
d1i4na_      252 ------------------------------------------------------------    252

Query        285 GEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYE    344
d1i4na_      252 ------------------------------------------------------------    252

Query        345 QSLS    348
d1i4na_      252 ----    252


hit structure      alignment
HHsearch alignment (Probability: 0.22 E-value:0.02)
DALI match                                                                   
Query         57 SSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFN------SISQLERFADK    110
d1i4na_      110 YIDTVQVKLASSVGADAILIIARILTAEQIKEIYEAAEELGMDSLVEVHSREDLEKVFSV    169

DALI match                                                          
Query        111 AAGIARGLRLNPQRLGEWDVPKVERVMDRI-NGFMIHNNCENKDFGLFDRM    160
d1i4na_      170 IRPKIIGINTRDLDTFEIKKNVLWELLPLVPDDTVVVAESGIKDPRELKDL    220



top
22: d1o1za_ Hypothetical protein TM1621 (svm: 2.372)

SCOP Superfamily: PLC-​like phosphodiesterases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 1482
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.34 LBcontacta:0.97 LBcontactb:0.98 LHM:0.19
id:0.97 blosum:0.10 compass:0.09 pearson:0.94
Scaled scores:
dali:0.70 daliz:0.43 gdtts:0.54 tmscore:0.66 rmsd:0.74 AHM:0.65 LBcontacta:0.40 LBcontactb:0.67 LHM:0.35
id:0.04 blosum:0.07 compass:0.14 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 10.3 Raw score:857.00)
Query          1 mietpyylidkakltrnmeriahvreKSGAKALLAL-----kcFATWSVFDLMRD-YMDG     54
d1o1za_        1 -------------------------hHHHVIVLGHRgysakylENTLEAFMKAIEaGANG     35

Query         55 TTSSS-------------------------------------------lfevrlgreRFG     71
d1o1za_       36 VELDVrlskdgkvvvshdedlkrlfgldvkirdatvselkeltdgkittlkevfenvSDD     95

Query         72 KETHAYSVAYGdnEIDEVVSH-----aDKIIFNSISQLERFAdkaAGIARGLRLNpQRLG    126
d1o1za_       96 KIINIEIKERE--AADAVLEIskkrknLIFSSFDLDLLDEKF---KGTKYGYLID-EENY    149

Query        127 ---ewDVPKVERVMdrINGFMIHNNcenkdfglfdrMLGE--IEERFGALIARVDWVSLG    181
d1o1za_      150 gsienFVERVEKER--PYSLHVPYQ-----------AFELeyAVEVLRSFRKKGIVIFVW    196

Query        182 GGIHFtgddypvdAFSARLRAFSdrygvqIYLEPGeASITksttlevtvldtlynknlai    241
d1o1za_      197 TLNDP--------EIYRKIRREI------DGVITD-EVEL--------------------    221

Query        242 vdssieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisf    301
d1o1za_      222 ------------------------------------------------------------    222

Query        302 qdaagytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1o1za_      222 ------------------------------------------fvklr    226


hit structure      alignment
FAST alignment (Normalized score: 5.41 Raw score:1516.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVRE-KSGAKALLALKC---------FATWSVFDLMR-     49
d1o1za_        1 --------------------------HHHHVIVLG----HRGYSAKYLENTLEAFMKAIE     30

Query         50 DYMDGTTSSSLF--------------------------------------------EVRL     65
d1o1za_       31 AGANGVELD---VRLSKDGKVVVSHDEDLKRLFGLDVKIRDATVSELKELTDGKITTLKE     87

Query         66 GRERFG---KETHAYSVAYGDNEIDEVVSHA------DKIIFNSISQLERFADKAAGIAR    116
d1o1za_       88 VFENV-SDDKIINIEI--KEREAADAVLEI-SKKRKNLIFSSFDLDLL---DEKFKGTKY    140

Query        117 GLRLNPQR--LGEWDVPKVERVMD---RINGFMIHNNCENKDFGLFDRM------LGEIE    165
d1o1za_      141 GYLI----DEENYGSIENFVERV-EKERPYSLHV---------------PYQAFELEYAV    180

Query        166 ERFGALIARV--DWVSLGGGIHFTGDDYPVDA----FSARLRAFSDRYGVQ--IYLEPGE    217
d1o1za_      181 EVLRSFRK--KGIVIFV---------------WTLNDPEIYRKIRR-----EIDGVIT--    216

Query        218 ASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKS    277
d1o1za_      217 ------------------------------------------------------------    217

Query        278 CLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVRE    337
d1o1za_      217 ------------------------------------------------------------    217

Query        338 FTYADYEQSLS----------    348
d1o1za_      217 -----------DEVELFVKLR    226


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:114.99)
Query          1 -------------------------------------------MIETPYYLIDK------     11
d1o1za_        1 HHHHVIVLGHRGYSAKYLENTLEAFMKAIEAGANGVELDVRLS------KDGKVVVSHDE     54

Query         12 ---------------AKL-----------TRNMERIAHVREKSGAKALLALKCFATWSVF     45
d1o1za_       55 DLKRLFGLDVKIRDA-TVSELKELTDGKI-TTLKEVFENVS-DDKIINIEIKEREAADAV    111

Query         46 DLMRDYM--DGTTSSSLFEVRLGRERFGKETHAYSVA--Y-GD-NEIDEVV-SHADKIIF     98
d1o1za_      112 LEISKKRKNLIFSSFDLDLLDEKFK--GTKYGYLIDEENYGSIENFVERVEKERPYSLHV    169

Query         99 N-S-ISQ--LERFADKAA-G-IARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENK    152
d1o1za_      170 PYQAFELEYAVEVLRSFRKKGIVIFVWTLN-----DPE-IYRKIRREIDGVIT-D-----    217

Query        153 DFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIY    212
d1o1za_      218 --------E--VEL-FVKL-R---------------------------------------    226

Query        213 LEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYM    272
d1o1za_      227 ------------------------------------------------------------    227

Query        273 ICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSV    332
d1o1za_      227 ------------------------------------------------------------    227

Query        333 RTVREFTYADYEQSLS    348
d1o1za_      227 ----------------    227


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.27)
DALI match                                      ..............  ***   ..... .
Query         38 CFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEID---EVVSHAD     94
d1o1za_       60 FGLDVKIRDATVSELKELTDGKITTLKEVFENVSDDKIINIEIKEREAADAVLEISKKRK    119

DALI match       ......... ....   **********.....  .........  *********      
Query         95 KIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDF    154
d1o1za_      120 NLIFSSFDL-DLLDEKFKGTKYGYLIDEENYGSIENFVERVEKERPYSLHVPYQAFELEY    178

DALI match         
Query        155 GL    156
d1o1za_      179 AV    180



top
23: d1nsja_ N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI (svm: 2.371)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.65  Contact: 1455
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.31 AHM:0.32 LBcontacta:0.97 LBcontactb:0.97 LHM:0.17
id:0.82 blosum:0.03 compass:0.15 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.43 gdtts:0.52 tmscore:0.68 rmsd:0.77 AHM:0.65 LBcontacta:0.37 LBcontactb:0.59 LHM:0.37
id:-0.01 blosum:0.04 compass:0.16 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 9.9 Raw score:891.40)
Query          1 mietpyylidkakltrNMERIAHVREKSGAKALLALKC----FATWSVFDLMRDYM----     52
d1nsja_        1 ------mvrvkicgitNLEDALFSVESGADAVGFVFYPkskrYISPEDARRISVELppfv     54

Query         53 -DGTTSSSLF--eVRLGRERF-GKETHAYSvAYGDNEIDEVVS-HADKIIFNS-----IS    102
d1nsja_       55 fRVGVFVNEEpekILDVASYVqLNAVQLHG-EEPIELCRKIAErILVIKAVGVsnerdME    113

Query        103 QLERFADkaagIARGLRLN----pqrlgeWDVPKVERVMDRI--NGFMIHnncenkdfgl    156
d1nsja_      114 RALNYRE----FPILLDTKtpeyggsgktFDWSLILPYRDRFryLVLSGG----------    159

Query        157 fdrMLGEIEeRFGALIaRVDWVSLGG-----GIHFtgddypVDAFSARLRAFSDRygvqi    211
d1nsja_      160 --lNPENVR-SAIDVV-RPFAVDVSSgveafPGKK------DHDSIKMFIKNAKG-----    204

Query        212 ylepgeasitksttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsy    271
d1nsja_      205 ------------------------------------------------------------    205

Query        272 micgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgs    331
d1nsja_      205 ------------------------------------------------------------    205

Query        332 vrtvreftyadyeqsls    348
d1nsja_      205 ----------------l    205


hit structure      alignment
FAST alignment (Normalized score: 6.15 Raw score:1643.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC--FATWSVFDLMRD-YMDGTTS     57
d1nsja_        1 ----------------------------MVRVKI----CGITNLEDALFSVESGADAVGF     28

Query         58 ---------SSLFEVRLGRERFG--KETHAYSVAYGDNEIDEVVS--HADKIIFN---SI    101
d1nsja_       29 VFYPKSKRYISPEDARRISVELPPFVFRVGVFVNEEPEKILDVASYVQLNAVQLHGEEPI     88

Query        102 SQLERFADKAAGIARGLRLNPQRLGEW-----DVPKVERVMDRINGFMIHNNCENKDFGL    156
d1nsja_       89 ELCRKIAE---RILVIKAVG-------VSNERDMERALNYRE--FPILLD----------    126

Query        157 FDR-------------MLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAF    203
d1nsja_      127 ---TKTPEYGGSGKTFDWSL----ILPYRDRFRYLVLSGGL-----------NPENVRSA    168

Query        204 SDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVL    263
d1nsja_      169 IDVVRP-FAVDVSSG---------------------------------------------    182

Query        264 PNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAI    323
d1nsja_      183 ------------------------------------------------------------    183

Query        324 AIRELDGSVRTVREFTYADYEQSLS-----------------------    348
d1nsja_      183 -------------------------VEAFPGKKDHDSIKMFIKNAKGL    205


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:141.19)
Query          1 ---------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALK--C--FATWSVFDL     47
d1nsja_        1 MVRVKICGI---------------TNLEDALFSVESGADAVGFVFYPKSKRYISPEDARR     45

Query         48 MRDYM-----DGTTSSSLF--EVRLGRERFGKETHAYSVAYGDNEIDEVVS-HADKIIFN     99
d1nsja_       46 ISVELPPFVFRVGVFVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVIKAVG    105

Query        100 -----SISQLERFADKAAGIARGLRLN------PQ-RLGEWDVPKVERVMDRI-NGFMIH    146
d1nsja_      106 VSNERDMERALNYR---E-FPILLDTKTPEYGGSGK---TFDWSLILPYRDRFRYLVLSG    158

Query        147 NNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGG-IHF-TGDDYPVDAFSARLRAFS    204
d1nsja_      159 GL-----------NPENVRS-AIDVV-RPFAVDVSSGVEAFPGK--KDH-DSIKMFIKNA    202

Query        205 DRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLP    264
d1nsja_      203 KG-L--------------------------------------------------------    205

Query        265 NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIA    324
d1nsja_      206 ------------------------------------------------------------    206

Query        325 IRELDGSVRTVREFTYADYEQSLS    348
d1nsja_      206 ------------------------    206


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.35)
DALI match       ....... ********........ **********   ....................  
Query         55 TTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEV---VSHADKIIFNSISQLERFADKA    111
d1nsja_       60 FVNEEPEKILDVASYVQLNAVQLHGEEPIELCRKIAERILVIKAVGVSNERDMERALNYR    119

DALI match        .........      .............                               
Query        112 AGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGAL    171
d1nsja_      120 EFPILLDTKTPEYGGSGKTFDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVV-------    172

DALI match         *********         ..............
Query        172 IARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSD    205
d1nsja_      173 --RPFAVDVSSGVEAFPGKKDHDSIKMFIKNAKG    204



top
24: d1a53a_ Indole-​3-​glycerophosphate synthase,​ IPGS (svm: 2.326)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.55  Contact: 1699
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.35 LBcontacta:0.98 LBcontactb:0.98 LHM:0.15
id:0.98 blosum:0.72 compass:0.32 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.42 gdtts:0.50 tmscore:0.66 rmsd:0.74 AHM:0.61 LBcontacta:0.41 LBcontactb:0.64 LHM:0.42
id:0.06 blosum:0.14 compass:0.23 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 10.1 Raw score:987.90)
Query          1 ----------------mietpyylidkakltrnmeriahvrEKSGaKALLALKC------     38
d1a53a_        1 prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkRNIT-AIIAEYKRkspsgl     59

Query         39 --faTWSV-FDLMRDYMDGTTSSS--------LFEVRLGRERFGKETHAYSVAYGDNEID     87
d1a53a_       60 dverDPIEySKFMERYAVGLSILTeekyfngsYETLRKIASSVSIPILMKDFIVKESQID    119

Query         88 EVVS-HADKIIFNS----ISQLERFADKAA--GIARGLRLNPQrlgEWDVpkVERVMdrI    140
d1a53a_      120 DAYNlGADTVLLIVkiltERELESLLEYARsyGMEPLIEINDE--nDLDI--ALRIG--A    173

Query        141 NGFMIHNNcenkdfglfdrMLGEIEERFGALIARVdWVSLGGGIHFtgddypvdafSARL    200
d1a53a_      174 RFIGINSR----dletleiNKENQRKLISMIPSNV-VKVAESGISE----------RNEI    218

Query        201 RAFSDRYgvQIYLEPGEASITksttlevtvldtlynknlaivdssieahmldlliyreta    260
d1a53a_      219 EELRKLG--VNAFLIGSSLMR---------------------------------------    237

Query        261 kvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkm    320
d1a53a_      238 ------------------------------------------------------------    238

Query        321 paiaireldgsvrtvreftyadyeqsls    348
d1a53a_      238 ------------------npekikefil    247


hit structure      alignment
FAST alignment (Normalized score: 6.05 Raw score:1773.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREK---------------------------------     27
d1a53a_        1 ---------------------------PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLN     33

Query         28 ---------SGAKALLALKCFA-------------TWSVFDLMRDYMDGTTS--------     57
d1a53a_       34 ERILEFNKRNITAIIAEY----KRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFN     89

Query         58 SSLFEVRLGRERFGKETHAYSVA--YGDNEIDEVVS-HADKIIF----NSISQLERFADK    110
d1a53a_       90 GSYETLRKIASSVSIPILMKD--FIVKESQIDDAYNLGADTVLLIVKILTERELESLLEY    147

Query        111 A---AGIARGLRLNPQRLGEW----DVPKVERVMD-RINGFMIHNNCEN---------KD    153
d1a53a_      148 -ARSYGMEPLIEI--------NDENDLDIALR---IGARFIGI------NSRDLETLEIN    189

Query        154 FGLFDRMLGEIEERFGALIARV----DWVSLGGGIHFTGDDYPVDA-FSARLRAFSDRYG    208
d1a53a_      190 KENQRKLISM------------IPSNVVKVAESGI-----------SERNEIEELRK-LG    225

Query        209 VQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGS    268
d1a53a_      226 V-NAFLIGSSL-------------------------------------------------    235

Query        269 HSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL    328
d1a53a_      236 ------------------------------------------------------------    236

Query        329 DGSVRTVREFTYADYEQSLS------------    348
d1a53a_      236 --------------------MRNPEKIKEFIL    247


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:144.43)
Query          1 --------------------------------------MIETPYYLIDKAKLTRNMERIA     22
d1a53a_        1 PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILE----------------------     38

Query         23 HVRE-KSGAKALLALKC-------F-ATWSV-FDLMRDYMDGTTSSS-------LF-EVR     64
d1a53a_       39 --FNKRNITAIIAEYKRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLR     96

Query         65 LGRERFGKETHAYSVAYGDNEIDEVVS-HADKIIFNS----ISQLERFADKAA--GIARG    117
d1a53a_       97 KIASSVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPL    156

Query        118 LRLNPQRLGEWDVPKVERVMDRINGFMIHNNC-----ENKDFGLFDRMLGEIEERFGALI    172
d1a53a_      157 IEIND----ENDLDIALRIG--ARFIGINSRDLETLE-------I-NK-ENQRKLISMIP    201

Query        173 ARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKST-------T    225
d1a53a_      202 SNV-VKVAESGISE------R-NEIEELRKLG----VNA-FLIGSSLMRNPEKIKEFIL-    247

Query        226 LEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFG    285
d1a53a_      248 ------------------------------------------------------------    248

Query        286 EFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQ    345
d1a53a_      248 ------------------------------------------------------------    248

Query        346 SLS    348
d1a53a_      248 ---    248


hit structure      alignment
HHsearch alignment (Probability: 0.19 E-value:0.02)
DALI match                                                                   
Query         57 SSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFN------SISQLERFADK    110
d1a53a_      112 IVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRI    171

DALI match                                                            
Query        111 AAGIARGLRLNPQRLGEWDVPKVERVMDRIN-GFMIHNNCENKDFGLFDRMLG    162
d1a53a_      172 GARF-IGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELRK    223



top
25: d1r85a_ Xylanase (svm: 1.898)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.15  Contact: 1938
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.34 AHM:0.34 LBcontacta:0.98 LBcontactb:0.98 LHM:0.17
id:0.82 blosum:0.01 compass:0.07 pearson:0.95
Scaled scores:
dali:0.69 daliz:0.42 gdtts:0.52 tmscore:0.69 rmsd:0.78 AHM:0.71 LBcontacta:0.37 LBcontactb:0.58 LHM:0.43
id:-0.00 blosum:0.02 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 11.1 Raw score:1213.70)
Query          1 mietpyylidkAKLTRnmERIAHVREksGAKALLALKcfATWS--VFDLMRD-YMDGTTS     57
d1r85a_        1 --------kphISALN-aPQLDQRYK-nEFTIGAAVE-pYQLQneKDVQMLKrHFNSIVA     49

Query         58 -SSLF--------------eVRLGRERFG---KETHAYSVA-------------------     80
d1r85a_       50 eNVMKpisiqpeegkfnfeqADRIVKFAKangMDIRFHTLVwhsqvpqwffldkegkpmv    109

Query         81 ---------------------YGDNEIDEVVSHADKIIFN--------------------     99
d1r85a_      110 netdpvkreqnkqlllkrletHIKTIVERYKDDIKYWDVVnevvgddgklrnspwyqiag    169

Query        100 ---SISQLERFADKA-AGIARGLRLNP---qrlgeWDVPKVERVM---DRINGFMIHNNc    149
d1r85a_      170 idyIKVAFQAARKYGgDNIKLYMNDYNtevepkrtALYNLVKQLKeegVPIDGIGHQSH-    228

Query        150 eNKDFGLFDRMLGEIEerfGALIARVDWVSLGGGIH------------------ftgDDY    191
d1r85a_      229 -IQIGWPSEAEIEKTI---NMFAALGLDNQITELDVsmygwpprayptydaipkqkfLDQ    284

Query        192 P--VDAFSARLRAFSdryGVQIYLEPGEaSITKsttlevtvldtlynknlaivdssieah    249
d1r85a_      285 AarYDRLFKLYEKLS---DKISNVTFWG-IADN-----------------------htwl    317

Query        250 mLDLL---------------------IYREtakvlpnegshsymicgksclagdvfgefr    288
d1r85a_      318 dSRADvyydangnvvvdpnapyakveKGKG------------------------------    347

Query        289 faeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1r85a_      348 ------------------------------------kdapfvfgpdykvkpaywaiidhk    371


hit structure      alignment
FAST alignment (Normalized score: 3.21 Raw score:1153.00)
Query          1 MIETPYYLIDKAKLT----------RNMERIAHVREKS-GAKALLALKCFA---------     40
d1r85a_        1 ---------------KPHISALNAPQLDQRYK------NEFTIGAA-----VEPYQLQNE     34

Query         41 -TWSVFDLMRDYMDGTTSS-------------------SLFEVRLGRERFGKETHAYSVA     80
d1r85a_       35 KDVQMLK---RHFNSIVAENVMKPISIQPEEGKFNFEQADRIVKFAK-ANGMDIRFH---     87

Query         81 Y--------------------------------------------GDNEIDEVVSHADKI     96
d1r85a_       88 -TLVWHSQVPQWFFLDKEGKPMVNETDPVKREQNKQLLLKRLETHIKTIVERYKDDIKYW    146

Query         97 IFN-------------------------SISQLERFADKA-AGIARGLRLNPQRLGEWDV    130
d1r85a_      147 D--VVNEVVGDDGKLRNSPWYQIAGIDYIKVAFQAARKYGGDNIKL--------------    190

Query        131 PKVERVMDRINGFMIHNNCENKD-----FGLFDRMLGEIEERFGALIAR-------VDWV    178
d1r85a_      191 -----------YMND--------YNTEVEPKRTALYNLVKQ--------LKEEGVPIDGI    223

Query        179 SLGGGIHFTGDD-YPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNK    237
d1r85a_      224 GHQSH---IQIGWPSEAEIEKTINMFA-ALGLDNQI------------------------    255

Query        238 NLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGD    297
d1r85a_      256 ------------------------------------------------------------    256

Query        298 RISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS---------    348
d1r85a_      256 ---------------------------------------------------TELDVSMYG    264

Query        349 ------------------------------------------------------------    349
d1r85a_      265 WPPRAYPTYDAIPKQKFLDQAARYDRLFKLYEKLSDKISNVTFWGIADNHTWLDSRADVY    324

Query        349 -----------------------------------------------    349
d1r85a_      325 YDANGNVVVDPNAPYAKVEKGKGKDAPFVFGPDYKVKPAYWAIIDHK    371


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:161.11)
Query          1 MIETPYYLIDK-AKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMR-DY---MDGT     55
d1r85a_        1 --------KPHI-----------------------------SALNAPQLDQRYKNEFTIG     23

Query         56 TSSSLFEV----RL-GRERFGKETHAY--SV--AY-------GDNEIDEVVS-H----AD     94
d1r85a_       24 AAVEPYQLQNEKDVQMLKRHFNSIVAENVMKPISIQPEEGKFNFEQADRIVKFAKANGMD     83

Query         95 KII-FNS--------------------------------------ISQLERFADKAAGI-    114
d1r85a_       84 IRFHTLVWHSQVPQWFFLDKEGKPMVNETDPVKREQNKQLLLKRLETHIKTIVERYKDDI    143

Query        115 ARGLRLN-P-------Q-RLGE----W-DVPKV-ERVMDRI---NGFMIHNNCENKDFGL    156
d1r85a_      144 KYWDVVNEVVGDDGKLRNSPWYQIAGIDYIKVAFQAARKYGGDNIKLYMNDY--NTEVEP    201

Query        157 FDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPG    216
d1r85a_      202 KRTALYNLVKQLKEEGVPIDGIGHQSH-I-QIGWPSEAEIEKTINMFAAL-GLDNQITEL    258

Query        217 EASITK------ST-TLEVT------------------------------------VLDT    233
d1r85a_      259 DV-SMYGWPPRA-YPTYDAIPKQKFLDQAARYDRLFKLYEKLSDKISNVTFWGIAD----    312

Query        234 LYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFR-----    288
d1r85a_      313 --------------NHTWLD-SRADVYY-------DANGN----------VVVDPNAPYA    340

Query        289 ------FAEELKVGDRISFQDAAGY-TMVKKNWFNGVKMPAIAIREL--------DGSVR    333
d1r85a_      341 KVEKGK-------------GKDAPFV-FG----------PDYKVKPAYWAIIDHK-----    371

Query        334 TVREFTYADYEQSLS    348
d1r85a_      372 ---------------    372


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.04)
DALI match       ........  ...............                                   
Query        141 NGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTG------------    188
d1r85a_      223 IGHQSHIQIGWPSEAEIEKTINMFAA--LGLDNQITELDVSMYGWPPRAYPTYDAIPKQK    280

DALI match       ................ 
Query        189 DDYPVDAFSARLRAFSD    205
d1r85a_      281 FLDQAARYDRLFKLYEK    297



hit structures. 
top
26: d1thfd_ Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF (svm: 2.126)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 1782
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.32 AHM:0.30 LBcontacta:0.98 LBcontactb:0.98 LHM:0.14
id:0.99 blosum:0.22 compass:0.24 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.40 gdtts:0.49 tmscore:0.68 rmsd:0.78 AHM:0.71 LBcontacta:0.42 LBcontactb:0.62 LHM:0.47
id:0.06 blosum:0.09 compass:0.21 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 10.2 Raw score:987.30)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALK-----------------cfATWS     43
d1thfd_        1 --------------------------mlAKRIIACLDvkdgrvvkgsnfenlrdsgDPVE     34

Query         44 VFDLMR-DYMDGTTSS-----------SLFEVRLGRERFGKETHAYSV-AYGDnEIDEVV     90
d1thfd_       35 LGKFYSeIGIDELVFLditasvekrktMLELVEKVAEQIDIPFTVGGGiHDFE-TASELI     93

Query         91 S-HADKIIFNS-----ISQLERFADKAAgIARGLRLNPQ---------------rlgeWD    129
d1thfd_       94 LrGADKVSINTaavenPSLITQIAQTFGsQAVVVAIDAKrvdgefmvftysgkkntgiLL    153

Query        130 VPKVERVMD-RINGFMIHN--NCENKDFglfdrMLGEIEeRFGALIarVDWVSLGGGIHF    186
d1thfd_      154 RDWVVEVEKrGAGEILLTSidRDGTKSG----yDTEMIR-FVRPLT--TLPIIASGGAGK    206

Query        187 tgddypvDAFSARLRAFSdrygvqIYLEPGEASITksttlevtvldtlynknlaivdssi    246
d1thfd_      207 -------MEHFLEAFLAG-----aDAALAASVFHF-------------------------    229

Query        247 eahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaag    306
d1thfd_      230 ------------------------------------------------------------    230

Query        307 ytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1thfd_      230 ------------------reidvrelkeylkkhgvnvrlegl    253


hit structure      alignment
FAST alignment (Normalized score: 5.37 Raw score:1594.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS--GAKALLALKCFA------------------     40
d1thfd_        1 ----------------------------MLAKRIIAC-----LDVKDGRVVKGSNFENLR     27

Query         41 ----TWSVFDLMRD-YMDGTTSS------------SLFEVRLGRERFGKETHAYSVAY-G     82
d1thfd_       28 DSGDPVELGKFYSEIGIDELVF-LDITASVEKRKTMLELVEKVAEQIDIPFTV-GGGIHD     85

Query         83 DNEIDEVV-SHADKIIFNSISQLERFADK----AAGI---ARGLRLNPQRLGEW------    128
d1thfd_       86 FETASELILRGADKVSI--NTAAVENPSLITQIAQTFGSQAVVVAID-------AKRVDG    136

Query        129 ----------------DVPKVERVMD-RINGFMIHN----NCENKDFGLFDRMLGE---I    164
d1thfd_      137 EFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILL--TSIDRDGTK-----------SGYD    183

Query        165 EERFGALIARV-DWVSLGGGIHFTGDDYPVDA-FSARLRAFSDRYGVQIYLEPGEASITK    222
d1thfd_      184 TEMIRFVRPLTTLPIIASGGA-----------GKMEHFLEAFL-AGA-DAALAASVF---    227

Query        223 STTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGD    282
d1thfd_      228 ------------------------------------------------------------    228

Query        283 VFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYAD    342
d1thfd_      228 ------------------------------------------------------------    228

Query        343 YEQSLS--------------------------    348
d1thfd_      228 ------HFREIDVRELKEYLKKHGVNVRLEGL    253


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:125.07)
Query          1 -------------MIETPYYLID---------KAK-L-TRNMERIAHVREKSGAKALLAL     36
d1thfd_        1 MLAKRIIACLDVK------DGRVVKGSNFENLRDSGDPVELGKFYSEI-GI-D-ELVFLD     51

Query         37 --KC--FA-T-WSVFDLMR--D-YMDGTT--SSSLFEVRLGRERFGKETHAY-S-VAYGD     83
d1thfd_       52 ITASVEKRKTMLELVEKVAEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPS    111

Query         84 NEIDEVVSHADKIIFNSISQLERFADKAAGIARGLRLNPQ------RL-------G-EWD    129
d1thfd_      112 -LITQIAQTFGSQ-----------------AVVVAIDAKRVDGEFMVFTYSGKKNTGILL    153

Query        130 VPKVERVMDR-I-NGFMIHNNCENKDFGLFDRMLGEIEERFGALIA-RVDWVSLGGGIHF    186
d1thfd_      154 R-DWVVEVEKRGAGEILLTSIDRDG---TKSG-Y--DTEMIRFVRPLTTLPIIASG-G-A    204

Query        187 TGDDYPVDAFSARLRAFSDRYGVQIYLEP--GEAS-------------------------    219
d1thfd_      205 -----G--KM-EHFLEAF-LAGADAALAASV--FHFREIDVRELKEYLKKHGVNVRLEGL    253

Query        220 ITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCL    279
d1thfd_      254 ------------------------------------------------------------    254

Query        280 AGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFT    339
d1thfd_      254 ------------------------------------------------------------    254

Query        340 YADYEQSLS    348
d1thfd_      254 ---------    254


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.02)
DALI match                                                                   
Query         62 EVRLGRERFGKETHAYSVAYGD-NEIDEVVSHADKIIF------NSISQLERFADKAAGI    114
d1thfd_      185 EMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEYLKKH    244

DALI match               
Query        115 ARGLRLNP    122
d1thfd_      245 GVNVRLEG    252



top
27: d1xyza_ Xylanase (svm: 1.850)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 1821
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.99 tmscore:0.99 rmsd:0.38 AHM:0.39 LBcontacta:0.98 LBcontactb:0.98 LHM:0.15
id:0.87 blosum:0.01 compass:0.10 pearson:0.96
Scaled scores:
dali:0.67 daliz:0.38 gdtts:0.49 tmscore:0.64 rmsd:0.74 AHM:0.66 LBcontacta:0.36 LBcontactb:0.57 LHM:0.48
id:0.00 blosum:0.03 compass:0.17 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 10.4 Raw score:1091.20)
Query          1 mietpyylidkakltrnmERIAHVREkSGAKALLALkcFATW------SVFDLMRDYMDG     54
d1xyza_        1 -----------------nALRDYAEA-RGIKIGTCV--NYPFynnsdpTYNSILQREFSM     40

Query         55 TTS--SSLF-------------eVRLGRERFG---KETHAYSVA----------------     80
d1xyza_       41 VVCenEMKFdalqprqnvfdfskGDQLLAFAErngMQMRGHTLIwhnqnpswltngnwnr    100

Query         81 ---------YGDNEIDEVVSHADKIIFN------------------------SISQLERF    107
d1xyza_      101 dsllavmknHITTVMTHYKGKIVEWDVAnecmddsgnglrssiwrnvigqdyLDYAFRYA    160

Query        108 ADKAAGIARGLRLNPQ----rlgeWDVPKVERVM---DRINGFMIHNNceNKDFGLfDRM    160
d1xyza_      161 READPDALLFYNDYNIedlgpksnAVFNMIKSMKergVPIDGVGFQCH--FINGMS-PEY    217

Query        161 LGEIEERFGALI-ARVDwVSLGGGIH-------ftgdDYPVDAFSARLRAFSDRYGVQIY    212
d1xyza_      218 LASIDQNIKRYAeIGVI-VSFTEIDIripqsenpataFQVQANNYKELMKICLANPNCNT    276

Query        213 LEPGEaSITKsttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsym    272
d1xyza_      277 FVMWG-FTDK--------------------------------------------------    285

Query        273 icgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsv    332
d1xyza_      286 -----------------------------------------ytwipgtfpgygnpliyds    304

Query        333 rtvreftyadyeqsls    348
d1xyza_      305 nynpkpaynaikealm    320


hit structure      alignment
FAST alignment (Normalized score: 4.29 Raw score:1433.00)
Query          1 MIETPYYLIDKAKLT-RNMERIAHVREKSGAKALLALKCFATWS------------VFDL     47
d1xyza_        1 ---------------NALRDYAEA----RGIKIGTC--------VNYPFYNNSDPTYNSI     33

Query         48 MRDYMDGTTSS-------------------SLFEVRLGRERFGKETHAYSVAY-------     81
d1xyza_       34 LQREFSMVVCENEMKFDALQPRQNVFDFSKGDQLLAFAE-RNGMQMRGH----TLIWHNQ     88

Query         82 ----------------------GDNEIDEVVSHADKIIFN--------------------     99
d1xyza_       89 NPSWLTNGNWNRDSLLAVMKNHITTVMTHYKGKIVEWD--VANECMDDSGNGLRSSIWRN    146

Query        100 ------SISQLERFADKAAGIARGLRLNPQRLGEW------------DVPKVERVM----    137
d1xyza_      147 VIGQDYLDYAFRYAREADPDALLFYND--------YNIEDLGPKSNAVFNMIKS--MKER    196

Query        138 -DRINGFMIHNNCEN------KDFGLFDRMLGEIEERFGALIARV--DWVSLGGGIHFTG    188
d1xyza_      197 GVPIDGVGFQ-----CHFINGMSPEYLASIDQNIK-RYAE-----IGVIVSF--------    237

Query        189 DDY---------------PVDAFSARL---RAFSDRYGVQ--IYLEPGEASITKSTTLEV    228
d1xyza_      238 ---TEIDIRIPQSENPATAFQVQANNYKELMKICLANP--NCNTFV--------------    278

Query        229 TVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFR    288
d1xyza_      279 ------------------------------------------------------------    279

Query        289 FAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1xyza_      279 ------------------------------------------------------------    279

Query        349 ------------------------------------------    349
d1xyza_      279 MWGFTDKYTWIPGTFPGYGNPLIYDSNYNPKPAYNAIKEALM    320


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:152.53)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDY----MDGTT     56
d1xyza_        1 --------------------------------------------NALRDYAEARGIKIGT     16

Query         57 SSSL-FE------VRLGRERFGKETHAY--SV--AY-------GDNEIDEVVS-H-----     92
d1xyza_       17 CVNYPFYNNSDPTYNSILQREFSMVVCENEMKFDALQPRQNVFDFSKGDQLLAFAERNGM     76

Query         93 ADKIIFNS----------------------I-SQLERFADKAAGI-ARG-LRL-NP----    122
d1xyza_       77 QMRGHTLIWHNQNPSWLTNGNWNRDSLLAVMKNHITTVMTHYKGKIVEWDVANECMDDSG    136

Query        123 ---Q-RLGE-----WDVPKV-ERVMDRI--NGFMIHNNCENKDFGLFDRMLGEIEERFGA    170
d1xyza_      137 NGLRSSIWRNVIGQDYLDYAFRYAREADPDALLFYNDYN-IEDLGPKSNAVFNMIKSMKE    195

Query        171 LIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK--STTLE-    227
d1xyza_      196 RGVPIDGVGFQCHFINGMSPEYLASIDQNIKRYAEI-GVIVSFTEIDI-RIPQSENPATA    253

Query        228 -------------------------------VTVLDTLYNKNLAIVDSSIEAHMLDLLIY    256
d1xyza_      254 FQVQANNYKELMKICLANPNCNTFVMWGFTD--------------------KYTWIP-GT    292

Query        257 RETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFN    316
d1xyza_      293 FPGY-------------------------------------------GNPLIYD------    303

Query        317 GVKMPAIAIREL---------DGSVRTVREFTYADYEQSLS    348
d1xyza_      304 ----SNYNPKPAYNAIKEALM--------------------    320


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.58)
DALI match                                                                   
Query        148 NCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRY    207
d1xyza_      173 DYNIEDLGPKSNAVFNMIKSMKERGVPIDGVGFQCHFINGMSPEYLASIDQNIKRYAEIG    232

DALI match                
Query        208 GVQIYLEPG    216
d1xyza_      233 VIVSFTEID    241



top
28: d1km4a_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) (svm: 2.190)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.65  Contact: 1601
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.32 AHM:0.34 LBcontacta:0.97 LBcontactb:0.98 LHM:0.16
id:0.99 blosum:0.68 compass:0.25 pearson:0.98
Scaled scores:
dali:0.69 daliz:0.43 gdtts:0.56 tmscore:0.70 rmsd:0.76 AHM:0.65 LBcontacta:0.38 LBcontactb:0.63 LHM:0.43
id:0.07 blosum:0.14 compass:0.22 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 10.3 Raw score:936.00)
Query          1 mietpyylidkakltrnmeriahvreksgAKALLALKC---faTWSVFDLMRDYMDGTTS     57
d1km4a_        1 ---------------------------vmNRLILAMDLmnrddALRVTGEVREYIDTVKI     33

Query         58 SS-------LFEVRLGRERFGKETHAYSVA-----yGDNEIDEVVS-HADKIIFNS---I    101
d1km4a_       34 GYplvlsegMDIIAEFRKRFGCRIIADFAVadipetNEKICRATFKaGADAIIVHGfpgA     93

Query        102 SQLERFADKAA--GIARGLRLNP------qrlgeWDVPKVERVM-DRINGFMIHNNcenk    152
d1km4a_       94 DSVRACLNVAEemGREVFLLTEMshpgaemfiqgAADEIARMGVdLGVKNYVGPST----    149

Query        153 dfglfdrMLGEIEeRFGA-LIARVdWVSLGGGIHFtgddypvdaFSARLRAfsdrygvqI    211
d1km4a_      150 -------RPERLS-RLREiIGQDS-FLISPGVGAQ-------ggDPGETLR------faD    187

Query        212 YLEPGEAS-ITKSttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshs    270
d1km4a_      188 AIIVGRSIyLADN-----------------------------------------------    200

Query        271 ymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldg    330
d1km4a_      201 ------------------------------------------------------------    201

Query        331 svrtvreftyadyeqsls    348
d1km4a_      201 ------paaaaagiiesi    212


hit structure      alignment
FAST alignment (Normalized score: 5.38 Raw score:1463.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGA---KALLALKCFA-------TWSVFDLMRD     50
d1km4a_        1 ------------------------------VMNRLILAM----DLMNRDDALRVTGEVRE     26

Query         51 YMDGTTSS--------SLFEVRLGRERFGKETHAYSVAY--------GDNEIDEVVS-HA     93
d1km4a_       27 YIDTVKI-GYPLVLSEGMDIIAEFRKRFGCRIIADF---AVADIPETNEKICRATFKAGA     82

Query         94 DKIIF---NSISQLERFADKA--AGIARGLRLNPQRLGEW------------------DV    130
d1km4a_       83 DAIIVHGFPGADSVRACLNVAEEMGREVFLL---------TEMSHPGAEMFIQGAADEIA    133

Query        131 PKVERVMD-RINGFMIHNNCE--NKDFGLFDRMLGEIEERFGALIARV----DWVSLGGG    183
d1km4a_      134 RMGVD---LGVKNYV------GPSTRPERLSRLREI------------IGQDSFLI----    168

Query        184 IHFTG------DDYPVDAFSARLRAFSDRYGVQ-IYLEPGEASITKSTTLEVTVLDTLYN    236
d1km4a_      169 -----SPGVGAQGGDPGETLRF-----------ADAIIVGRSIY----------------    196

Query        237 KNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVG    296
d1km4a_      197 ------------------------------------------------------------    197

Query        297 DRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------    348
d1km4a_      197 ----------------------------------------------------LADNPAAA    204

Query        349 --------    349
d1km4a_      205 AAGIIESI    212


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:142.95)
Query          1 -MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF---ATWSVFDLMRDYMDGTT     56
d1km4a_        1 V---------------------M--N-----RLILAMDLMNRDDALRVTGEVREYIDTVK     32

Query         57 SSS--L----F-EVRLGRERFGKETHAYSVAY----G-DNEIDEVVS-HADKIIFNS--I    101
d1km4a_       33 IGYPLVLSEGMDIIAEFRKRFGCRIIADFAVADIPETNEKICRATFKAGADAIIVHGFPG     92

Query        102 -SQLERFADKAA--GIARGLRLNP-----Q-RLGEWDVPKVERVM-DRINGFMIHNNCEN    151
d1km4a_       93 ADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPST---    149

Query        152 KDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHF--TGDDYPVDAFSARLRAFSDRYGV    209
d1km4a_      150 --------RPERLSR-LREIIGQDSFLISPGVGAQGG------D--PG-ETLRFA-----    186

Query        210 QIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSH    269
d1km4a_      187 -DAIIVGRSIYLADN---------------------------------------------    200

Query        270 SYMICGKSCLAGDVFGEFRFAEELKVGDRISFQD-----------AAGYTMVKKNWFNGV    318
d1km4a_      201 ---------------------------------PAAAAAGIIESI---------------    212

Query        319 KMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1km4a_      213 ------------------------------    213


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.22)
DALI match                                             
Query        161 LGEIEERFGALIARVDWVSLGGGIHFTGDDYPVDAFSA    198
d1km4a_       14 RDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRK     51



top
29: d1piia2 N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI (svm: 2.194)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.55  Contact: 1502
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.33 AHM:0.31 LBcontacta:0.97 LBcontactb:0.97 LHM:0.16
id:0.92 blosum:0.21 compass:0.31 pearson:0.99
Scaled scores:
dali:0.69 daliz:0.41 gdtts:0.51 tmscore:0.66 rmsd:0.76 AHM:0.69 LBcontacta:0.43 LBcontactb:0.65 LHM:0.43
id:0.02 blosum:0.08 compass:0.21 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 9.3 Raw score:886.00)
Query          1 mietpyylidkakltrnmeriahvreksgAKALLALKcfATWSVFDLMRDY-MDGTTSSS     59
d1piia2        1 -----------------------------GENKVCGL--TRGQDAKAAYDAgAIYGGLIF     29

Query         60 ---------lfevRLGRERFGKETHAYSVAYGDNEIDEVVS--HADKIIF-NSIS--QLE    105
d1piia2       30 vatsprcvnveqaQEVMAAAPLQYVGVFRNHDIADVVDKAKvlSLAAVQLhGNEEqlYID     89

Query        106 RFADKA-AGIARGLRLNPQrlgeWDVPkvervMDRINGFMIHN---NCENkdfglfdrML    161
d1piia2       90 TLREALpAHVAIWKALSVG-etlPARE-----FQHVDKYVLDNgqgGSGQ------rfDW    137

Query        162 GEIEErfGALIarvdWVSLGGGIHFtgddypvdaFSARLRAFSdrygvqIYLEPGEASIT    221
d1piia2      138 SLLNG--QSLG----NVLLAGGLGA--------dNCVEAAQTG-----cAGLDFNSAVES    178

Query        222 Ksttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksclag    281
d1piia2      179 Q-----------------------------------------------------------    179

Query        282 dvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvreftya    341
d1piia2      180 ------------------------------------------------pgikdarllasv    191

Query        342 dyeqsls    348
d1piia2      192 fqtlray    198


hit structure      alignment
FAST alignment (Normalized score: 5.40 Raw score:1418.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC--FATWSVFDLMRD-YMDGTTS     57
d1piia2        1 -----------------------------GENKV----CGLTRGQDAKAAYDAGAIYGGL     27

Query         58 ---------SSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVS--HADKIIF---NSISQ    103
d1piia2       28 IFVATSPRCVNVEQAQEVMAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLY     87

Query        104 LERFADK-AAGIARGLRLNPQRLGEWDVPKVERV---------MDRINGFMIHNNCENKD    153
d1piia2       88 IDTLREALPAHVAIWKALS---------------VGETLPAREFQHVDKYVL--------    124

Query        154 FGLFDR-----------MLGEIEERFGALIARVD----WVSLGGGIHFTGDD--YPVDAF    196
d1piia2      125 ------DNGQGGSGQRFDWSLLNG----------QSLGNVLLAGGL------GADNCVEA    162

Query        197 SARLRAFSDRYGVQ---IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDL    253
d1piia2      163 AQ------------TGCAGLDFNSAV----------------------------------    176

Query        254 LIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKN    313
d1piia2      177 ------------------------------------------------------------    177

Query        314 WFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS----------------------    348
d1piia2      177 -----------------------------------ESQPGIKDARLLASVFQTLRAY    198


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:135.94)
Query          1 --------MIETPYYLIDKAKLTRNMERIAHVREKSGA-KALLALK--C--FATWSVFDL     47
d1piia2        1 GENKVCGL---------------TRG-QDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQE     44

Query         48 MRDYM-D-G-TTSSSLF--EVRLGRERFGKETHAYSVAYGDNEIDEVVS-H---AD-KII     97
d1piia2       45 VMAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKA    104

Query         98 FNS---ISQLERFADKAAGIARGLRLN----PQRLGEWDVPKVERVMDRINGFMIHNNCE    150
d1piia2      105 LSVGETLP-AR--EFQHV-DKYVLDNGQGGSGQ--R-FDWSLLNGQSLGNVLLAG-GL--    154

Query        151 NKDFGLFDRMLGEIEERFGALIARVDWVSLGGG-IHF-TGDDYPVDAFSARLRAFSDRYG    208
d1piia2      155 ---------GADNCVE-AAQT--GCAGLDFNSAVESQPGI--KDA-RLLASVFQTLRAY-    198

Query        209 VQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGS    268
d1piia2      199 ------------------------------------------------------------    199

Query        269 HSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL    328
d1piia2      199 ------------------------------------------------------------    199

Query        329 DGSVRTVREFTYADYEQSLS    348
d1piia2      199 --------------------    199


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.07)
DALI match             ****************************.......     ....*********.
Query         58 SSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIF-----NSISQLERFADKAA    112
d1piia2       37 VNVEQAQEVMAAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALP     96

DALI match        *********** 
Query        113 -GIARGLRLNPQR    124
d1piia2       97 AHVAIWKALSVGE    109



top
30: d1ur1a_ Xylanase (hh: 0.930)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.29  Contact: 1933
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.35 AHM:0.38 LBcontacta:0.98 LBcontactb:0.98 LHM:0.22
id:0.96 blosum:0.04 compass:0.09 pearson:0.96
Scaled scores:
dali:0.70 daliz:0.43 gdtts:0.52 tmscore:0.69 rmsd:0.76 AHM:0.67 LBcontacta:0.37 LBcontactb:0.60 LHM:0.37
id:0.03 blosum:0.05 compass:0.16 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 11.0 Raw score:1162.60)
Query          1 mietpyylidkakltrnmeRIAHVREkSGAKALLALK-cFATWS---VFDLMRDYMDGTT     56
d1ur1a_        1 -------------------GLKSAYK-DNFLIGAALNatIASGAderLNTLIAKEFNSIT     40

Query         57 S-SSLF-----------------evRLGRERFGKETHAYSVA------------------     80
d1ur1a_       41 PeNCMKwgvlrdaqgqwnwkdadafVAFGTKHNLHMVGHTLVwhsqihdevfknadgsyi    100

Query         81 -----------yGDNEIDEVVSHADKIIFN-----------------------SISQLER    106
d1ur1a_      101 skaalqkkmeehITTLAGRYKGKLAAWDVVneavgddlkmrdshwykimgddfIYNAFTL    160

Query        107 FADKAAGIARGLRLNP---qrlgeWDVPKVERVM---DRINGFMIHNNceNKDFGLFDRM    160
d1ur1a_      161 ANEVDPKAHLMYNDYNiertgkreATVEMIERLQkrgMPIHGLGIQGH--LGIDTPPIAE    218

Query        161 LGEIEerfGALIARVDWVSLGGGIH-----------------------------ftgDDY    191
d1ur1a_      219 IEKSI---IAFAKLGLRVHFTSLDVdvlpsvweevstrfeykperdpytkglpqemqDKL    275

Query        192 P--VDAFSARLRAFSDrygVQIYLEPGEaSITKSttlevtvldtlynknlaivdssieah    249
d1ur1a_      276 AkrYEDLFKLFIKHSD---KIDRATFWG-VSDDA--------------------------    305

Query        250 mldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfQDAAgytm    309
d1ur1a_      306 ----------------------------------swlngfpipgrtnypllfDRKL----    327

Query        310 vkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1ur1a_      328 --------------------qpkdayfrlldlkrlehhh    346


hit structure      alignment
FAST alignment (Normalized score: 4.44 Raw score:1541.00)
Query          1 MIETPYYLIDKAKLTRNMERIAH-VREKS---GAKALLALKC----FATWS----VFDLM     48
d1ur1a_        1 -----------------------GLKSA-YKDNFLIGAA---LNATIASG-ADERLNTLI     32

Query         49 RDYMDGTTSS-------------------SLFEVRLGRERFGKETHAYSVAY--------     81
d1ur1a_       33 AKEFNSITPENCMKWGVLRDAQGQWNWKDADAFVAFGT-KHNLHMVGH----TLVWHSQI     87

Query         82 -------------------------GDNEIDEVVSHADKIIFN-----------------     99
d1ur1a_       88 HDEVFKNADGSYISKAALQKKMEEHITTLAGRYKGKLAAWD--VVNEAVGDDLKMRDSHW    145

Query        100 --------SISQLERFADKAAGIARGLRLNPQRLGEW-----------DVPKVERVM---    137
d1ur1a_      146 YKIMGDDFIYNAFTLANEVDPKAHLMYND--------YNIERTGKREATVEMIER--LQK    195

Query        138 --DRINGFMIHNNCEN-------KDFGLFDRMLGEIEERFGALIARV--DWVSLGGGIHF    186
d1ur1a_      196 RGMPIHGLGIQ-----GHLGIDTPPIAEIEKSIIAFAK---------LGLRVHFT-----    236

Query        187 TGDDY-------------------------------------PVDAFSARLRAFSDRYGV    209
d1ur1a_      237 -----SLDVDVLPSVWEEVSTRFEYKPERDPYTKGLPQEMQDKLAKRYEDLFKLFIK---    288

Query        210 Q-----IYLEPGE--ASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKV    262
d1ur1a_      289 -HSDKIDRAT---FWGVSD-----------------------------------------    303

Query        263 LPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d1ur1a_      304 ------------------------------------------------------------    304

Query        323 IAIRELDGSVRTVREFTYADYEQSLS----------------------------------    348
d1ur1a_      304 --------------------------DASWLNGFPIPGRTNYPLLFDRKLQPKDAYFRLL    337

Query        349 ---------    349
d1ur1a_      338 DLKRLEHHH    346


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:145.74)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFAT---W-SVFDLMR-DYMDGT     55
d1ur1a_        1 --------------G--LKSAYK-DN--F-LIGAALNATIASGADERLNTLIAKEFNSIT     40

Query         56 TSSS-----L---------FEVRLGRERF----GKETHAYS----VAY------------     81
d1ur1a_       41 PENCMKWGVLRDAQGQWNWKDADAFVAFGTKHNLHMVGHTLVWHSQIHDEVFKNADGSYI    100

Query         82 ----GDNEIDEVVSHADKIIFNSISQLERFADK-AA--GI---AR-GLRLNPQ-------    123
d1ur1a_      101 SKAA------------------LQKKMEEHITTLAGRYKGKLAAWDVVNEAVGDDLKMRD    142

Query        124 RLGEW--DVPKVERVMDRIN-------GFMIHNNCENKDFGLFDRMLGEIEERFGALIA-    173
d1ur1a_      143 SHWYKIMGDDFIYNAFTLANEVDPKAHLMYNDYN--I--E--RTGKREATVEMIERLQKR    196

Query        174 -RVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK----------    222
d1ur1a_      197 GMPIHGLGIQGHLG-IDTPPIAEIEKSIIAFA-KLGLRVHFTSLDV--DVLPSVWEEVST    252

Query        223 STTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRET--AKV---LPNE-----------    266
d1ur1a_      253 -------------------------------RFEYKPERDPYTKGLPQEMQDKLAKRYED    281

Query        267 --------------------GSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAG    306
d1ur1a_      282 LFKLFIKHSDKIDRATFWGV-----------------------------------SDDAS    306

Query        307 YTMVK-------------KNWFNGVKMPAIAIREL----------------DGSVRTVRE    337
d1ur1a_      307 WLNGFPIPGRTNYPLLFD-----------RKLQPKDAYFRLLDLKRLEHHH---------    346

Query        338 FTYADYEQSLS    348
d1ur1a_      347 -----------    347


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.06)
DALI match       **************** ...     ...  *******..     .........  .....
Query        104 LERFADKAAGIARGLR-LNPQRLGEWDV--PKVERVMDR-----INGFMIHNNCENKDFG    155
d1ur1a_      158 FTLANEVDPKAHLMYNDYNIERTGKREATVEMIERLQKRGMPIHGLGIQGHLGIDTPPIA    217

DALI match       ..........  
Query        156 LFDRMLGEIEER    167
d1ur1a_      218 EIEKSIIAFAKL    229



hit structures. 
top
31: d1vc4a_ Indole-​3-​glycerophosphate synthase,​ IPGS (svm: 2.373)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.52  Contact: 1792
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.99 tmscore:0.99 rmsd:0.33 AHM:0.33 LBcontacta:0.98 LBcontactb:0.98 LHM:0.14
id:0.93 blosum:0.31 compass:0.24 pearson:0.98
Scaled scores:
dali:0.66 daliz:0.40 gdtts:0.53 tmscore:0.68 rmsd:0.76 AHM:0.66 LBcontacta:0.39 LBcontactb:0.63 LHM:0.46
id:0.01 blosum:0.10 compass:0.22 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 9.7 Raw score:962.60)
Query          1 ----------------mietpyylidkakltrnmeriahvrekSGAKALLALKC------     38
d1vc4a_        1 mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrPGLSVIAEVKRqspseg     60

Query         39 ----fATWSVFDLMRD-YMDGTTSSS--------LFEVRLGRERFGKETHAYSVAYGDNE     85
d1vc4a_       61 lirevDPVEAALAYARgGARAVSVLTephrfggsLLDLKRVREAVDLPLLRKDFVVDPFM    120

Query         86 IDEVVS-HADKIIFNS---ISQLERFADKAA--GIARGLRLNPQrlgEWDVpkVERVMdr    139
d1vc4a_      121 LEEARAfGASAALLIVallGELTGAYLEEARrlGLEALVEVHTE--rELEI--ALEAG--    174

Query        140 INGFMIHNNcenkdfglFDRMLGEIEERFG-ALIArvDWVSLGGGIHFtgddypVDAFSa    198
d1vc4a_      175 AEVLGINNR-dlatlhiNLETAPRLGRLARkRGFG--GVLVAESGYSR------KEELK-    224

Query        199 RLRAFsdrygvqIYLEPGEASITKSTtlevtvldtlynknlaivdssieahmldlliyre    258
d1vc4a_      225 ALEGL------fDAVLIGTSLMRAPD----------------------------------    244

Query        259 takvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngv    318
d1vc4a_      245 ------------------------------------------------------------    245

Query        319 kmpaiaireldgsvrtvreftyadyeqsls    348
d1vc4a_      245 --------------------leaalrelvg    254


hit structure      alignment
FAST alignment (Normalized score: 5.95 Raw score:1767.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS--------------------------------     28
d1vc4a_        1 ----------------------------MRPDLSRVPGVLGEIARKRASEVAPYPLPEPP     32

Query         29 ------------GAKALLALKCFA--------------TWSVFDLMRD-YMDGTTS----     57
d1vc4a_       33 SVPSFKEALLRPGLSVIAEV----KRQSPSEGLIREVDPVEAALAYARGGARAVSVLTEP     88

Query         58 ----SSLFEVRLGRERFGKETHAYSVA--YGDNEIDEVVS-HADKIIFN--------SIS    102
d1vc4a_       89 HRFGGSLLDLKRVREAVDLPLLRKD--FVVDPFMLEEARAFGASAALL-IVALLGELTGA    145

Query        103 QLERFADKAAGIARGLRLNPQRLGEW----DVPKVERVMD-RINGFMIHNNCEN------    151
d1vc4a_      146 YLEEARR--LGLEALVEV--------HTERELEIALE---AGAEVLGI------NNRDLA    186

Query        152 ---KDFGLFDRMLGEIEERFGALIAR---VDWVSLGGGIHFTGDDYP-VDAFSARLRAFS    204
d1vc4a_      187 TLHINLETAPRLGRLARK--------RGFGGVLVAESGY--------SRKEELKALEG--    228

Query        205 DRYGVQ--IYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKV    262
d1vc4a_      229 ------LFDAVLIGTSL-------------------------------------------    239

Query        263 LPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d1vc4a_      240 ------------------------------------------------------------    240

Query        323 IAIRELDGSVRTVREFTYADYEQSLS---------------    348
d1vc4a_      240 --------------------------MRAPDLEAALRELVG    254


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:145.66)
Query          1 ----------------------------------------MIETPYYLIDKAKLTRNMER     20
d1vc4a_        1 MRPDLSRVPGVLGEIARKRASEVAPYPLPEPPSVPSFKEA--------------------     40

Query         21 IAHVR--EKSGAKALLALKCF---------AT-WSVFDLMRDY-MDGTTSSS--------     59
d1vc4a_       41 ----LLR--PGLSVIAEVKRQSPSEGLIREVDPVEAALAYARGGARAVSVLTEPHRFGGS     94

Query         60 LFEVRLGRERFGKETHAYSVAYGDNEIDEVVS-HADKIIFN---S-ISQLERFADKAA-G    113
d1vc4a_       95 LLDLKRVREAVDLPLLRKDFVVDPFMLEEARAFGASAALLIVALLGELTGAYLEEARRLG    154

Query        114 IARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNN----CENKDFGLFDRMLGEIEERFG    169
d1vc4a_      155 LEALVEVHTE---RELE-IALEAG--AEVLGINNRDLATLHI----NL-ETAPRLGRLAR    203

Query        170 ALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVT    229
d1vc4a_      204 KR-GFGGVLVAESGYSR------K-EELKALEGLF-----DA-VLIGTSLMRAPD-----    244

Query        230 VLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRF    289
d1vc4a_      245 ------------------------------------------------------------    245

Query        290 AEELKVGDRISFQDAA---------GYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTY    340
d1vc4a_      245 ---------------LEAALRELVG-----------------------------------    254

Query        341 ADYEQSLS    348
d1vc4a_      255 --------    255


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.25)
DALI match                                                                   
Query         82 GDNEIDEVVSHADKIIF----------NSISQLERFADKAAGIARGLRLNPQRLGEWDVP    131
d1vc4a_      163 TERELEIALEAGAEVLGINNRDLATLHINLETAPRLGRLARKRGFGGVLVAE-SGYSRKE    221

DALI match                                        
Query        132 KVERVMDRINGFMIHNNCENKDFGLFDRMLGEI    164
d1vc4a_      222 ELKALEGLFDA--VLIGTSLMRAPDLEAALREL    252



top
32: d1i1wa_ Xylanase A,​ catalytic core (svm: 1.572)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 1995
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.99 tmscore:0.99 rmsd:0.36 AHM:0.37 LBcontacta:0.98 LBcontactb:0.98 LHM:0.16
id:0.89 blosum:0.02 compass:0.11 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.39 gdtts:0.50 tmscore:0.67 rmsd:0.75 AHM:0.65 LBcontacta:0.35 LBcontactb:0.55 LHM:0.45
id:0.01 blosum:0.04 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 10.4 Raw score:1070.40)
Query          1 mietpyylidkakLTRNMerIAHVREKSGA-KALLALKcfATWS---VFDLMRDYMDGTT     56
d1i1wa_        1 -------------XAAQS--VDQLIKARGKvYFGVATD-qNRLTtgkNAAIIQANFGQVT     44

Query         57 S-SSLF--------------EVRLGRERFG---KETHAYSVA------------------     80
d1i1wa_       45 PeNSMKwdatepsqgnfnfaGADYLVNWAQqngKLIRGHTLVwhsqlpswvssitdkntl    104

Query         81 ------YGDNEIDEVVSHADKIIFN-----------------------sISQLERFADKA    111
d1i1wa_      105 tnvmknHITTLMTRYKGKIRAWDVVneafnedgslrqtvflnvigedyiPIAFQTARAAD    164

Query        112 AGIARGLRLNP-----qrlgeWDVPKVERVM---DRINGFMIHNNceNKDFgLFDRmLGE    163
d1i1wa_      165 PNAKLYINDYNldsasypktqAIVNRVKKWRaagVPIDGIGSQTH--LSAG-QGAS-VLQ    220

Query        164 IEERFGALiaRVDWVSLGGGIHftGDDYP-vdafSARLRAFSdrygVQIYLEPGEaSITK    222
d1i1wa_      221 ALPLLASA--GTPEVAITELDV-aGASSTdyvnvVNACLNVS----SCVGITVWG-VADP    272

Query        223 sttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgksclagd    282
d1i1wa_      273 ------------------------------------------------------------    273

Query        283 vfgefrfaeelkvgdrisfqDAAGytmvkknwfngvkmpaiaireldgsvrtvreftyad    342
d1i1wa_      273 -------dswrasttpllfdGNFN----------------------------pkpaynai    297

Query        343 yeqsls    348
d1i1wa_      298 vqnlqq    303


hit structure      alignment
FAST alignment (Normalized score: 4.98 Raw score:1617.00)
Query          1 MIETPYYLIDKAKLTRNM----ERIAHVREKSGA-KALLALKCFA----------TWSVF     45
d1i1wa_        1 ------------------XAAQSVDQLIKA-RGKVYFGVA-----TDQNRLTTGKNAAII     36

Query         46 DLMRDYMDGTTSS-------------------SLFEVRLGRERFGKETHAYSVAY-----     81
d1i1wa_       37 ---QANFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQ-QNGKLIRGH----TLVWH     88

Query         82 -----------------------GDNEIDEVVSHADKIIFN-------------------     99
d1i1wa_       89 SQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWD--VVNEAFNEDGSLRQTVFLN    146

Query        100 ------SISQLERFADKAAGIARGLRLNPQRLGEW-------------DVPKVERVM---    137
d1i1wa_      147 VIGEDYIPIAFQTARAADPNAKLYIND--------YNLDSASYPKTQAIVNRVKK--WRA    196

Query        138 --DRINGFMIHNNCENK------DFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGD    189
d1i1wa_      197 AGVPIDGIGSQ------THLSAGQGASVLQALPLLAS------AGTPEVAIT--------    236

Query        190 DYP-------VDAFSARLRAFSDRYGVQ--IYLEPGE--ASITKSTTLEVTVLDTLYNKN    238
d1i1wa_      237 ---ELDVAGASSTDYVNVVNACLNVS--SCVGIT---VWGVAD-----------------    271

Query        239 LAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDR    298
d1i1wa_      272 ------------------------------------------------------------    272

Query        299 ISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS----------    348
d1i1wa_      272 --------------------------------------------------PDSWRASTTP    281

Query        349 ----------------------    349
d1i1wa_      282 LLFDGNFNPKPAYNAIVQNLQQ    303


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:144.95)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALK-CFA----TWSVFDLMRDYMDGT     55
d1i1wa_        1 --------X-AA-QS--VDQLIK-ARG-KVYFGVATDQNRLTTGKNAAIIQANF--G-QV     43

Query         56 TS-SS---------------LFEVRLGRER--FGKETHAYS-----VAY-----------     81
d1i1wa_       44 TPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVSSITDKNT    103

Query         82 GDNEIDEVVSHADKIIFNSISQLERFADKAA--GI-A--RGLRL-NPQ------RLGEW-    128
d1i1wa_      104 -----------------LTNVMKNHITTLMTRYKGKIRAWDVVNEAFNEDGSLRQTVFLN    146

Query        129 --DVPKVERVMDRIN-------GFMIHNNCENKDFGLFDRMLGEIEERFGALIA--RVDW    177
d1i1wa_      147 VIGEDYIPIAFQTARAADPNAKLYINDYN--L-DSAS-YPKTQAIVNRVKKWRAAGVPID    202

Query        178 VSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKS--------------    223
d1i1wa_      203 GIGSQTHLSAGQGASVLQALPLLASA--G-TPEVAITELDVAGASSTDYVNVVNACLNVS    259

Query        224 -----------TTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYM    272
d1i1wa_      260 SCVGITVWGVA-------------------------DPDSW--R-A-ST-----------    279

Query        273 ICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL----    328
d1i1wa_      280 ------------------------------TPLLFDG-------------NFNPKPAYNA    296

Query        329 -------DGSVRTVREFTYADYEQSLS    348
d1i1wa_      297 IVQNLQQ--------------------    303


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.53)
DALI match                                      
Query        183 GIHFTGDDYPVDAFSARLRAFSDRYGVQIYL    213
d1i1wa_      205 GSQTHLSAGQGASVLQALPLLASAGTPEVAI    235



top
33: d1muma_ 2-​methylisocitrate lyase (svm: 2.372)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.46  Contact: 1744
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.96 tmscore:0.97 rmsd:0.58 AHM:0.52 LBcontacta:0.97 LBcontactb:0.98 LHM:0.20
id:0.87 blosum:0.13 compass:0.15 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.42 gdtts:0.43 tmscore:0.56 rmsd:0.58 AHM:0.56 LBcontacta:0.36 LBcontactb:0.59 LHM:0.42
id:0.00 blosum:0.07 compass:0.19 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 9.8 Raw score:1010.40)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALkcFATWsVFDLMR-DYMDGTTSS-     58
d1muma_        1 -------------lhspgkafraaltkeNPLQIVGT--INAN-HALLAQrAGYQAIYLSg     44

Query         59 --------------------SLFEVRLGRERFGKETHAYSVAYG-------DNEIDEVVS     91
d1muma_       45 ggvaagslglpdlgistlddVLTDIRRITDVCSLPLLVDADIGFgssafnvARTVKSMIK    104

Query         92 -HADKIIFNS---------------------ISQLERFADKA--AGIARGLRLNPQ--rl    125
d1muma_      105 aGAAGLHIEDqvgakrcghrpnkaivskeemVDRIRAAVDAKtdPDFVIMARTDALaveg    164

Query        126 geWDVPKVERV-MDRINGFMIHNncenkdfglfdRMLGEIEeRFGALIArvDWVSLGGGI    184
d1muma_      165 ldAAIERAQAYvEAGAEMLFPEA----------iTELAMYR-QFADAVQ--VPILANITE    211

Query        185 HftgddypvdaFSARLRAFSdrygvqIYLEPGEASITKS--TTLE----VTVLdtlynkn    238
d1muma_      212 F----gatplfTTDELRSAH-----vAMALYPLSAFRAMnrAAEHvynvLRQE-------    255

Query        239 laivdssieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdr    298
d1muma_      256 ------------------------------------------------------------    256

Query        299 isfqdaagytmvkknwfngvkmpaiaIRELdgsvRTVR-----eftyADYEQsls    348
d1muma_      256 ------------------gtqksvidTMQT---rNELYesinyyqyeEKLDNlfa    289


hit structure      alignment
FAST alignment (Normalized score: 3.92 Raw score:1243.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS---------------GAKALLALKCF-ATWSV     44
d1muma_        1 ----------------------------LHSPGKAFRAALTKENPLQIVG----TINANH     28

Query         45 FDLMR-DYMDGTTSS----------------------SLFEVRLGRERFGKETHAYSVAY     81
d1muma_       29 ALLAQRAGYQAIYL-SGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIG     87

Query         82 -------GDNEIDEVVS-HADKIIFN----------------------SISQLERFAD--    109
d1muma_       88 FGSSAFNVARTVKSMIKAGAAGLHI-EDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK    146

Query        110 KAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENK----DFGLFDRMLGEIE    165
d1muma_      147 TDPDFVIM-------------------------ARTDA-----LAVEGLDAAIERAQAYV    176

Query        166 ERFGALIAR---VDWVSLGGGIHFTGDDYPVDA----FSARLRAFSDRYGVQIYLEP---    215
d1muma_      177 ---------EAGAEMLFP---------------EAITELAMYRQFADAVQVPILANITEF    212

Query        216 ---------------------GEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLL    254
d1muma_      213 GATPLFTTDELRSAHVAMALYPLSAFRAM-------------------------------    241

Query        255 IYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNW    314
d1muma_      242 ------------------------------------------------------------    242

Query        315 FNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------------------------    348
d1muma_      242 ----------------------------------NRAAEHVYNVLRQEGTQKSVIDTMQT    267

Query        349 ----------------------    349
d1muma_      268 RNELYESINYYQYEEKLDNLFA    289


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:157.65)
Query          1 -----------MIETPYYLIDKAKLTRNMERIAHVR-EKSGAKALLALKCFATWSVFDLM     48
d1muma_        1 LHSPGKAFRAA------------------------LT-KENPLQIVGT--IN-ANHALLA     32

Query         49 RD-YMDGTTS-S--------------------SLFEVRLGRERFGKETHAYSVAYG----     82
d1muma_       33 QRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSA     92

Query         83 -D--NEIDEVVS-HADKIIFNS--------------------I-SQLERFADKAA-G-IA    115
d1muma_       93 FNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFV    152

Query        116 RGLRLN-PQRL-GE-WDVPKVERVMD-RINGFMIHNNCENKDFGLFDRMLGEIEERFGAL    171
d1muma_      153 IMARTDALAVEG-LDAAIERAQAYVEAGAEMLFPEAI----------TELAMYRQ-FADA    200

Query        172 IARVDWVSLGGGIH----FTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITK-STT-    225
d1muma_      201 V-QV-PILANITEFGATP------L--FTTDELRSAH----VAMALYPLSAFRAMNRAAE    246

Query        226 LEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFG    285
d1muma_      247 HVYNVL----------R------------------------------Q------------    254

Query        286 EFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVR-TV---------    335
d1muma_      255 --------EGTQKSVIDT--------------------MQTRNE-LYES-INYYQYEEKL    284

Query        336 -----REFTYADYEQSLS    348
d1muma_      285 DNLFA-------------    289


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.38)
DALI match                                                                   
Query          8 LIDKAKLTRNMERIAHVREKSGAKALLALKCFAT----WSVFDLMRDYMDGTTSS-----     58
d1muma_      129 IVSKEEMVDRIRAAVDAKTDPDFVIMARTDALAVEGLDAAIERAQAYVEAGAEMLFPEAI    188

DALI match                                                   
Query         59 -SLFEVRLGRERFGKET--HAYSVAYGDN-EIDEVVSHADKIIF     98
d1muma_      189 TELAMYRQFADAVQVPILANITEFGATPLFTTDELRSAHVAMAL    232



top
34: d1dxea_ 2-​dehydro-​3-​deoxy-​galactarate aldolase (hh: 0.914)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 1708
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.33 AHM:0.34 LBcontacta:0.96 LBcontactb:0.97 LHM:0.13
id:0.81 blosum:0.05 compass:0.34 pearson:0.99
Scaled scores:
dali:0.65 daliz:0.36 gdtts:0.48 tmscore:0.66 rmsd:0.75 AHM:0.66 LBcontacta:0.33 LBcontactb:0.54 LHM:0.46
id:-0.01 blosum:0.05 compass:0.24 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 8.8 Raw score:895.40)
Query          1 mietpyylidkakltrnmeriahvreksGAKALlALKCfATWSVFDLMRDYMD-GTTSSS     59
d1dxea_        1 -------------dvfpnkfkaalaakqVQIGC-WSAL-SNPISTEVLGLAGFdWLVLDG     45

Query         60 ------LFEVRLGRERFG---KETHAYSVAYGDNEIDEVVS-HADKIIFNS---ISQLER    106
d1dxea_       46 ehapndISTFIPQLMALKgsaSAPVVRVPTNEPVIIKRLLDiGFYNFLIPFvetKEEAEL    105

Query        107 FADKAA------------------------------GIARGLRLNPQrlgEWDV-PKVER    135
d1dxea_      106 AVASTRyppegirgvsvshranmfgtvadyfaqsnkNITILVQIESQ--qGVDNvDAIAA    163

Query        136 VmDRINGFMIHNN---cenkdfgLFDR--MLGEIEeRFGALIA--RVDWVsLGGGIhftg    188
d1dxea_      164 T-EGVDGIFVGPSdlaaalghlgNASHpdVQKAIQ-HIFNRASahGKPSG-ILAPV----    216

Query        189 ddypvdAFSARLRAFSdrygVQIYLEPG-EASITKsttlevtvldtlynknlaivdssie    247
d1dxea_      217 -----eADARRYLEWG----ATFVAVGSdLGVFRS-------------------------    242

Query        248 ahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagy    307
d1dxea_      243 ------------------------------------------------------------    243

Query        308 tmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1dxea_      243 ------------------------------atqkladtfkk    253


hit structure      alignment
FAST alignment (Normalized score: 5.20 Raw score:1543.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS--------------GAKALLALKCFATWSVFD     46
d1dxea_        1 ----------------------------DVFPNKFKAALAAKQVQIGCWS-ALSNPISTE     31

Query         47 LMRD-YMDGTTS------SSLFEVRLGRERFG----KETHAYSVAYGDNEIDEVVS-HAD     94
d1dxea_       32 VLGLAGFDWLVLDGEHAPNDISTFIPQLMAL-KGSASAPVVRVPTNEPVIIKRLLDIGFY     90

Query         95 KIIFN---SISQLERFADK------------------------------AAGIARGLRLN    121
d1dxea_       91 NFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQ--    148

Query        122 PQRLGEWD------VPKVERV--MDRINGFMIHNNCENKD---------------FGLFD    158
d1dxea_      149 --------IESQQGVDNVDAIAATEGVDGIFVG-------PSDLAAALGHLGNASHPDVQ    193

Query        159 RMLGEIEERFGALIARV--DWVSLGGGIHFTGDDYPVDA---FSARLRAFSDRYGVQ---    210
d1dxea_      194 KAIQHIFNRASA-----HGKPSGI---------------LAPVEADARRYLE-----WGA    228

Query        211 IYLE--PGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGS    268
d1dxea_      229 TFVAVGSDLGV-------------------------------------------------    239

Query        269 HSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL    328
d1dxea_      240 ------------------------------------------------------------    240

Query        329 DGSVRTVREFTYADYEQSLS--------------    348
d1dxea_      240 --------------------FRSATQKLADTFKK    253


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:145.37)
Query          1 --------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFD     46
d1dxea_        1 DVFPNKFKAALAAK---------------------------QVQIGCWSA--LSNPISTE     31

Query         47 LMRDY-MDGTT-SS-----SLFEVRLGRERF--G-KETHAYS-VAYGDNEIDEVVS-HAD     94
d1dxea_       32 VLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPTNEPV-IIKRLLDIGFY     90

Query         95 KIIFN-S---IS--QLERFAD------K--------------------AA-GIARGLRLN    121
d1dxea_       91 NFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANMFGTVADYFAQSNKNITILVQIE    150

Query        122 PQRLGEW-DVPKVERVMDRINGFMIHNNC-E------NKDFGLFDRMLGEIEERFGALIA    173
d1dxea_      151 SQ--QGVDNVDAIA-ATEGVDGIFVGPSDLAAALGHL--GNASHPDVQKAIQHIFNRASA    205

Query        174 RVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPG-EASITKSTT---LEVT    229
d1dxea_      206 HGKPSGILA-P-V------E-ADARRYLEWG----ATFVAVGSDLGVFRSATQKLA----    248

Query        230 VLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK-VLPNEGSHSYMICGKSCLAGDVFGEFR    288
d1dxea_      249 -------------------------------DT-FK-K----------------------    253

Query        289 FAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1dxea_      254 ------------------------------------------------------------    254


hit structure      alignment
HHsearch alignment (Probability: 0.68 E-value:0.00)
DALI match                 ..... .... **************.               .........
Query         19 ERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDG----------TTSSSLFEVRLGRE     68
d1dxea_        5 NKFKAALAA-KQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALK     63

DALI match       ...********************......    ...************            
Query         69 RFGKETHAYSVAYGDNEIDEVVSHADKII----FNSISQLERFADKAAGIARGLR-----    119
d1dxea_       64 GSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVS    123

DALI match                                                                   
Query        120 LNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEER--FGALIARVDW    177
d1dxea_      124 HRANMFGTVADYFAQSNKNIT------ILVQIESQQGVDNV-DAIAATEGVDGIFVGPSD    176

DALI match                                              
Query        178 VSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPG    216
d1dxea_      177 LAAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAP    215



top
35: d1qo2a_ Phosphoribosylformimino-​5-​aminoimidazole carboxamide ribotite isomerase HisA (svm: 2.296)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.29  Contact: 1712
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.31 AHM:0.30 LBcontacta:0.98 LBcontactb:0.98 LHM:0.16
id:0.94 blosum:0.20 compass:0.18 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.40 gdtts:0.51 tmscore:0.69 rmsd:0.78 AHM:0.72 LBcontacta:0.38 LBcontactb:0.60 LHM:0.48
id:0.03 blosum:0.09 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 9.9 Raw score:958.70)
Query          1 mietpyylidkakltrnmeriahvreksgAKALLALK--------------------cfa     40
d1qo2a_        1 -----------------------------MLVVPAIDlfrgkvarmikgrkentifyekd     31

Query         41 TWSVFDLMR-DYMDGTTSSS-----------lfeVRLGRErFGKETHAYSVAYGDNEIDE     88
d1qo2a_       32 PVELVEKLIeEGFTLIHVVDlsnaiensgenlpvLEKLSE-FAEHIQIGGGIRSLDYAEK     90

Query         89 VVS-HADKIIFN--SISQlERFADKAA--GIARGLRLNPQ-----------rlgeWDVPK    132
d1qo2a_       91 LRKlGYRRQIVSskVLED-PSFLKSLReiDVEPVFSLDTRggrvafkgwlaeeeiDPVSL    149

Query        133 VERVMD-RINGFMIHN--NCENKDFglfdrMLGEIEERFGALIarvDWVSLGGGIHFtgd    189
d1qo2a_      150 LKRLKEyGLEEIVHTEieKDGTLQE----hDFSLTKKIAIEAE---VKVLAAGGISS---    199

Query        190 dypvDAFSARLRAFSDRYG-VQIYLEPGEASITksttlevtvldtlynknlaivdssiea    248
d1qo2a_      200 ----ENSLKTAQKVHTETNgLLKGVIVGRAFLE---------------------------    228

Query        249 hmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagyt    308
d1qo2a_      229 ------------------------------------------------------------    229

Query        309 mvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1qo2a_      229 ---------------------------giltvevmkryar    241


hit structure      alignment
FAST alignment (Normalized score: 3.65 Raw score:1059.00)
Query          1 MIETPYYLIDKA------------------------------KLTRNMERIAHVREKSG-     29
d1qo2a_        1 ------------MLVVPAIDLFRGKVARMIKGRKENTIFYEKDPVELVEKLIE------E     42

Query         30 --AKALLALKCFA-----------TWSVFDLMRDYM----DGTT--SSSLFEVRLGRERF     70
d1qo2a_       43 GFTLIHVV-----DLSNAIENSGENLPVLEKLSE--FAEHIQIGGGIRSLDYAEKLRK--     93

Query         71 GKETHAYSVAYGDNEIDEVVS-HADKIIFNSISQLERFADKAA-----GIARGLRLNPQR    124
d1qo2a_       94 ---------------------LGYRRQIV--SSKVLEDPSFLKSLREIDVEPVFSLD---    127

Query        125 LGEW------------------DVPKVERVMD-RINGFMIHNNCENKDFGLFDR------    159
d1qo2a_      128 ----TRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHT-------------EIEKDG    170

Query        160 -----MLGEIEERFGALIARV--DWVSLGGGIHFTGDDYP-VDAFSARLRAFSDRYGVQI    211
d1qo2a_      171 TLQEHDFSLT----KKIAIE-AEVKVLAAGGI--------SSENSLKTAQKVHTET----    213

Query        212 -----YLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNE    266
d1qo2a_      214 NGLLKGVIVGRAF-----------------------------------------------    226

Query        267 GSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIR    326
d1qo2a_      227 ------------------------------------------------------------    227

Query        327 ELDGSVRTVREFTYADYEQSLS---------------    348
d1qo2a_      227 ----------------------LEGILTVEVMKRYAR    241


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:127.89)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSS-     59
d1qo2a_        1 ------------------------M-----L---------------------VVPAIDLF     10

Query         60 -LFE-----------------VR-LGRER--FGK-ETHAYSV-A-----Y-GDNEIDEVV     90
d1qo2a_       11 RGKVARMIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKLS     70

Query         91 SHA-DKIIF--NSI-SQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDR-INGFMI    145
d1qo2a_       71 EFAEHIQIGGGIRSLDYAEKLRKLG--YRRQIVSS---KVLEDPSFLKSLREIDVEPVFS    125

Query        146 HNNCENKDFGLFD---------RMLGEIEERFGALIARVDWVSLGGGIHF--TGDDYPVD    194
d1qo2a_      126 LDT--R-G-GRVAFKGWLAEEEIDPVSLLKRLKEY--GLEEIVHTEIEKDGTLQE-HDF-    177

Query        195 AFSARLRAFSDRYGVQIYLEPGEASIT----------------------KSTTLEVTVLD    232
d1qo2a_      178 SLTKKIAIE--AE-VKVLAAG-GISSENSLKTAQKVHTETNGLLKGVIV-----------    222

Query        233 TLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEE    292
d1qo2a_      223 ------------------------------------------------------------    223

Query        293 LKVGDRISFQDAAGY-TMVKKNWFNGVKMPAIAI----------RELDGSVRTVREFTYA    341
d1qo2a_      223 ------------GRAF-LE------------GILTVEVMKRYAR----------------    241

Query        342 DYEQSLS    348
d1qo2a_      242 -------    242


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.04)
DALI match                                                                   
Query         39 FATWSVFDLMRDYMDGT----TSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHAD     94
d1qo2a_       60 GENLPVLEKLSEFAEHIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREID    119

DALI match                                                                   
Query         95 ---------------------KIIFNSISQLERFADKAAGIARGLRLNPQRLGEWDVPKV    133
d1qo2a_      120 VEPVFSLDTRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSL    179

DALI match                                    
Query        134 ERVMDRINGFMIHNNCENKDFGLFDRMLG    162
d1qo2a_      180 TKKIAIEAEVKVLAAGGISSENSLKTAQK    208



hit structures. 
top
36: d1v93a_ Methylenetetrahydrofolate reductase (svm: 2.285)

SCOP Superfamily: FAD-​linked oxidoreductase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 1696
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.34 LBcontacta:0.99 LBcontactb:0.98 LHM:0.16
id:0.96 blosum:0.21 compass:0.19 pearson:0.98
Scaled scores:
dali:0.70 daliz:0.44 gdtts:0.51 tmscore:0.68 rmsd:0.76 AHM:0.67 LBcontacta:0.43 LBcontactb:0.62 LHM:0.40
id:0.04 blosum:0.09 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 10.1 Raw score:1028.10)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALK-------cfaTWSVFDLMRDY-M     52
d1v93a_        1 -----------------mkirdllkarrGPLFSFEFFppkdpegeeaLFRTLEELKAFrP     43

Query         53 DGTTSS----------SLFEVRLGRERfGKETHAYSVA------yGDNEIDEVV-SHADK     95
d1v93a_       44 AFVSITygamgstrerSVAWAQRIQSL-GLNPLAHLTVagqsrkeVAEVLHRFVeSGVEN    102

Query         96 IIFN--------------------SISQLERFA-DKAAGIARGLRLNPQ-----rlgewD    129
d1v93a_      103 LLALrgdpprgervfrphpegfryAAELVALIReRYGDRVSVGGAAYPEghpesesleaD    162

Query        130 VPKVERV-MDRINGFMIHNNcenkdfglFDRMLGEIEERFG-ALIArvDWVSLGGgIHFT    187
d1v93a_      163 LRHFKAKvEAGLDFAITQLF-------fNNAHYFGFLERARrAGIG--IPILPGI-MPVT    212

Query        188 ----------------------------------GDDY--PVDAFSARLRAFSdrygvqI    211
d1v93a_      213 syrqlrrftevcgasipgpllaklerhqddpkavLEIGveHAVRQVAELLEAG-----vE    267

Query        212 YLEPGE-aSITKsttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshs    270
d1v93a_      268 GVHFYTlnKSPA------------------------------------------------    279

Query        271 ymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldg    330
d1v93a_      280 ------------------------------------------------------------    280

Query        331 svrtvreftyadyeqsls    348
d1v93a_      280 -----trmvlerlglrpa    292


hit structure      alignment
FAST alignment (Normalized score: 5.26 Raw score:1676.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS-----------GAKALLALKCFATWS------     43
d1v93a_        1 ----------------------------MKIRDLLKARRGPLFSFE--------FFPPKD     24

Query         44 ---------VFDLMRD-YMDGTTSS-----------SLFEVRLGRERFGKETHAYSVAY-     81
d1v93a_       25 PEGEEALFRTLEELKAFRPAFVSI-TYGAMGSTRERSVAWAQRIQ-SLGLNPLAHL---T     79

Query         82 --------GDNEIDEVVS-HADKIIFN---------------------SISQLERFADKA    111
d1v93a_       80 VAGQSRKEVAEVLHRFVESGVENLLA-LRGDPPRGERVFRPHPEGFRYAAELVALIRERY    138

Query        112 -AGIARGLRLNPQRLGEW-----------DVPKVERVMD-RINGFMIHNNC-ENKDFGLF    157
d1v93a_      139 GDRVSVGGAAYP------EGHPESESLEADLRHFKAKVEAGLDFAIT----QLFFNNAHY    188

Query        158 DRMLGEIEERFGALIARV----DWVSLGGGIHFTGDDY----------------------    191
d1v93a_      189 FGFLERARR---------AGIGIPILPGI---------MPVTSYRQLRRFTEVCGASIPG    230

Query        192 -------------------PVDAFSARLRAFSDRY--GVQIYLEPGEASITKSTTLEVTV    230
d1v93a_      231 PLLAKLERHQDDPKAVLEIGVEHAVRQVAELLE--AGVEGVHFY----------------    272

Query        231 LDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFA    290
d1v93a_      273 ------------------------------------------------------------    273

Query        291 EELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--    348
d1v93a_      273 ----------------------------------------------------------TL    274

Query        349 ------------------    349
d1v93a_      275 NKSPATRMVLERLGLRPA    292


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:140.23)
Query          1 ------MIETPYYLIDKAKLTRNMERIAHVREKSGAK---ALLALKCFATWSVFDLMRDY     51
d1v93a_        1 MKIRDL------------------------------LKAR------------------RG     12

Query         52 MDGTTSSSL---------FE-VRLGRERFGKETHAYSV------AYG-DNEIDEVV--SH     92
d1v93a_       13 PLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGL     72

Query         93 ADKIIFNS-------IS-QLERFADKAAGIARGLRLNPQR-----L-G----EWDVPKV-    133
d1v93a_       73 NPLAHLTVAGQSRKEVAEVLHRFVESGV-ENLLALRGDPPRGERVFRPHPEGFRYAAELV    131

Query        134 ERVMD-R---INGFMIHNNCENKDF-GL-FDRMLGEIEERFGALIARVDWVSLGGGIHFT    187
d1v93a_      132 ALIRERYGDRVSVGGAAYP--E--GH-PE-SESLEADLRHFKAKVEAGLDFAITQLFFNN    185

Query        188 GDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIE    247
d1v93a_      186 ---AHYFGFLERARRA--GIGIPILPGIMP--V---T-----------------------    212

Query        248 AHMLDLLIY-------------RET-AKVLPNEGSHSYMICGKSCLAGDVFG-EFRFAEE    292
d1v93a_      213 --SYRQLRRFTEVCGASIPGPL-LAKLERH-------------------QDDP-------    243

Query        293 LKVGDRISF-QDAA--G------------------YTMVKK--NWFNGVKMPAIAI-REL    328
d1v93a_      244 ------KAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPAT----------RMVL-ER    286

Query        329 ------DGSVRTVREFTYADYEQSLS    348
d1v93a_      287 LGLRPA--------------------    292


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.59)
DALI match                                                                   
Query        122 PQRLGEWDVPKVERVMDRINGFMIHNNCENK-----DFGLFDRMLGEIEERFGALIARVD    176
d1v93a_      119 PHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKV--------    170

DALI match                                               
Query        177 WVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPG    216
d1v93a_      171 --EAGLDFAITQLFFNNAHYFGFLERARRA-GIGIPILPG    207



top
37: d1n7ka_ Deoxyribose-​phosphate aldolase DeoC (svm: 2.172)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.35  Contact: 1849
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.32 AHM:0.31 LBcontacta:0.97 LBcontactb:0.98 LHM:0.13
id:0.95 blosum:0.10 compass:0.16 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.40 gdtts:0.52 tmscore:0.69 rmsd:0.76 AHM:0.68 LBcontacta:0.38 LBcontactb:0.60 LHM:0.49
id:0.03 blosum:0.06 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 10.0 Raw score:945.70)
Query          1 mietpyylidkakltrnmeriAHVReksgAKALLALKC------FATWsvFDLMRDY-MD     53
d1n7ka_        1 -----psardilqqgldrlgsPEDL---aSRIDSTLLSprateeDVRN-lVREASDYgFR     51

Query         54 GTTSSsLFEVRLGRERFG---KETHAYSV---------AYGDnEIDEVVS-HADKIIFNS    100
d1n7ka_       52 CAVLT-PVYTVKISGLAEklgVKLCSVIGfplgqapleVKLV-EAQTVLEaGATELDVVP    109

Query        101 ---------ISQLERFADKAA--GIARGLRLNPQrlgewDVPKV-ERVMD-RINGFMIHN    147
d1n7ka_      110 hlslgpeavYREVSGIVKLAKsyGAVVKVILEAPlwddkTLSLLvDSSRRaGADIVKTST    169

Query        148 NCenkdfglfdrMLGEIEeRFGALIA-RVDWVSLGGGIHFtgddypvdAFSARLRAFSdr    206
d1n7ka_      170 GV-----ytkggDPVTVF-RLASLAKpLGMGVKASGGIRS-------gIDAVLAVGAG--    214

Query        207 ygvqIYLEPGeASITksttlevtvldtlynknlaivdssieahmldlliyretakvlpne    266
d1n7ka_      215 ---aDIIGTS-SAVK---------------------------------------------    225

Query        267 gshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiair    326
d1n7ka_      226 ------------------------------------------------------------    226

Query        327 eldgsvrtvreftyadyeqsls    348
d1n7ka_      226 -------------vlesfkslv    234


hit structure      alignment
FAST alignment (Normalized score: 5.51 Raw score:1571.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGA----------------------KALLALKC     38
d1n7ka_        1 ------------------------------PSARDILQQGLDRLGSPEDLASRIDSTL--     28

Query         39 F----ATWSVFDLMRD-----YMDGTTSSSLFEVRLGRERFG-----KETHAYSVAY---     81
d1n7ka_       29 -LSPRATEEDVRNLVREASDYGFRCAVL-TPVYTVKISGL--AEKLGVKLCSV----IGF     80

Query         82 ---------GDNEIDEVVS-HADKIIFN----------SISQLERFADKA--AGIARGLR    119
d1n7ka_       81 PLGQAPLEVKLVEAQTVLEAGATELDV-VPHLSLGPEAVYREVSGIVKLAKSYGAVVKVI    139

Query        120 LNPQRLGE--WDVPKVERVMD------RINGFMIHNNCENKDFGL----------FDRML    161
d1n7ka_      140 LEA-----PLWDDKTLSLLV-DSSRRAGADIVK------------TSTGVYTKGGDPVTV    181

Query        162 GEIEERFGALIARV--DWVSLGGGIHFTGDDYPVDA-FSARLRAFSDRYGVQ--IYLEPG    216
d1n7ka_      182 FRLASLAKP-----LGMGVKASGGI-----------RSGIDAVLAVGA----GADIIGT-    220

Query        217 EASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGK    276
d1n7ka_      221 ------------------------------------------------------------    221

Query        277 SCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVR    336
d1n7ka_      221 ------------------------------------------------------------    221

Query        337 EFTYADYEQSLS--------------    348
d1n7ka_      221 ------------SSAVKVLESFKSLV    234


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:124.40)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYM-DGTTSSS     59
d1n7ka_        1 ----------PSARD--I-------------------------L-QQGLDRLG-------     15

Query         60 LFEVRLGRERFGKETHAYSV---AY--G-DNEIDEVVSH-ADKIIFNSISQLERFADKAA    112
d1n7ka_       16 ------SPEDLASRIDSTLLSPRATEEDVRNLVREASDYGFRCAVLTPV-YTVKISGLAE     68

Query        113 --GIARGLRLN---PQR--LGEWDVPKVERVMD-RINGFMIHNNCENKDFGLFDRMLGEI    164
d1n7ka_       69 KLGVKLCSVIGFPLGQAPL--EVKLVEAQTVLEAGATELDVVPHL-S---LGPEAVYREV    122

Query        165 EERFGALIAR-VDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEP-----GEA    218
d1n7ka_      123 SG-IVKLAKSYGAVVKVILEAPLWD-DKTLSLLVDSSRRAG----ADIVKTSTGVYTKGG    176

Query        219 SITKS-----------------TTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAK    261
d1n7ka_      177 DPVTVFRLASLAKPLGMGVKAS--------------------------------------    198

Query        262 VLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVK----------    311
d1n7ka_      199 --------------------------------------------GG-IRSGIDAVLAVGA    213

Query        312 ---------------------KNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1n7ka_      214 GADIIGTSSAVKVLESFKSLV-------------------------------------    234


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.27)
DALI match                                                                   
Query         79 VAYGDNEIDEVVSHADKIIFNS----ISQLERFADKAAGIARGLRLNPQ------RLGEW    128
d1n7ka_       31 PRATEEDVRNLVREASDYGFRCAVLTPVYTVKISGLAEKLGVKLCSVIGFPLGQAPLEVK     90

DALI match                                                         
Query        129 DVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWV    178
d1n7ka_       91 LVEAQTVLEAGATELDVVPHLS-LGPEAVYREVSGIVKLAKSYGAVVKVI    139



top
38: d1f6ya_ corrinoid/​iron-​sulfur protein methyltransferase MetR (hh: 0.909)

SCOP Superfamily: Dihydropteroate synthetase-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.26  Contact: 1519
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.98 tmscore:0.98 rmsd:0.31 AHM:0.28 LBcontacta:0.95 LBcontactb:0.95 LHM:0.16
id:0.96 blosum:0.25 compass:0.10 pearson:0.97
Scaled scores:
dali:0.66 daliz:0.39 gdtts:0.49 tmscore:0.67 rmsd:0.78 AHM:0.74 LBcontacta:0.31 LBcontactb:0.49 LHM:0.45
id:0.03 blosum:0.09 compass:0.16 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 8.7 Raw score:871.10)
Query          1 -----------mietpyylIDKAkLTRNMERIAHVREkSGAKALLALKC--fATWSV-FD     46
d1f6ya_        1 mliigeringmfgdikraiQERD-PAPVQEWARRQEE-GGARALDLNVGdkvSAMEWlVE     58

Query         47 LMRDY--mDGTTSSS-LFEVRLGRERF-gKETHAYSVaYGDNEIDEVVSHA----DKIIF     98
d1f6ya_       59 VTQEVsnlTLCLDSTnIKAIEAGLKKCknRAMINSTN-AEREKVEKLFPLAvehgAALIG    117

Query         99 NS-------------ISQLERFADKA----AGIA-RGLR-LNPQ-----rlgeWDVPKVE    134
d1f6ya_      118 LTmnktgipkdsdtrLAFAMELVAAAdefgLPMEdLYIDpLILPanvaqdhapEVLKTLQ    177

Query        135 RVMD----RINGFMIHNNcenkdfGLFDRMLGEIEERFGALIarvdWVSLGggihftgdd    190
d1f6ya_      178 QIKMladpAPKTVLGLSN-vsqncQNRPLINRTFLAMAMACG---lMSAIA---------    224

Query        191 ypvdaFSARLRAFSDRYGvqiylepgeasitksttlevtvldtlynknlaivdssieahm    250
d1f6ya_      225 ---daCDEALIETAATAE------------------------------------------    239

Query        251 ldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmv    310
d1f6ya_      240 ------------------------------------------------------------    240

Query        311 kknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1f6ya_      240 -------------------illnqtvycdsfvkmfktr    258


hit structure      alignment
FAST alignment (Normalized score: 4.84 Raw score:1450.00)
Query          1 MIETPY-------------------YLIDKAKLTRNMERIAHVREKSG---AKALLALKC     38
d1f6ya_        1 ------MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEE------GGARALDLN---     45

Query         39 FA-------TWSVFDLMRDYM----DGTTSSSLFEVRLGRERFGKETHAYSVA----YGD     83
d1f6ya_       46 --VGDKVSAMEWLVEVTQEV-SNLTLCLDSTNIKAIEAGLKKCKNRAMI----NSTNAER     98

Query         84 NEIDEVVSHA-----DKIIFN--------------SISQLERFADKAAGI--------AR    116
d1f6ya_       99 EKVEKLFPL-AVEHGAALIG-LTMNKTGIPKDSDTRLAFAMELVAAA---DEFGLPMEDL    153

Query        117 GLRLNPQRLGEW-------------DVPKVERVMDRI------NGFMIH---NNCENKDF    154
d1f6ya_      154 YIDPL-------ILPANVAQDHAPEVLKTLQQIK---MLADPAPKTVLGLSNVSQNC---    200

Query        155 -GLFDRMLGEIEERFGALIA-RVDWVSLGGGIHFTGDDYP-----VDAFSARLRAFSDRY    207
d1f6ya_      201 QNRPLINRTFLA-MAMA---CGLMSA--------------IADACDEALIETAATAEILL    242

Query        208 GVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEG    267
d1f6ya_      243 N-----------------------------------------------------------    243

Query        268 SHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRE    327
d1f6ya_      244 ------------------------------------------------------------    244

Query        328 LDGSVRTVREFTYADYEQSLS---------------    348
d1f6ya_      244 ---------------------QTVYCDSFVKMFKTR    258


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:151.71)
Query          1 ------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC-FA-     40
d1f6ya_        1 MLIIGERINGMFGDIKRA------IQERD--PAPVQEWARRQEEGGARALDLNV-GDKVS     51

Query         41 T-WSVFDLMRDYM-D-GTTS-SSLFEVRLGRERFGKETHA-YSV-AYG-DNE-IDEVVSH     92
d1f6ya_       52 AMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEH    111

Query         93 ADKIIFN----------------SISQLERFAD-K-AAGIARGLRLNPQ-------RLG-    126
d1f6ya_      112 GAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQD-HAP    170

Query        127 EW-DV-PKVERVMDRINGFMIHNNC-ENKDFGLFDRMLGEIEERFGALIARVDWVSLGGG    183
d1f6ya_      171 EVLKTLQQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAM-AMACG--L-MSAIA--    224

Query        184 IHFTGDDYPVDAFSARLRAFSDRY----GV---------QI---YLEPGEASITKSTTLE    227
d1f6ya_      225 D-A------C--DEALIETAATAEILLNQTVYCDSFVKM-FKTR----------------    258

Query        228 VTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEF    287
d1f6ya_      259 ------------------------------------------------------------    259

Query        288 RFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSL    347
d1f6ya_      259 ------------------------------------------------------------    259

Query        348 S    348
d1f6ya_      259 -    259


hit structure      alignment
HHsearch alignment (Probability: 0.14 E-value:0.16)
DALI match                                                                   
Query         48 MRDYMDGTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHA-----DKIIFNSIS    102
d1f6ya_       15 IKRAIQERDPAPVQEWARRQEEGGARALDLNVGDKVSAMEWLVEVTQEVSNLTLCLDSTN     74

DALI match                                                                   
Query        103 QLERFADKAA--GIARGLRLNPQR-LGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDR    159
d1f6ya_       75 IKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLA    134

DALI match                                                                   
Query        160 MLGEIEERFGALIARVDWVSLGGG-IHFTGDDYPVDAFSARLRAFSD--RYGVQIYLEPG    216
d1f6ya_      135 FAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLS    194

DALI match        
Query        217 E    217
d1f6ya_      195 N    195



top
39: d1rqba2 Transcarboxylase 5S subunit,​ N-​terminal domain (svm: 2.372)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 1672
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.98 tmscore:0.98 rmsd:0.39 AHM:0.39 LBcontacta:0.98 LBcontactb:0.98 LHM:0.16
id:0.84 blosum:0.05 compass:0.21 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.39 gdtts:0.49 tmscore:0.64 rmsd:0.73 AHM:0.66 LBcontacta:0.38 LBcontactb:0.61 LHM:0.41
id:0.00 blosum:0.05 compass:0.20 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 8.4 Raw score:915.20)
Query          1 mietpyylidkakltrnmeriahvreKSGAKALLA--LKCF-----------aTWSVFDL     47
d1rqba2        1 -------------------reievsePREVGITELvlRDAHqslmatrmamedMVGACAD     41

Query         48 MRDYMD-GTTSSS---------------lfeVRLGRERFG-KETHAYSV--AYGD-----     83
d1rqba2       42 IDAAGYwSVECWGgatydscirflnedpwerLRTFRKLMPnSRLQMLLRgqNLLGyrhyn    101

Query         84 -----NEIDEVV-SHADKIIFNS----ISQLERFADKAA--GIARGLRLNPQ----rlge    127
d1rqba2      102 devvdRFVDKSAeNGMDVFRVFDamndPRNMAHAMAAVKkaGKHAQGTICYTispvhtve    161

Query        128 WDVPKVERVMD-RINGFMIHNNCEnkdfglFDRMLGEIEERFG-ALIARVdWVSLGGGIh    185
d1rqba2      162 GYVKLAGQLLDmGADSIALXDMAA----llKPQPAYDIIKAIKdTYGQKT-QINLHCHS-    215

Query        186 ftgddypvdafsARLRAFSdrygvqIYLEPgeASITksttlevtvldtlynknlaivdss    245
d1rqba2      216 ---ttgvtevslMKAIEAG-----vDVVDT--AISS------------------------    241

Query        246 ieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqDAA    305
d1rqba2      242 -----------------------mslgpghnptesvaemlegtgyttnldydrlhkiRDH    278

Query        306 GyTMVK-KNWFngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1rqba2      279 FkAIRPkYKKF-------------------esktlvdtsifksq    303


hit structure      alignment
FAST alignment (Normalized score: 4.92 Raw score:1596.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREK--------SGAKALL-ALKCFA-----------     40
d1rqba2        1 ---------------------------REIEVSEPREVGITELVLRD--AHQSLMATRMA     31

Query         41 ---TWSVFDLMR-DYMDGTTSS-----------------SLFEVRLGRERFG-KETHAYS     78
d1rqba2       32 MEDMVGACADIDAAGYWSVE--CWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLL     89

Query         79 VAY---------------GDNEIDEVVS-HADKIIF----NSISQLERFADKA---AGIA    115
d1rqba2       90 ---RGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAA-VKKAGKH    145

Query        116 RGLRLNPQRLGEW--------------DVPKVERVMDRINGFMIHNNCEN------KDFG    155
d1rqba2      146 AQGTIC-------YTISPVHTVEGYVKLAGQLLD--MGADSIAL------XDMAALLKPQ    190

Query        156 LFDRMLGEIEERFGALIARV----DWVSLGGGIHFTGDDYP---VDAFSARLRAFSDRYG    208
d1rqba2      191 PAYDIIKAIKDT--------YGQKTQINLHC----------HSTTGVTEVSLMKAIE-AG    231

Query        209 VQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGS    268
d1rqba2      232 V-DVVDT-----------------------------------------------------    237

Query        269 HSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL    328
d1rqba2      238 ------------------------------------------------------------    238

Query        329 DGSVRTVREFTYADYEQSLS----------------------------------------    348
d1rqba2      238 --------------------AISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRD    277

Query        349 --------------------------    349
d1rqba2      278 HFKAIRPKYKKFESKTLVDTSIFKSQ    303


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:152.56)
Query          1 -------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLA-LK-CF---------A--     40
d1rqba2        1 REIEVSE--------------------------PREVGITELVLRDAHQSLMATRMAMED     34

Query         41 TWSVFDLMRDYMD-GTTSSS---L----------F--EVRLGRERFG-KETHAYSV--AY     81
d1rqba2       35 MVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNL     94

Query         82 G--------D--NEIDEVVS-HADKIIFNS----ISQLERFADKAA--GIARGLRLNPQR    124
d1rqba2       95 LGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTI    154

Query        125 ---LGE--WDVPKVERVMD-RINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWV    178
d1rqba2      155 SPV-HTVEGYVKLAGQLLDMGADSIALXDMAAL----LKPQPAYDIIKAIKDTYGQKTQI    209

Query        179 SLGGGIH----FTGDDYP-VDAFSARLRAFSDRYGVQIYLEPG----E------AS----    219
d1rqba2      210 NLHCHSTTGVT-----EVS--LM-KAI-EAG----V-DVVDTAISSMSLGPGHNPTESVA    255

Query        220 -------------------ITK-STTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRET    259
d1rqba2      256 EMLEGTGYTTNLDYDRLHKIRDHFKAIRP---------------K----YKKFE--S-KT    293

Query        260 A---------KVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMV    310
d1rqba2      294 LVDTSIFKSQ--------------------------------------------------    303

Query        311 KKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1rqba2      304 --------------------------------------    304


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.35)
DALI match                                                        
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSS     58
d1rqba2      188 KPQPAYDIIKAIKDTYG-QKTQINLHCHSTTGVTEVSLMKAIEAGVDVV    235



top
40: d1t8qa_ Glycerophosphodiester phosphodiesterase GlpQ (svm: 1.443)

SCOP Superfamily: PLC-​like phosphodiesterases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 1478
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.32 AHM:0.34 LBcontacta:0.98 LBcontactb:0.98 LHM:0.21
id:0.95 blosum:0.04 compass:0.07 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.44 gdtts:0.53 tmscore:0.68 rmsd:0.76 AHM:0.65 LBcontacta:0.41 LBcontactb:0.65 LHM:0.28
id:0.04 blosum:0.04 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 8.2 Raw score:925.30)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLAL-----kcFATWSvFDLMRD-YMDG     54
d1t8qa_        1 ---------------------------nEKIVIAHRgasgylpEHTLPaKAMAYAqGADY     33

Query         55 TTSSSL------------------------------------------------------     60
d1t8qa_       34 LEQDLVmtkddnlvvlhdhyldrvtdvadrfpdrarkdgryyaidftldeikslkftegf     93

Query         61 ------------------------feVRLGRERFG---------KETHAYSVAY------     81
d1t8qa_       94 diengkkvqtypgrfpmgksdfrvhtFEEEIEFVQglnhstgknIGIYPEIKAPwfhhqe    153

Query         82 ---GDNEIDEVVS--------haDKIIFNSISQLERFAD-----kaAGIARGLRLNPQ--    123
d1t8qa_      154 gkdIAAKTLEVLKkygytgkddkVYLQCFDADELKRIKNelepkmgMELNLVQLIAYTdw    213

Query        124 -------------rlgEWDV---PKVERVMDRINGFMIHnncenkdfglfdrMLGE----    163
d1t8qa_      214 netqqkqpdgswvnynYDWMfkpGAMKQVAEYADGIGPD-----------yhMLIEetsq    262

Query        164 ----iEERFGALIA-RVDWVSLGGgIHFTG---ddYPVDAFSAR-LRAFSdrygvQIYLE    214
d1t8qa_      263 pgnikLTGMVQDAQqNKLVVHPYT-VRSDKlpeytPDVNQLYDAlYNKAG-----VNGLF    316

Query        215 PGEasitksttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymic    274
d1t8qa_      317 TDF---------------------------------------------------------    319

Query        275 gksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrt    334
d1t8qa_      320 ------------------------------------------------------------    320

Query        335 vreftyadyeqsls    348
d1t8qa_      320 -----pdkavkfln    328


hit structure      alignment
FAST alignment (Normalized score: 4.37 Raw score:1476.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS-GAKALLALKC---------FATWSVFDLMRD     50
d1t8qa_        1 ----------------------------NEKIVIA----HRGASGYLPEHTLPAKAMAYA     28

Query         51 -YMDGTTSSSLF------------------------------------------------     61
d1t8qa_       29 QGADYLEQD---LVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIK     85

Query         62 ---------------------------------EVRLGRERFG-----------KETHAY     77
d1t8qa_       86 SLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEF--VQGLNHSTGKNIGIYPE    143

Query         78 SVAYGD---------NEIDEVVSHA------------DKIIFNSISQLERF-ADKAA---    112
d1t8qa_      144 IKA---PWFHHQEGKDIAAKTLEV-LKKYGYTGKDDKVYLQCFDADELKRIKNELE-PKM    198

Query        113 --GIARGLRLNPQRLG-----------------------EWDVPKVERVMDRINGFMIHN    147
d1t8qa_      199 GMELNLVQLIA-----YTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGP--    251

Query        148 NCENKDFGLFDRML-----------------GEIEERFGALIARV--DWVSLGGGIHFTG    188
d1t8qa_      252 --------------DYHMLIEETSQPGNIKLTGMVQDAQQ-----NKLVVHPY-------    285

Query        189 DDY------------PVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYN    236
d1t8qa_      286 ---TVRSDKLPEYTPDVNQLYDA---LYNKAGV-NGLFT---------------------    317

Query        237 KNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVG    296
d1t8qa_      318 ------------------------------------------------------------    318

Query        297 DRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS--------    348
d1t8qa_      318 ----------------------------------------------------DFPDKAVK    325

Query        349 ---    349
d1t8qa_      326 FLN    328


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:122.49)
Query          1 -----------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALK------     37
d1t8qa_        1 NEKIVIAHRGASGYLPE--------HTLPAKAMAYAQ-G--A-----DYLEQDLVMTKDD     44

Query         38 ---CF-------------------------------------------------------     39
d1t8qa_       45 NLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTY    104

Query         40 ---------------A-TW-SVFDLMR----DYMDGTTSS-------------SLFEVRL     65
d1t8qa_      105 PGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEV    164

Query         66 GRERFG----KETHAYS-V-AY-GDNEIDEVV--SHADKIIFNSISQLERFADKAAGIAR    116
d1t8qa_      165 LKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLV-------------------    205

Query        117 GLRLNPQ----------------RLG-EWDVPKVERVMDRINGFMIHNNCENKDFGLFDR    159
d1t8qa_      206 -QLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPD---------Y-H    254

Query        160 MLGEI--------EERFGALIAR-VDWVSLGGGIHFTG------DDYPVDAFSARLRAFS    204
d1t8qa_      255 MLIEETSQPGNIKLTGMVQDAQQNKLVVHPYT-VRSDKLPEYTP------DVNQLYDALY    307

Query        205 DRYGVQIYLEPGEAS--------ITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIY    256
d1t8qa_      308 NKAGVNGLF-T-DFPDKAVKFLN-------------------------------------    328

Query        257 RETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFN    316
d1t8qa_      329 ------------------------------------------------------------    329

Query        317 GVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1t8qa_      329 --------------------------------    329


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.45)
DALI match                          
Query        183 GIHFTGDDYPVDAFSARLR    201
d1t8qa_       10 GASGYLPEHTLPAKAMAYA     28



hit structures. 
top
41: d1foba_ Beta-​1,​4-​galactanase (hh: 0.952)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 1856
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.39 AHM:0.41 LBcontacta:0.98 LBcontactb:0.98 LHM:0.21
id:0.95 blosum:0.02 compass:0.06 pearson:0.96
Scaled scores:
dali:0.68 daliz:0.39 gdtts:0.49 tmscore:0.67 rmsd:0.74 AHM:0.64 LBcontacta:0.34 LBcontactb:0.56 LHM:0.35
id:0.02 blosum:0.04 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 9.8 Raw score:1087.00)
Query          1 mietpyylidkakltrnmeriahvrekSGAKALLALKCFAT---------------wSVF     45
d1foba_        1 ---------------------------ALTYRGADISSLLLledegysyknlngqtqALE     33

Query         46 DLMRD-YMDGTTSSS----------LFEVRLGRERFG---KETHAYSVA-----------     80
d1foba_       34 TILADaGINSIRQRVwvnpsdgsydLDYNLELAKRVKaagMSLYLDLHLsdtwadpsdqt     93

Query         81 ---------------yGDNEIDEVVS-------HADKIIFN-------------------     99
d1foba_       94 tpsgwsttdlgtlkwqLYNYTLEVCNtfaendiDIEIISIGneiragllwplgetssysn    153

Query        100 sISQLERFADKAA------GIARGLRLNP---qrlgeWDVPKVER----VMDRINGFMIH    146
d1foba_      154 iGALLHSGAWGVKdsnlatTPKIMIHLDDgwswdqqnYFYETVLAtgelLSTDFDYFGVS    213

Query        147 NNceNKDF-GLFDRMLGEIEERFGALiARVDwVSLGGGIhFTGDD---------------    190
d1foba_      214 YY--PFYSaSATLASLKTSLANLQST-YDKP-VVVVETN-WPVSCpnpayafpsdlssip    268

Query        191 ----YPVDAFSARLRAFSDRYgVQIYLEPGEaSITK--------------STTLevtvld    232
d1foba_      269 fsvaGQQEFLEKLAAVVEATT-DGLGVYYWE-PAWIgnaglgsscadnlmVDYT------    320

Query        233 tlynknlaivdssieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaee    292
d1foba_      321 ------------------------------------------------------------    321

Query        293 lkvgdrisfQDAAgytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1foba_      321 ---------TDEV---------------------------------yesietlgel    334


hit structure      alignment
FAST alignment (Normalized score: 4.29 Raw score:1461.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSG--AKALLALKCFATW----------------     42
d1foba_        1 -----------------------------ALTYRGADISS----LLLLEDEGYSYKNLNG     27

Query         43 ---SVFDLMRD-YMDGTTS----------SSLFEVRLGRER---FGKETHAYSVAY----     81
d1foba_       28 QTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDL---HLSD     84

Query         82 -------------------------GDNEIDEVVS-------HADKIIFN----------     99
d1foba_       85 TWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIIS--IGNEIRAGLL    142

Query        100 -----------SISQLERFADKAA--------GIARGLRLNPQRLGEW--------DVPK    132
d1foba_      143 WPLGETSSYSNIGALLHSGAWG--VKDSNLATTPKIMIHL--------DDGWSWDQQNYF    192

Query        133 VER-------VMDRINGFMIHNNCEN--------KDFGLFDRMLGEIEERFGALIARV--    175
d1foba_      193 YETVLATGELLSTDFDYFGVS-----YYPFYSASATLASLKTSLANLQST--------YD    239

Query        176 DWVSLGGGIHFTGDDY------------------------PVDAFSARLRAFSDRYGVQ-    210
d1foba_      240 KPVVVV----------ETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAV----V    285

Query        211 ------IYLEPG--EASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKV    262
d1foba_      286 EATTDGLGVY--YWEPAW------------------------------------------    301

Query        263 LPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPA    322
d1foba_      302 ------------------------------------------------------------    302

Query        323 IAIRELDGSVRTVREFTYADYEQSLS---------------------------------    348
d1foba_      302 --------------------------IGNAGLGSSCADNLMVDYTTDEVYESIETLGEL    334


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:145.32)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF--A------T---------W-     42
d1foba_        1 ---------------------A--L---T-YRGADISSLLLLEDEGYSYKNLNGQTQALE     33

Query         43 -SVFDLMRDYMDGTTSS---------S----L-FEVRLGRERFGKETHAYSVAYG-----     82
d1foba_       34 TILADAGI---NSIRQRVWVNPSDGSYDLDYNLELAKRVKAA-GMSLYLDLHLSDTWADP     89

Query         83 ----DNEIDEVVSHADKIIFN----------SI-SQLERFADKAA--G-----I-ARGLR    119
d1foba_       90 SDQT---------------TPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIG    134

Query        120 L-NPQRLG---EW-----DVPKVERV-MDRIN---------GFMIHNNCENKDFGLFDRM    160
d1foba_      135 NEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDD--G--W--SWDQ    188

Query        161 LGEIEERFGA---LIARVDWVSLGGGIHF-TGDDYPVDAFSARLRAFSDRYGVQIYLEPG    216
d1foba_      189 QNYFYETVLATGELLSTDFDYFGVSYYPFY-SASATLASLKTSLANLQSTYDKPVVVVET    247

Query        217 EASI-----------------TKSTT---------------------------LEVTVLD    232
d1foba_      248 NWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPA-------    300

Query        233 TLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEE    292
d1foba_      301 ---------------WIGNAG-LGSSCA--------------------------------    312

Query        293 LKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIREL-------DGSVRTVREFTYADYEQ    345
d1foba_      313 ----------DNLMVDY-----------TTDEVYESIETLGEL-----------------    334

Query        346 SLS    348
d1foba_      335 ---    335


hit structure      alignment
HHsearch alignment (Probability: 0.23 E-value:0.01)
DALI match                                                                   
Query         54 GTTSSSLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIF-----------NSIS    102
d1foba_        6 GADISSLLLLEDE-----GYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLD     60

DALI match                                                                   
Query        103 QLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLG    162
d1foba_       61 YNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLG-----TLKWQLYNYTL    115

DALI match                                                       
Query        163 EIEERFGALIARVDWVSLG-----GGIHFTGDDYPVDAFSARLRAFSD    205
d1foba_      116 EVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAW    163



top
42: d1aq0a_ Plant beta-​glucanases (svm: 1.377)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.20  Contact: 1503
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.34 LBcontacta:0.97 LBcontactb:0.97 LHM:0.16
id:0.77 blosum:0.03 compass:0.05 pearson:0.95
Scaled scores:
dali:0.69 daliz:0.41 gdtts:0.50 tmscore:0.67 rmsd:0.76 AHM:0.69 LBcontacta:0.37 LBcontactb:0.56 LHM:0.42
id:-0.00 blosum:0.04 compass:0.13 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 9.1 Raw score:1003.90)
Query          1 mietpyylidkakltrnmeriahvreksgaKALLALKC---faTWSV-FDLMR-DYMDGT     55
d1aq0a_        1 ------------------------------IGVCYGMSannlpAASTvVSMFKsNGIKSM     30

Query         56 TSSSLFevRLGRERF---GKETHAYSVA-----------yGDNEIDEVVS-----hADKI     96
d1aq0a_       31 RLYAPN--QAALQAVggtGINVVVGAPNdvlsnlaaspaaAASWVKSNIQaypkvsFRYV     88

Query         97 IFN----------SISQLERFADKA-----AGIARGLRLNPQ--------------rlge    127
d1aq0a_       89 CVGnevaggatrnLVPAMKNVHGALvaaglGHIKVTTSVSQAilgvfsppsagsftgeaa    148

Query        128 wDVPKVERV-MDRINGFMIHNN------------cenkDFGL-------------fDRML    161
d1aq0a_      149 aFMGPVVQFlARTNAPLMANIYpylawaynpsamdmgyALFNasgtvvrdgaygyqNLFD    208

Query        162 GEIEERFGAL----iaRVDWVSLGggIHFT------GDDY---PVDAFSARLRAF--sDR    206
d1aq0a_      209 TTVDAFYTAMgkhggsSVKLVVSE-sGWPSgggtaaTPANarfYNQHLINHVGRGtprHP    267

Query        207 YGvQIYLEPG--------------EASITKSTtlevtvldtlynknlaivdssieahmld    252
d1aq0a_      268 GA-IETYIFAmfnenqkdsgveqnWGLFYPNM----------------------------    298

Query        253 lliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkk    312
d1aq0a_      299 ------------------------------------------------------------    299

Query        313 nwfngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1aq0a_      299 ----------------------------qhvypinf    306


hit structure      alignment
FAST alignment (Normalized score: 3.80 Raw score:1241.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWS---------VFDLMRD-     50
d1aq0a_        1 -------------------------------IGVC--------YGMSANNLPAASTVVSM     21

Query         51 ----YMDGTTSSS--LFEVRLGRERFGKETHAYSVAY---------------GDNEIDEV     89
d1aq0a_       22 FKSNGIKSMRLYAPNQAALQAV-GGTGINVVVG----APNDVLSNLAASPAAAASWVKSN     76

Query         90 VS------HADKIIFN------------SISQLERFADK-----AAGIARGLRLNPQRLG    126
d1aq0a_       77 I-QAYPKVSFRYVC--VGNEVAGGATRNLVPAMKNVHGALVAAGLGHIKVTTSVSQ----    129

Query        127 EW------------------------DVPKVERVMDRI--NGFMIHNNCENKDF------    154
d1aq0a_      130 --AILGVFSPPSAGSFTGEAAAFMGPVVQFLAR-----TNAPLMAN--------IYPYLA    174

Query        155 ------------------------------GLFDRMLGEIEERFGA----LIARVDWVSL    180
d1aq0a_      175 WAYNPSAMDMGYALFNASGTVVRDGAYGYQNLFDTTVDAFYTA---MGKHGGSSV-KLVV    230

Query        181 GGGIHFTGDD-----------YPVDAFSARLRAFSDRYG----------VQIYLEPGEAS    219
d1aq0a_      231 S---------ESGWPSGGGTAATPANARFYNQHLIN---HVGRGTPRHPGAIETY-----    273

Query        220 ITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCL    279
d1aq0a_      274 ------------------------------------------------------------    274

Query        280 AGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFT    339
d1aq0a_      274 ------------------------------------------------------------    274

Query        340 YADYEQSLS---------------------------------    348
d1aq0a_      274 ---------IFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF    306


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:138.83)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC----FA----T-WSVFDLMRDY     51
d1aq0a_        1 -------------------------------IGVCYGMSANNLPAASTVVSMFKSNGI--     27

Query         52 MDGTTS-S-SLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNSI-S--QLER    106
d1aq0a_       28 -KSMRLYAPNQAALQAVGGT-GINVVVGAPNDV--------------LSNLAASPAAAAS     71

Query        107 FADK-AA--G---IARGLRL--NPQRLGEWDVPKVERVMDRI--------NGFMIHNNCE    150
d1aq0a_       72 WVKSNIQAYPKVSFRYVCVGNEVAGGATRNLVPAMKNVHGALVAAGLGHIKVTTSVSQAI    131

Query        151 N-KDFG-L--FDRM-LGE-IEERFGALIARVDWVSLGGGIHFT--------------GDD    190
d1aq0a_      132 LG-VFSPPSAGSFTGEAAAFMGPVVQFLARTNAPLMAN-IYPYLAWAYNPSAMDMGYALF    189

Query        191 ---------------YPVDAFSARLRA-FS--DRYGVQIYLEPGEASIT-----KSTT--    225
d1aq0a_      190 NASGTVVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSES-GWPSGGGTAATPANA    248

Query        226 ------------------------------LEVTVLDTLYNKNLAIVDSSIEAHMLDLLI    255
d1aq0a_      249 RFYNQHLINHVGRGTPRHPGAIETYIFAMF-----------------------NENQ--K    283

Query        256 YRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWF    315
d1aq0a_      284 D-SGVE-----------------------------------------QNWGLFYP-----    296

Query        316 NGVKMPAIAIREL--DGSVRTVREFTYADYEQSLS    348
d1aq0a_      297 -----NMQHVYPINF--------------------    306


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.36)
DALI match                                                     
Query        141 NGFMIHNNCENKDFGLFDRMLGEIEERFGAL-----IARVDWVSLG    181
d1aq0a_       46 TGINVVVGAPNDVLSNLAASPAAAASWVKSNIQAYPKVSFRYVCVG     91



top
43: d1geqa_ Trp synthase alpha-​subunit (svm: 2.058)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.56  Contact: 1627
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.38 LBcontacta:0.97 LBcontactb:0.98 LHM:0.19
id:0.98 blosum:0.63 compass:0.24 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.39 gdtts:0.47 tmscore:0.65 rmsd:0.76 AHM:0.65 LBcontacta:0.38 LBcontactb:0.61 LHM:0.39
id:0.06 blosum:0.14 compass:0.21 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 9.7 Raw score:956.80)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALK-----cfaTWSVFDLMRDYMDGT     55
d1geqa_        1 -------------------------mfkDGSLIPYLTagdpdkqsTLNFLLALDEYAGAI     35

Query         56 TSSS--------------------------lFEVRLGRER---fGKETHAYSVA------     80
d1geqa_       36 ELGIpfsdpiadgktiqeshyralkngfklrEAFWIVKEFrrhsSTPIVLMTYYnpiyra     95

Query         81 yGDNEIDEVVS-HADKIIFNSIS--QLERFADKAA--GIARGLRLNPQrlgeWDVPKVER    135
d1geqa_       96 gVRNFLAEAKAsGVDGILVVDLPvfHAKEFTEIAReeGIKTVFLAAPN----TPDERLKV    151

Query        136 VMDRIN-GFMIHNNCenkdfgLFDRMLGEIEERFGALIarVDWVSLGGGIHFtgddypvD    194
d1geqa_      152 IDDMTTgFVYLVSLY------EIPKTAYDLLRRAKRIC--RNKVAVGFGVSK-------R    196

Query        195 AFSARLRAFSdrygvqIYLEPGEASITKSTtlevtvldtlynknlaivdssieahmldll    254
d1geqa_      197 EHVVSLLKEG-----aNGVVVGSALVKIIG------------------------------    221

Query        255 iyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqDAAGytmvkknw    314
d1geqa_      222 ------------------------------------------------EKGR--------    225

Query        315 fngvkmpaiaireldgsvrtvreftyadyeqsls    348
d1geqa_      226 ------------------eateflkkkveellgi    241


hit structure      alignment
FAST alignment (Normalized score: 5.72 Raw score:1657.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSG----AKALLALKCFA----------TWSVFD     46
d1geqa_        1 -----------------------------MFKDGSLIPY-----LTAGDPDKQSTLNFLL     26

Query         47 LMRDYMDGTTSS------------------------------SLFEVRLGRERFGKETHA     76
d1geqa_       27 ALDEYAGAIEL-GIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHSSTPIVL     85

Query         77 YSVAY---------GDNEIDEVVS-HADKIIFN--SISQLERFADKA---AGIARGLRLN    121
d1geqa_       86 MT---YYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEI-AREEGIKTVFLAA    141

Query        122 PQRLGE-WDVPKVERVMDR-INGFMIHNNCENKD------FGLFDRMLGEIEERFGALIA    173
d1geqa_      142 P-----NTPDERLKVIDDMTTGFVYL--------VSLYEIPKTAYDLLRRAKRI------    182

Query        174 RV--DWVSLGGGIHFTGDDYPVDA-----FSARLRAFSDRYGVQIYLEPGEASITKSTTL    226
d1geqa_      183 --CRNKVAV---------------GFGVSKREHVVSLLK-EGA-NGVVVGSAL-------    216

Query        227 EVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGE    286
d1geqa_      217 ------------------------------------------------------------    217

Query        287 FRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1geqa_      217 ------------------------------------------------------------    217

Query        347 LS-------------------------    348
d1geqa_      217 --VKIIGEKGREATEFLKKKVEELLGI    241


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:149.14)
Query          1 --MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCF--A-T-WSVFDLMRDYMDG     54
d1geqa_        1 MF-------------------------K-DGSLIPYLTAGDPDKQSTLNFLLALDEYAGA     34

Query         55 TTSSS-------------------------LFEVRLGRERF---G-KETHAYSVA--YG-     82
d1geqa_       35 IELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYR     94

Query         83 --D-NEIDEVVS-HADKIIFN-S-ISQLERFADKAA--GIARGLRLNPQRLGEWDVPKVE    134
d1geqa_       95 AGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPN----TPDERLK    150

Query        135 RVMDRIN-GFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTGDDYPV    193
d1geqa_      151 VIDDMTTGFVYLVSLY------EIPKTAYDLLRRAKRI--CRNKVAVGFGVSK------R    196

Query        194 DAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDL    253
d1geqa_      197 -EHVVSLLKEG----ANGVV-VGSALVKI-I-------------------------G---    221

Query        254 LIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKN    313
d1geqa_      222 -------------------------------------------------EKG--------    224

Query        314 WFNGVKMPAIAIRE------------LDGSVRTVREFTYADYEQSLS    348
d1geqa_      225 ---------REATEFLKKKVEELLGI---------------------    241


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.12)
DALI match                                                                   
Query         19 ERIAHVREKSGAKALLALKCFATWSVFDLMRD---------YMDGTTSSSLFEVRLGRER     69
d1geqa_      123 KEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYEIPKTAYDLLRRAKRI    182

DALI match                                       
Query         70 FGKETHAYSVAYGDNEIDEVVS-HADKIIFNS    100
d1geqa_      183 CRNKVAVGFGVSKREHVVSLLKEGANGVVVGS    214



top
44: d1vhca_ Hypothetical protein HI0047 (hh: 0.920)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.43  Contact: 1448
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.98 tmscore:0.98 rmsd:0.35 AHM:0.37 LBcontacta:0.97 LBcontactb:0.97 LHM:0.16
id:0.98 blosum:0.14 compass:0.07 pearson:0.96
Scaled scores:
dali:0.64 daliz:0.37 gdtts:0.45 tmscore:0.62 rmsd:0.74 AHM:0.65 LBcontacta:0.35 LBcontactb:0.54 LHM:0.41
id:0.05 blosum:0.09 compass:0.17 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 9.5 Raw score:878.00)
Query          1 ----------mietpyylidkakLTRNMERIAHVREKSGA-KALLALKCFatWSVFDLMR     49
d1vhca_        1 syttqqiieklrelkivpvialdNADDILPLADTLAKNGLsVAEITFRSEaaADAIRLLR     60

Query         50 ----DYMDGTTSSSL-FEVRLGRERFGKETHAYSvaYGDNEIDEVV--SHADKIIFNSIS    102
d1vhca_       61 anrpDFLIAAGTVLTaEQVVLAKSSGADFVVTPG--LNPKIVKLCQdlNFPITPGVNNPM    118

Query        103 QLERFADKAAgiARGLRLNPqrLGEW--DVPKVER-VMDRINGFMIHNncenkdfglfdr    159
d1vhca_      119 AIEIALEMGI-sAVKFFPAE--ASGGvkMIKALLGpYAQLQIMPTGGI------------    163

Query        160 MLGEIEeRFGALiARVDWVSLG--gGIHFTGDdYPVDAFSARLRAFSDRYGvqiylepge    217
d1vhca_      164 GLHNIR-DYLAI-PNIVACGGSwfvEKKLIQS-NNWDEIGRLVREVIDIIK---------    211

Query        218 asitksttlevtvldtlynknlaivdssieahmldlliyretakvlpnegshsymicgks    277
d1vhca_      212 ------------------------------------------------------------    212

Query        278 clagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvre    337
d1vhca_      212 ------------------------------------------------------------    212

Query        338 ftyadyeqsls    348
d1vhca_      212 ----------e    212


hit structure      alignment
FAST alignment (Normalized score: 4.72 Raw score:1281.00)
Query          1 MIETPYYLIDKAK-----------------------------------------------     13
d1vhca_        1 -------------SYTTQQIIEKLRELKIVPVIALDNADDILPLADTLAKNGLSVAEITF     47

Query         14 -LTRNMERIAHVREK-SGAKALLALK-CFATWSVFDLMRD-YMDGTTSSS--LFEVRLGR     67
d1vhca_       48 RSEAAADAIRLLRANRPDFLIAA---GTVLTAEQVVLAKSSGADFVVTPGLNPKIVKLCQ    104

Query         68 ERFGKETHAYSVAYGDNEIDEVVS-HADKIIFN------SISQLERFADKAAGIARGLRL    120
d1vhca_      105 -DLNFPITPGV--NNPMAIEIALEMGISAVKFFPAEASGGVKMIKALLGPYAQLQIMPT-    160

Query        121 NPQRLGEW---DVPKVERV--MDRINGFMIHNNCEN---------KDFGLFDRMLGEIEE    166
d1vhca_      161 --------GGIGLHNIRDYLAIPNIVACGGSW----FVEKKLIQSNNWDEIGRLVREVID    208

Query        167 RFGALIARVDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTL    226
d1vhca_      209 II----------------------------------------------------------    210

Query        227 EVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGE    286
d1vhca_      211 ------------------------------------------------------------    211

Query        287 FRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1vhca_      211 ------------------------------------------------------------    211

Query        347 LS--    348
d1vhca_      211 --KE    212


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:147.60)
Query          1 ----------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC     38
d1vhca_        1 SYTTQQIIEKLRELKIVPVIAL---------D--NADDILPLADTLAKNGLSVAEITFRS     49

Query         39 FATWSVFDLMR-DY--M-DGTTSSSLF-EVRLGRERFGKETHAYSVAYGDNEIDEVVSH-     92
d1vhca_       50 EAAADAIRLLRANRPDFLIAAGTVLTAEQVVLAK-SSGADFVVTPGLNP-KIVKLCQDLN    107

Query         93 ADKIIFNSI-SQLERFADKAAGIARGLRLNPQRLGEW--DVPKVER-VMDRINGFMIHNN    148
d1vhca_      108 FPITPGVNNPMAIEIALEMGI-SAVKFFPAEA--SGGVKMIKALLGPYAQL-QIMPTGGI    163

Query        149 CENKDFGLFDRMLGEIEERFGALIARVDWVSLGG-GIH-FT-GDD-YPVDAFSARLRAFS    204
d1vhca_      164 -----------GLHNIRD-YLAI-PNIVACGGSWFVEKKLIQSNNWDEIGRLVREVIDII    210

Query        205 DRYGVQIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLP    264
d1vhca_      211 KE----------------------------------------------------------    212

Query        265 NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIA    324
d1vhca_      213 ------------------------------------------------------------    213

Query        325 IRELDGSVRTVREFTYADYEQSLS    348
d1vhca_      213 ------------------------    213


hit structure      alignment
HHsearch alignment (Probability: 0.41 E-value:0.01)
DALI match                                                                   
Query         15 TRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGKET     74
d1vhca_       53 ADAIRLLRANRPD----FLIAAGTVLTAEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNF    108

DALI match                                                                   
Query         75 HAYSVAYGDNEIDEVVSHADKII-------FNSISQLERFADKAAGIARGLRLNPQRLGE    127
d1vhca_      109 PITPGVNNPMAIEIALEMGISAVKFFPAEASGGVKMIKALLGPYAQLQIM------PTGG    162

DALI match                                                          
Query        128 WDVPKVERVMDRINGFMIHNNCENK--------DFGLFDRMLGEIEERFGA    170
d1vhca_      163 IGLHNIRDYL-AIPNIVACGGSWFVEKKLIQSNNWDEIGRLVREVIDIIKE    212



top
45: d1ec7a1 D-​glucarate dehydratase (svm: 1.456)

SCOP Superfamily: Enolase C-​terminal domain-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 1648
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.42 AHM:0.42 LBcontacta:0.97 LBcontactb:0.98 LHM:0.16
id:0.88 blosum:0.05 compass:0.23 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.37 gdtts:0.45 tmscore:0.64 rmsd:0.71 AHM:0.65 LBcontacta:0.34 LBcontactb:0.55 LHM:0.43
id:0.00 blosum:0.05 compass:0.15 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 8.9 Raw score:955.30)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALKC----------------------     38
d1ec7a1        1 ----------------------dgqqrsEVEMLGYLFFvgnrkatplpyqsqpddscdwy     38

Query         39 ----------faTWSVFDLMRD--YMDGTTSS--------SLFEVRLGRER-fgKETHAY     77
d1ec7a1       39 rlrheeamtpdaVVRLAEAAYEkyGFNDFKLKggvlageeEAESIVALAQRfpqARITLD     98

Query         78 S-VAYG----DNEIDEVVSHADKIIF--------nSISQLERFADKAAgIARGLRlnpqr    124
d1ec7a1       99 PnGAWSlneaIKIGKYLKGSLAYAEDpcgaeqgfsGREVMAEFRRATG-LPTATN-----    152

Query        125 LGEW---DVPKVERVMdRINGFMIHNNcenkdfglfdrMLGEIEErFGALIA-RVDWVSL    180
d1ec7a1      153 MIATdwrQMGHTLSLQ-SVDIPLADPH---------fwTMQGSVR-VAQMCHeFGLTWGS    201

Query        181 GGGIHFTgddYPVDAFSARLRAFsdrYGVQIYLEPGeASITKST----------------    224
d1ec7a1      202 HSNNHFD---ISLAMFTHVAAAA---PGKITAIDTH-WIWQEGNqrltkepfeikgglvq    254

Query        225 -------tlevtvldtlynknlaiVDSSieahmLDLLIYREtakvlpnegshsymicgks    277
d1ec7a1      255 vpekpglgveidmdqvmkahelyqKHGL--garDDAMGMQY-------------------    293

Query        278 clagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvre    337
d1ec7a1      294 -------------------------------------------------------lipgw    298

Query        338 ftyadyeqsls    348
d1ec7a1      299 tfdnkrpcmvr    309


hit structure      alignment
FAST alignment (Normalized score: 4.03 Raw score:1322.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS------GAKALLALKCFA--------------     40
d1ec7a1        1 ----------------------------DGQQRSEVEMLGY-----LFFVGNRKATPLPY     27

Query         41 -----------------------TWSVFDLMRD--YMDGTTSS---------SLFEVRLG     66
d1ec7a1       28 QSQPDDSCDWYRLRHEEAMTPDAVVRLAEAAYEKYGFNDFKL-KGGVLAGEEEAESIVAL     86

Query         67 RERFG-KETHAYSVAY-------GDNEIDEVVSHADKIIFN---------------SISQ    103
d1ec7a1       87 AQRFPQARITLDPN--GAWSLNEAIKIGKYLKGSLAYA---EDPCGAEQGFSGREVMAEF    141

Query        104 LERFADKAAGIARGLRLNPQRLGEW---------DVPKVERVM-DRINGFMIHNNCEN--    151
d1ec7a1      142 RRA-----TGLPTA-----------TNMIATDWRQMGHTLS--LQSVDIPLA------DP    177

Query        152 --KDFGLFDRMLGEIEERFGALIARV--DWVSLGGGIHFTGDDYP---VDAFSARLRAFS    204
d1ec7a1      178 HFWTMQGSVRVAQMCHE---------FGLTWGSHS----------NNHFDISLAMFTHVA    218

Query        205 DRYGVQI-------YLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYR    257
d1ec7a1      219 A------AAPGKITAIDT------------------------------------------    230

Query        258 ETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNG    317
d1ec7a1      231 ------------------------------------------------------------    231

Query        318 VKMPAIAIRELDGSVRTVREFTYADYEQSLS-----------------------------    348
d1ec7a1      231 -------------------------------HWIWQEGNQRLTKEPFEIKGGLVQVPEKP    259

Query        349 --------------------------------------------------    349
d1ec7a1      260 GLGVEIDMDQVMKAHELYQKHGLGARDDAMGMQYLIPGWTFDNKRPCMVR    309


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:151.57)
Query          1 ----MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC------------------     38
d1ec7a1        1 DGQQ-------------------------RSEVEMLGYLFFVGNRKATPLPYQSQPDDSC     35

Query         39 -----F--AT-----W-SVFDLMRD--YM-DGTTSSS---L-FEVRLGRER--FG--KET     74
d1ec7a1       36 DWYRLRHEEAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARI     95

Query         75 HAY-SVAYG-DNEIDEVVSH---ADKIIF--N------SISQLERFADKAAGIARGL--R    119
d1ec7a1       96 TLDPNGAWSLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATG-LPTATNMI    154

Query        120 LNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVS    179
d1ec7a1      155 ATD----WRQMGHTLSLQ-SVDIPLADPHF---------WTMQGSVRVAQMCHEFGLTWG    200

Query        180 LGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTT--------------    225
d1ec7a1      201 SHSNNHF-D--ISLAMFTHVAAAA-P--GKITAIDTH-WIWQEGNQRLTKEPFEIKGGLV    253

Query        226 ------------------LEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVL-PNE    266
d1ec7a1      254 QVPEKPGLGVEIDMDQVM------------------------------------KAH-EL    276

Query        267 --GSHSYMICGKSCLAGDVFGE-----FRFAEELKVGDRISFQDAAGYT-MVK-KNWFN-    316
d1ec7a1      277 YQ-----------------KHGLGARD--------------------DAM-GMQYLIPGW    298

Query        317 --------GVKMPAIAIRELDGSVRTVREFTYADYEQS--LS    348
d1ec7a1      299 TFDNKRPC-----------------------------MVR--    309


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.59)
DALI match                                               
Query         10 DKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMR     49
d1ec7a1       75 AGEEEAESIVALAQRFPQ----ARITLDPNGAWSLNEAIK    110



hit structures. 
top
46: d1s2wa_ Phosphoenolpyruvate mutase (svm: 2.373)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 1608
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.98 tmscore:0.98 rmsd:0.33 AHM:0.32 LBcontacta:0.97 LBcontactb:0.98 LHM:0.17
id:0.75 blosum:0.14 compass:0.12 pearson:0.97
Scaled scores:
dali:0.68 daliz:0.41 gdtts:0.50 tmscore:0.66 rmsd:0.76 AHM:0.68 LBcontacta:0.39 LBcontactb:0.64 LHM:0.42
id:-0.01 blosum:0.08 compass:0.17 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 9.5 Raw score:961.50)
Query          1 mietpyylidkakltrnmeriahvreksGAKALLALkcfATWSVFDLMR-DYMDGTTS--     57
d1s2wa_        1 -------------kvkkttqlkqmlnskDLEFIMEA---HNGLSARIVQeAGFKGIWGsg     44

Query         58 ---------sSLFEVRLGRERFGKETHAYSVAY------GDNEIDEVVS-HADKIIFNS-    100
d1s2wa_       45 lsvsaqlwtqVVEVLEFMSDASDVPILLDADTGygnfnnARRLVRKLEDrGVAGACLEDk    104

Query        101 --------------ISQLERFADKA--AGIARGLRLNPQ---rlgeWDVPKVERV-MDRI    140
d1s2wa_      105 lfgraqpladieefALKIKACKDSQtdPDFCIVARVEAFiagwgldEALKRAEAYrNAGA    164

Query        141 NGFMIHNNcenkdfgLFDRMLGEIEERFGALIarvdWVSLGGGIHFtgddypvdaFSARL    200
d1s2wa_      165 DAILMHSK------kADPSDIEAFMKAWNNQG----PVVIVPTKYY-------ktPTDHF    207

Query        201 RAFSdrygvqIYLEPGEASITK-STTL-----eVTVLdtlynknlaivdssieahmldll    254
d1s2wa_      208 RDMG-----vSMVIWANHNLRAsVSAIqqttkqIYDD-----------------------    239

Query        255 iyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknw    314
d1s2wa_      240 ------------------------------------------------------------    240

Query        315 fngvkmpaiairelDGSVR--TVREftyadyeqsls    348
d1s2wa_      240 -------qslvnveDKIVSvkEIFR----------l    258


hit structure      alignment
FAST alignment (Normalized score: 5.08 Raw score:1522.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS---------------GAKALLALKCF-ATWSV     44
d1s2wa_        1 ----------------------------KVKKTTQLKQMLNSKDLEFIME----AHNGLS     28

Query         45 FDLMRD-YMDGTTSS-------------SLFEVRLGRERFGKETHAYSVAY--------G     82
d1s2wa_       29 ARIVQEAGFKGIW--GSGLSVSAQLWTQVVEVLEFMSDASDVPILLDAD--TGYGNFNNA     84

Query         83 DNEIDEVVS-HADKIIFN----------------SISQLERFADKA--AGIARGLRLNPQ    123
d1s2wa_       85 RRLVRKLEDRGVAGACL-EDKLFGRAQPLADIEEFALKIKACKDSQTDPDFCIVARV---    140

Query        124 RLGEW-----------DVPKVERVMD-RINGFMIHNNCENKDFGLFDRMLGEIEERFGAL    171
d1s2wa_      141 -----EAFIAGWGLDEALKRAEAYRNAGADAILMH--SKKADPSDIEAFMKA--------    185

Query        172 IAR---VDWVSLGGGIHFTGDDYPVDA--------FSARLRAFSDRYGVQ---IYLEPGE    217
d1s2wa_      186 ---WNNQGPVVI---------------VPTKYYKTPTDHFRD--------MGVSMVIWAN    219

Query        218 ASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKS    277
d1s2wa_      220 HNLRAS------------------------------------------------------    225

Query        278 CLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVRE    337
d1s2wa_      226 ------------------------------------------------------------    226

Query        338 FTYADYEQSLS---------------------------------    348
d1s2wa_      226 -----------VSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL    258


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:135.14)
Query          1 ----------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRD     50
d1s2wa_        1 KVKKTTQLKQ-----------------------MLNSKDLEFIMEAHNGLSARIVQEA-G     36

Query         51 YMDGTTS-S---------SLFEVRLGRERFGKETHAYSVAYGDNEIDEVVSHADKIIFNS    100
d1s2wa_       37 FKGIWGSGLSVSAQLWTQVVEVLEFMSDASDVPILLDADTG----------------Y-G     79

Query        101 ISQLERFADKAAG-I-----ARGLRLNPQR----LGEWDVPKVERVMDRIN---------    141
d1s2wa_       80 -N-FNNARRLVRKLEDRGVAGACLEDK-LFGRAQ-PLADIEEFALKIKACKDSQTDPDFC    135

Query        142 GFMIHN-NCENKDFGLF-DRMLGEIEERFGALIAR--VDWVS------------------    179
d1s2wa_      136 IVARVEA--------FIA-GWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAW    186

Query        180 ------LGGGIHFTGDDYPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTLEVTVLDT    233
d1s2wa_      187 NNQGPVVIVPTKY-Y-KTPTDHFRDM-G-V-------SMVIWANHNLRASVSAIQ-----    230

Query        234 LYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEEL    293
d1s2wa_      231 --------QTTK----------------------------QIYD----------------    238

Query        294 KVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVRE--FTYADYEQSLS    348
d1s2wa_      239 DQSLVNV--------------------EDKIV------SVKEIFRL-----------    258


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.34)
DALI match                                                                   
Query          8 LIDKAKLTRNMERIAHVREKSGAKALLALKCFA-----TWSVFDLMRDYMDGTT------     56
d1s2wa_      112 LADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHS    171

DALI match                                                    
Query         57 SSS-LFEVRLGRERFGKE--THAYSVAYGDNEIDEVVSHADKIIF     98
d1s2wa_      172 KKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVI    216



top
47: d1sgja_ Citrate lyase,​ beta subunit (svm: 1.512)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.38  Contact: 1687
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.39 AHM:0.37 LBcontacta:0.97 LBcontactb:0.98 LHM:0.19
id:0.91 blosum:0.04 compass:0.08 pearson:0.96
Scaled scores:
dali:0.66 daliz:0.36 gdtts:0.42 tmscore:0.59 rmsd:0.73 AHM:0.64 LBcontacta:0.36 LBcontactb:0.62 LHM:0.36
id:0.01 blosum:0.05 compass:0.15 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 9.0 Raw score:884.60)
Query          1 mietpyylidkakltrnmeriahvreksgaKALLALK----cFATWsvfdlMRDYMDGTT     56
d1sgja_        1 -------------------------ppallRSVLFAPgnradLIAK----lPRSAPDAVV     31

Query         57 SSS------------------LFEVRLGRERFG-KETHAYSVAY----GDNEIDEVVSHA     93
d1sgja_       32 IDLedavpgtaeakaaarpvaHDAARDLIAAAPhLAVFVRVNALhspyFEDDLSVLTPEL     91

Query         94 DKIIFNS---ISQLERFADKAA----GIARGLRLNPQrlgEWDV-pKVERVmDRINGFMI    145
d1sgja_       92 SGVVVPKlemGAEARQVAQMLQerslPLPILAGLETG--aGVWNarEIMEV-PEVAWAYF    148

Query        146 HNN----cenkdfGLFDRMLGEIEERFGALIA-RVDWVSLGGgIHFTGdDYPV-DAFSAR    199
d1sgja_      149 GAEdyttdlggkrTPGGLEVLYARSQVALAARlTGVAALDIV-VTALN-DPETfRADAEQ    206

Query        200 LRAFSdrygvqIYLEPGEASitksttlevtvldtlynknlaivdssieahmldlliyret    259
d1sgja_      207 GRALG-----ySGKLCIHPA----------------------------------------    221

Query        260 akvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvk    319
d1sgja_      222 ------------------------------------------------------------    222

Query        320 mpaiaireldgsvrtvreftyadyeqsls    348
d1sgja_      222 -------------------qvalaheyfg    231


hit structure      alignment
FAST alignment (Normalized score: 4.71 Raw score:1336.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKSGA-----KALLALKCF---ATWSVFDLMRD-Y     51
d1sgja_        1 ------------------------------PPALLRSVLF----APGNRADLIAKLPRSA     26

Query         52 MDGTTSS-------------------SLFEVRLGRERFG-KETHAYSVAY--------GD     83
d1sgja_       27 PDAVVI-DLEDAVPGTAEAKAAARPVAHDAARDLIAAAPHLAVFVR----VNALHSPYFE     81

Query         84 NEIDEV--VSHADKIIFN---SISQLERFADKA-----AGIARGLRLNPQRLGEWDV---    130
d1sgja_       82 DDLS--VLTPELSGVVVPKLEMGAEARQVAQM-LQERSLPLPILAG-----------LET    127

Query        131 ----PKVERV--MDRINGFMIHNNCENKD---------------FGLFDRMLGEIEERFG    169
d1sgja_      128 GAGVWNAREIMEVPEVAWAYFG-------AEDYTTDLGGKRTPGGLEVLYARSQVALAAR    180

Query        170 ALIARV--DWVSLGGGIHFTGDD-YPVDAFSARLRAFSDRYGVQIYLEPGEASITKSTTL    226
d1sgja_      181 L-----TGVAALDI-VVTA----LNDPETFRADAEQGRA-LGY-SGKLCI----------    218

Query        227 EVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGE    286
d1sgja_      219 ------------------------------------------------------------    219

Query        287 FRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS    346
d1sgja_      219 ------------------------------------------------------------    219

Query        347 LS-------------    348
d1sgja_      219 --HPAQVALAHEYFG    231


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:141.31)
Query          1 ----MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMD-GT     55
d1sgja_        1 PPAL----------------------------LRSVLFAPG-NRADLIAK-LPRSAPDAV     30

Query         56 TSSS--------------L-FEVRLGRER--FG--KETHAYS-VA----YGDNEIDEVVS     91
d1sgja_       31 VIDLEDAVPGTAEAKAAARPVAHDAARDLIAAAPHLAVFVRVNALHSPYFED-DLSVLTP     89

Query         92 HADKIIF--N----SI-SQLERFAD-KAAGIARGLRLNPQRLGEWDVPKVERVMDRINGF    143
d1sgja_       90 ELSGVVVPKLEMGAEARQVAQMLQERSLP-LPILAGLETG-AGVWNAREIM-EVPEVAWA    146

Query        144 MIHNNC--E----NKDFGLFDRMLGEIEERFGALIA-RVDWVSLGGGIHFTGDDYPVDAF    196
d1sgja_      147 YFGAEDYTTDLGGKRTPGG-LEVLYARSQ-VALAARLTGVAALDIV-VTALNDPETFRAD    203

Query        197 SARLRAFSDRYGVQIYLEPGEASI----------TKSTTLEVTVLDTLYNKNLAIVDSSI    246
d1sgja_      204 AEQGRAL--G--YSGKLCI--HPAQVALAHEYFG--------------------------    231

Query        247 EAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAG    306
d1sgja_      232 ------------------------------------------------------------    232

Query        307 YTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS    348
d1sgja_      232 ------------------------------------------    232


hit structure      alignment
HHsearch alignment (Probability: 0.20 E-value:0.00)
DALI match                                                                   
Query         76 AYSVAYGDNEIDEVVSHADKIIFNSIS-------------------QLERFADKAAGIAR    116
d1sgja_        9 LFAPGNRADLIAKLPRSAPDAVVIDLEDAVPGTAEAKAAARPVAHDAARDLIAAAPHLAV     68

DALI match                                                       
Query        117 GLRLNPQRLGEWDVPKVERVMDRINGFMIHNNCENKDFGLFDRMLGEI    164
d1sgja_       69 FVRVNALHSP-YFEDDLSVLTPELSGVVVPKLEMGAEARQVAQMLQER    115



top
48: d1ujpa_ Trp synthase alpha-​subunit (svm: 2.035)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 1577
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.38 AHM:0.39 LBcontacta:0.98 LBcontactb:0.98 LHM:0.20
id:1.00 blosum:0.69 compass:0.32 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.40 gdtts:0.45 tmscore:0.60 rmsd:0.72 AHM:0.62 LBcontacta:0.40 LBcontactb:0.63 LHM:0.38
id:0.10 blosum:0.14 compass:0.23 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 9.2 Raw score:936.30)
Query          1 mietpyylidkakltrnmeriahvrEKSGAKALLALK-----cfaTWSVFDLMRDYMDGT     55
d1ujpa_        1 --------------mttleafakarSEGRAALIPYLTagfpsregFLQAVEEVLPYADLL     46

Query         56 TSSS-------------------------LFEVRLGRERFGKETHAYSVA------yGDN     84
d1ujpa_       47 EIGLpysdgpviqraselalrkgmsvqgaLELVREVRALTEKPLFLMTYLnpvlawgPER    106

Query         85 EIDEVVS-HADKIIF-NSIS-qlERFADKAA--GIARGLRLNPQrlgeWDVPKVERVMDR    139
d1ujpa_      107 FFGLFKQaGATGVILpDLPPdedPGLVRLAQeiGLETVFLLAPT----STDARIATVVRH    162

Query        140 IN-GFMIHNNcenkdfglfdrMLGEIEERFGALIArvDWVSLGGGIHFtgddypvDAFSA    198
d1ujpa_      163 ATgFVYAVSV-----------EVKDLVRRIKARTA--LPVAVGFGVSG-------KATAA    202

Query        199 RLRafsdrygvqIYLEPGEASI-TKSTtlevtvldtlynknlaivdssieahmldlliyr    257
d1ujpa_      203 QAA-------vaDGVVVGSALVrALEE---------------------------------    222

Query        258 etakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqDAAGytmvkknwfng    317
d1ujpa_      223 ---------------------------------------------GRSL-----------    226

Query        318 vkmpaiaireldgsvrtvreftyadyeqsls    348
d1ujpa_      227 --------------apllqeirqglqrlplp    243


hit structure      alignment
FAST alignment (Normalized score: 5.49 Raw score:1595.00)
Query          1 MIETPYYLIDKAKLTRNMERIAHVREKS--------------GAKALLALKCFA------     40
d1ujpa_        1 ----------------------------MTTLEAFAKARSEGRAALIPY-----LTAGFP     27

Query         41 ----TWSVFDLMRDYMDGTTSS--------------------------SLFEVRLGRERF     70
d1ujpa_       28 SREGFLQAVEEVLPYADLLEI-GLPYSDGPVIQRASELALRKGMSVQGALELVREVRALT     86

Query         71 GKETHAYSVAY---------GDNEIDEVVS-HADKIIFNSIS--QLERFADKA-----AG    113
d1ujpa_       87 EKPLFLMT---YLNPVLAWGPERFFGLFKQAGATGVILP---DLPPDEDPGLVRLAQEIG    140

Query        114 IARGLRLNPQRLGE-WDVPKVERVMDR-INGFMIHNNCENKDFG--LFDRMLGEIEERFG    169
d1ujpa_      141 LETVFLLAP-----TSTDARIATVVRHATGFVYAV---------SVEVKDLVRRIKAR--    184

Query        170 ALIARV--DWVSLGGGIHFTGDDYP-----VDAFSARLRAFSDRYGVQ-IYLEPGEASIT    221
d1ujpa_      185 ------TALPVAV------------GFGVSGKATAAQAAV--------ADGVVVGSAL--    216

Query        222 KSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAG    281
d1ujpa_      217 ------------------------------------------------------------    217

Query        282 DVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYA    341
d1ujpa_      217 ------------------------------------------------------------    217

Query        342 DYEQSLS---------------------------    348
d1ujpa_      217 -------VRALEEGRSLAPLLQEIRQGLQRLPLP    243


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:126.07)
Query          1 ------------------------------------------------------------      1
d1ujpa_        1 MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDGPVIQR     60

Query          1 ----------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKC-FAT---WSV-F     45
d1ujpa_       61 ASELALRKGM------------SVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFF    108

Query         46 DLMRDY-MDGTTSS-SLF-EVRLGRERFG---KETHAYSVA-YGDNEIDEVVSHA-DKII     97
d1ujpa_      109 GLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVY    168

Query         98 FN---SISQLERFADKAAGIARGLRLNPQRLGEWDVPKVERVMDRINGFMIHN-NCENKD    153
d1ujpa_      169 AVSVEVKDLVRRIKART-ALPVAVGFGVS--GKATAAQAA--V--ADGVVVGSALVRA-L    220

Query        154 FGLFDRMLGEIEERFGALIAR----VDWVSLGGGIHFTGDDYPVDAFSARLRAFSDRYGV    209
d1ujpa_      221 EEG-RSLAPLLQE-IRQGLQRLPLP-----------------------------------    243

Query        210 QIYLEPGEASITKSTTLEVTVLDTLYNKNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSH    269
d1ujpa_      244 ------------------------------------------------------------    244

Query        270 SYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELD    329
d1ujpa_      244 ------------------------------------------------------------    244

Query        330 GSVRTVREFTYADYEQSLS    348
d1ujpa_      244 -------------------    244


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.64)
DALI match                                                                   
Query         19 ERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFE----VRLGRERFGKET     74
d1ujpa_      130 PGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVEVKDLVRRIKARTALPV    189

DALI match                              
Query         75 HAYSVAYGDNEIDEVVSHADKII     97
d1ujpa_      190 AVGFGVSGKATAAQAAVADGVVV    212



top
49: d1twda_ Copper homeostasis protein CutC (svm: 2.363)

SCOP Superfamily: CutC-​like (Pfam 03932)  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.51  Contact: 1483
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.36 AHM:0.36 LBcontacta:0.98 LBcontactb:0.98