HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T517A
Query:
T517_A.pdb A
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1jx7a_ Hypothetical protein YchN YchN-​like YchN-​like α/β 9.38 1.887 0.99 13.0 13.0 0.61
2 d1l1sa_ Hypothetical protein MTH1491 YchN-​like YchN-​like α/β 7.99 2.229 0.99 12.7 12.7 0.60
3 d1o94a2 Trimethylamine dehydrogenase,​ C-​terminal domain FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.92 1.693 0.11 4.4 4.6 0.43
4 d1ps9a2 2,​4-​dienoyl-​CoA reductase,​ C-​terminal domain FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.40 1.693 0.01 4.5 3.6 0.28
5 d3grsa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.35 1.631 0.20 4.4 4.2 0.41
6 d1ebda2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.34 1.615 0.18 4.5 4.5 0.39
7 d1lvla2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.33 1.528 0.19 4.5 4.5 0.40
8 d1onfa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.29 1.673 0.09 4.3 4.6 0.39
9 d1h6va2 Mammalian thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.28 1.632 0.18 4.4 4.2 0.40
10 d3lada2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.25 1.585 0.11 4.4 4.2 0.39
11 d1jeha2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.23 1.618 0.17 4.3 4.2 0.40
12 d1q1ra2 Putidaredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.22 1.526 0.05 4.6 4.5 0.32
13 d1mo9a2 NADH-​dependent 2-​ketopropyl coenzyme M oxidoreductase/​carboxylase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.20 1.632 0.09 4.0 4.2 0.38
14 d1trba2 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.13 1.691 0.05 4.4 3.8 0.40
15 d1qx4a2 cytochrome b5 reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 2.12 1.285 0.01 4.4 3.3 0.44
16 d1h7wa3 Dihydropyrimidine dehydrogenase,​ domain 3 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.12 1.698 0.02 3.9 3.9 0.30
17 d1c0pa1 D-​aminoacid oxidase,​ N-​terminal domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 2.10 1.634 0.07 4.2 3.8 0.45
18 d1w4xa2 Phenylacetone monooxygenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.09 1.695 0.01 2.9 2.5 0.43
19 d1fl2a2 Alkyl hydroperoxide reductase subunit F (AhpF),​ C-​terminal domains FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 2.08 1.685 0.01 4.3 4.0 0.41
20 d1ps9a3 2,​4-​dienoyl-​CoA reductase,​ middle domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 2.04 1.690 0.10 4.1 3.9 0.44
21 d1vdca2 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.98 1.690 0.02 3.8 3.6 0.39
22 d1cqxa3 Flavohemoglobin,​ C-​terminal domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.97 0.745 0.01 4.6 3.2 0.45
23 d1xfia_ Hypothetical protein At2g17340 Hypothetical protein At2g17340 Hypothetical protein At2g17340 multi 1.95 1.291 0.01 3.6 2.9 0.43
24 d1trba1 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.95 1.697 0.05 4.0 3.9 0.43
25 d1jzta_ Hypothetical protein YNL200c (YNU0 YEAST) YjeF N-​terminal domain-​like YjeF N-​terminal domain-​like α/β 1.94 1.593 0.06 3.6 4.0 0.44
26 d1fw8a_ Phosphoglycerate kinase Phosphoglycerate kinase Phosphoglycerate kinase α/β 1.90 0.785 0.03 5.0 2.5 0.39
27 d1o94a3 Trimethylamine dehydrogenase,​ middle domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.89 1.691 0.04 3.7 3.6 0.40
28 d1nhpa2 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.88 1.599 0.05 4.1 4.3 0.33
29 d1j6ua1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.87 1.692 0.02 3.9 4.4 0.35
30 d2uaga1 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.87 1.633 0.04 4.1 4.1 0.36
31 d1feca2 Trypanothione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.87 1.631 0.07 3.8 3.8 0.37
32 d1p3da1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.86 1.690 0.02 4.1 4.5 0.36
33 d1h7wa4 Dihydropyrimidine dehydrogenase,​ domain 2 Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.85 1.691 0.05 4.0 3.8 0.42
34 d1vg0a1 Rab escort protein 1 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.85 1.632 0.03 3.0 2.7 0.44
35 d1rxwa2 Flap endonuclease-​1 (Fen-​1 nuclease) PIN domain-​like PIN domain-​like α/β 1.84 1.423 0.01 2.8 3.4 0.37
36 d1v6sa_ Phosphoglycerate kinase Phosphoglycerate kinase Phosphoglycerate kinase α/β 1.83 1.292 0.07 4.7 2.8 0.38
37 d1k0ia1 p-​Hydroxybenzoate hydroxylase,​ PHBH FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.81 1.693 0.03 3.3 3.0 0.46
38 d1qfja2 NAD(P)H:flavin oxidoreductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.81 0.724 0.02 3.8 3.9 0.42
39 d1ep3b2 Dihydroorotate dehydrogenase B,​ PyrK subunit Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.75 1.505 0.01 4.5 3.8 0.43
40 d1tq8a_ Hypothetical protein Rv1636 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.75 1.087 0.02 4.4 3.6 0.38
41 d1otha2 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.75 1.482 0.03 3.9 3.2 0.38
42 d1g5ta_ ATP:corrinoid adenosyltransferase CobA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.74 0.702 0.07 2.8 3.3 0.39
43 d1fcda2 Flavocytochrome c sulfide dehydrogenase,​ FCSD,​ flavin-​binding subunit FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.72 1.692 0.01 3.6 3.5 0.41
44 d1ojta2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.72 1.631 0.15 3.4 2.7 0.38
45 d1saya1 L-​alanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.71 1.690 0.08 4.0 4.0 0.40
46 d1fl2a1 Alkyl hydroperoxide reductase subunit F (AhpF),​ C-​terminal domains FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.70 1.693 0.03 3.7 3.2 0.42
47 d1gvha3 Flavohemoglobin,​ C-​terminal domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.70 0.683 0.01 3.6 2.0 0.44
48 d1a9xa3 Carbamoyl phosphate synthetase (CPS),​ large subunit PreATP-​grasp domains PreATP-​grasp domain PreATP-​grasp domain α/β 1.67 1.616 0.01 4.0 4.1 0.39
49 d1el5a1 Sarcosine oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.67 1.694 0.01 3.2 3.2 0.44
50 d1krha2 Benzoate dioxygenase reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.66 0.789 0.02 3.6 3.4 0.42
51 d1vc1a_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 1.65 0.741 0.03 3.2 3.6 0.39
52 d1kjqa2 Glycinamide ribonucleotide transformylase PurT,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.63 1.151 0.06 3.7 3.9 0.36
53 d1qlaa2 Fumarate reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.63 1.690 0.04 3.2 3.1 0.46
54 d1m6ia2 Apoptosis-​inducing factor (AIF) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.60 1.630 0.03 3.4 3.4 0.37
55 d1q1ra1 Putidaredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.59 1.634 0.02 3.4 2.9 0.41
56 d1dv1a2 Biotin carboxylase (BC),​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.58 0.977 0.03 3.5 3.8 0.34
57 d1r0ka2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.57 1.537 0.03 3.9 3.5 0.43
58 d1ve9a1 D-​aminoacid oxidase,​ N-​terminal domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.56 1.715 0.02 3.7 3.5 0.28
59 d1uana_ Hypothetical protein TT1542 LmbE-​like LmbE-​like α/β 1.56 0.824 0.02 2.6 2.3 0.39
60 d1i8ta1 UDP-​galactopyranose mutase,​ N-​terminal domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.55 1.633 0.03 3.6 2.4 0.26
61 d1d5ta1 Guanine nucleotide dissociation inhibitor,​ GDI FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.55 1.630 0.06 3.0 2.6 0.28
62 d1j23a_ Putative ATP-​dependent RNA helicase Hef,​ nuclease domain Restriction endonuclease-​like Restriction endonuclease-​like α/β 1.54 0.994 0.02 2.9 3.3 0.37
63 d1q74a_ 1D-​myo-​inosityl 2-​acetamido-​2-​deoxy-​alpha-​D-​glucopyranoside deacetylase MshD LmbE-​like LmbE-​like α/β 1.54 0.661 0.04 2.5 2.7 0.43
64 d1pj5a2 N,​N-​dimethylglycine oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.54 1.696 0.02 3.8 3.1 0.26
65 d1cjca2 Adrenodoxin reductase of mitochondrial p450 systems Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.54 1.635 0.02 3.5 2.3 0.42
66 d1neka2 Succinate dehydogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.53 1.694 0.02 2.9 2.9 0.45
67 d1mjha_ ​(​Hypothetical​(​ protein MJ0577 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.52 1.080 0.05 2.9 3.8 0.39
68 d1g5qa_ Epidermin modifying enzyme (peptidyl-​cysteine decarboxylase) EpiD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.51 1.064 0.02 2.7 3.3 0.39
69 d1h6va1 Mammalian thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.50 1.693 0.05 3.0 3.2 0.43
70 d1t1ra2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.49 1.629 0.03 3.7 3.8 0.29
71 d1jmva_ Universal stress protein A,​ UspA Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.49 0.997 0.02 3.4 3.1 0.37
72 d1gpma1 GMP synthetase,​ central domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.48 0.753 0.06 2.7 3.2 0.32
73 d1lqta2 Ferredoxin:NADP reductase FprA Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.47 1.637 0.04 3.4 2.0 0.41
74 d1q9ia2 Flavocytochrome c3 (respiratory fumarate reductase) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.47 1.693 0.03 2.7 3.0 0.46
75 d1ng4a1 Glycine oxidase ThiO FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.47 1.695 0.03 2.8 3.2 0.44
76 d2piaa2 Phthalate dioxygenase reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.47 0.977 0.01 3.0 3.2 0.39
77 d1ml4a2 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.47 1.116 0.04 3.4 3.5 0.38
78 d1d4oa_ Transhydrogenase domain III (dIII) DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.46 0.699 0.01 2.6 3.3 0.39
79 d1vkza2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.46 0.790 0.01 3.2 3.7 0.32
80 d3grsa1 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.46 1.694 0.03 2.9 3.3 0.41
81 d3lada1 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.44 1.695 0.04 2.9 3.2 0.43
82 d1ueha_ Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase α/β 1.44 0.934 0.13 2.0 2.8 0.43
83 d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.43 0.704 0.11 3.1 3.4 0.31
84 d1pswa_ ADP-​heptose LPS heptosyltransferase II UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.42 0.862 0.01 4.1 3.1 0.35
85 d1pjqa1 Siroheme synthase CysG,​ domain 1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 1.691 0.01 4.0 4.3 0.25
86 d1seza1 Protoporphyrinogen oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.41 1.690 0.05 2.7 2.0 0.44
87 d1lw7a1 Transcriptional regulator NadR,​ NMN-​adenylyltransferase domain Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.40 0.676 0.02 2.7 2.6 0.34
88 d1duvg2 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.39 1.115 0.02 3.0 2.9 0.37
89 d1byra_ Nuclease Nuc Phospholipase D/​nuclease Phospholipase D/​nuclease α+β 1.39 1.203 0.01 2.4 3.3 0.36
90 d1mv8a3 GDP-​mannose 6-​dehydrogenase,​ GDP-​binding domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.37 1.118 0.03 3.3 2.9 0.39
91 d1js1x2 Transcarbamylase-​like protein Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.37 0.895 0.02 3.2 3.1 0.37
92 d1mvla_ 4'​-​phosphopantothenoylcysteine decarboxylase (PPC decarboxylase,​ halotolerance protein Hal3a) Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.37 0.897 0.03 3.3 2.7 0.40
93 d1jyka_ CTP:phosphocholine cytidylytransferase LicC Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.37 0.843 0.02 2.5 2.6 0.27
94 d1f8ra1 L-​aminoacid oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.37 1.693 0.05 3.0 1.7 0.46
95 d1dkra2 Phosphoribosylpyrophosphate synthetase PRTase-​like PRTase-​like α/β 1.37 0.866 0.01 2.9 3.0 0.33
96 d1s5pa_ NAD-​dependent deacetylase CobB DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.34 0.955 0.01 3.3 2.1 0.38
97 d1od6a_ Phosphopantetheine adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.33 0.724 0.01 2.7 2.7 0.36
98 d1vi2a1 Putative shikimate dehydrogenase YdiB NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.33 1.574 0.01 4.6 4.2 0.31
99 d1o97c_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.32 1.113 0.01 2.3 2.4 0.38
100 d1q7ea_ Hypothetical protein YfdW CoA-​transferase family III (CaiB/​BaiF) CoA-​transferase family III (CaiB/​BaiF) α/β 1.31 1.117 0.01 2.7 2.4 0.41
101 d1j2ra_ Hypothetical protein YecD Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.31 0.610 0.02 2.9 2.7 0.42
102 d1bmta2 Methionine synthase,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 1.30 0.722 0.12 3.2 2.7 0.32
103 d1f2da_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.30 0.647 0.06 1.9 2.4 0.37
104 d1l7da1 Nicotinamide nucleotide transhydrogenase dI component NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.28 1.631 0.09 5.1 3.9 0.23
105 d1ga8a_ Galactosyltransferase LgtC Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.26 0.762 0.01 1.7 1.3 0.31
106 d2at2a2 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.26 0.894 0.03 2.5 2.5 0.35
107 d1ccwa_ Glutamate mutase,​ small subunit Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 1.26 0.823 0.28 2.5 2.8 0.39
108 d1edza1 Methylenetetrahydrofolate dehydrogenase/​cyclohydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.25 1.121 0.00 3.8 3.4 0.36
109 d1lu9a1 Methylene-​tetrahydromethanopterin dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.25 1.631 0.02 3.4 3.9 0.35
110 d1kyqa1 Bifunctional dehydrogenase/​ferrochelatase Met8p,​ N-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.24 1.630 0.01 3.2 3.2 0.29
111 d1d7ya1 NADH-​dependent ferredoxin reductase,​ BphA4 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.24 1.694 0.02 2.8 2.4 0.31
112 d1mo9a1 NADH-​dependent 2-​ketopropyl coenzyme M oxidoreductase/​carboxylase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.22 1.630 0.01 2.1 2.6 0.40
113 d1j6ua2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.22 0.831 0.02 1.9 3.2 0.39
114 d1gsoa2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.22 1.116 0.02 3.2 2.8 0.32
115 d1dlja3 UDP-​glucose dehydrogenase (UDPGDH),​ C-​terminal (UDP-​binding) domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.22 1.070 0.02 2.9 3.1 0.25
116 d1nhpa1 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.21 1.691 0.01 2.5 2.7 0.37
117 d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.21 1.112 0.03 2.1 3.0 0.41
118 d1b37a1 Polyamine oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.18 1.691 0.03 2.8 1.6 0.28
119 d1f0ka_ Peptidoglycan biosynthesis glycosyltransferase MurG UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.18 0.846 0.12 3.5 2.9 0.36
120 d1kdga1 Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH),​ FAD-​binding domain FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.18 1.695 0.02 1.9 2.3 0.50
121 d1vlua_ Gamma-​glutamyl phosphate reductase ALDH-​like ALDH-​like α/β 1.18 0.893 0.01 3.4 2.1 0.39
122 d1gsaa1 Prokaryotic glutathione synthetase,​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.17 0.834 0.06 1.8 2.5 0.31
123 d1n4wa1 Cholesterol oxidase of GMC family FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.17 1.696 0.03 3.6 2.1 0.32
124 d1af7a2 Chemotaxis receptor methyltransferase CheR,​ C-​terminal domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.16 0.844 0.01 2.2 2.1 0.42
125 d1d4aa_ NAD(P)H:quinone reductase Flavoproteins Flavodoxin-​like α/β 1.15 0.986 0.03 2.3 2.9 0.35
126 d1s3ea1 Monoamine oxidase B FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.14 1.638 0.03 2.6 1.8 0.28
127 d1ehia1 D-​alanine:D-​lactate ligase VanA,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.14 0.824 0.01 2.3 2.7 0.34
128 d1efva1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.12 1.112 0.02 2.3 2.5 0.35
129 d1li4a1 S-​adenosylhomocystein hydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.12 1.480 0.05 2.4 3.4 0.36
130 d1lqta1 Ferredoxin:NADP reductase FprA FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.12 1.697 0.01 1.4 2.5 0.40
131 d1vmea1 ROO-​like flavoprotein TM0755,​ C-​terminal domain Flavoproteins Flavodoxin-​like α/β 1.11 0.898 0.28 4.7 3.6 0.37
132 d1v3ua2 Leukotriene b4 12-​hydroxydehydrogenase/​prostaglandin 15-​keto reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.11 1.483 0.02 2.8 3.2 0.38
133 d1e8ca2 UDP-​N-​acetylmuramyl tripeptide synthetase MurE MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.10 0.846 0.01 2.4 2.9 0.29
134 d1e4ea1 D-​alanine:D-​lactate ligase VanA,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.10 0.798 0.03 2.7 2.0 0.34
135 d1yaca_ YcaC Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.09 1.339 0.01 2.1 2.9 0.38
136 d1m66a2 Glycerol-​3-​ phosphate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.09 1.565 0.02 2.3 2.2 0.37
137 d1nyta1 Shikimate 5-​dehydrogenase AroE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.09 1.580 0.01 3.2 3.3 0.35
138 d1gg4a1 UDP-​murNac-​tripeptide D-​alanyl-​D-​alanine-​adding enzyme MurF MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.08 0.841 0.01 2.1 3.8 0.41
139 d1sqsa_ Hypothetical protein SP1951 Flavoproteins Flavodoxin-​like α/β 1.07 0.610 0.02 2.2 3.1 0.35
140 d1meoa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 1.07 1.119 0.01 2.0 2.6 0.35
141 d1vj0a2 Hypothetical protein TM0436 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.07 1.524 0.01 3.0 3.6 0.38
142 d1v1aa_ 2-​keto-​3-​deoxygluconate kinase Ribokinase-​like Ribokinase-​like α/β 1.07 1.222 0.03 3.5 3.0 0.40
143 d1ju2a1 Hydroxynitrile lyase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.07 1.695 0.00 1.8 1.7 0.46
144 d1iz0a2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.06 1.484 0.02 3.4 3.4 0.36
145 d1qyca_ Phenylcoumaran benzylic ether reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.06 1.388 0.02 4.9 3.1 0.36
146 d1e0ta3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 1.06 0.842 0.01 2.3 2.1 0.37
147 d1t57a_ Hypothetical protein MTH1675 PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 1.05 1.338 0.03 1.5 2.2 0.39
148 d1o97d1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.05 1.115 0.01 2.5 2.3 0.37
149 d1knxa1 HPr kinase/​phoshatase HprK N-​terminal domain HPr kinase/​phoshatase HprK N-​terminal domain MurF and HprK N-​domain-​like α/β 1.05 0.714 0.05 1.2 2.4 0.39
150 d1jnra2 Adenylylsulfate reductase A subunit FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.05 1.631 0.01 2.1 1.6 0.43
151 d1q7ra_ Hypothetical protein YaaE Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 1.04 0.822 0.01 1.5 2.2 0.37
152 d1s3ia2 10-​formyltetrahydrofolate dehydrogenase domain 2 Formyltransferase Formyltransferase α/β 1.04 1.115 0.01 3.7 2.9 0.33
153 d1mx3a1 Transcription corepressor CtbP NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.03 1.481 0.01 4.3 3.0 0.34
154 d1m6ia1 Apoptosis-​inducing factor (AIF) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.03 1.692 0.01 1.6 2.1 0.37
155 d1m2ka_ AF1676,​ Sir2 homolog (Sir2-​AF1?) DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.03 1.114 0.01 2.9 1.9 0.35
156 d1fcda1 Flavocytochrome c sulfide dehydrogenase,​ FCSD,​ flavin-​binding subunit FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.03 1.693 0.01 1.9 2.8 0.38
157 d1qj4a_ Hydroxynitrile lyase alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 1.03 0.654 0.01 2.9 2.1 0.42
158 d2naca1 Formate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.02 1.482 0.02 4.2 3.1 0.35
159 d1obba1 Alpha-​glucosidase AglA NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.02 1.119 0.01 2.2 3.0 0.38
160 d1im5a_ Pyrazinamidase/​nicotinamidase Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.01 1.483 0.02 2.0 2.3 0.39
161 d1efpa1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.01 0.995 0.02 2.2 2.1 0.35
162 d1gpja2 Glutamyl tRNA-​reductase middle domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 1.273 0.01 2.6 3.2 0.36
163 d1p5ja_ L-​serine dehydratase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.00 1.484 0.10 3.8 2.1 0.42
164 d1x9ga_ Ribonuclease MAR1 Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.00 1.229 0.02 2.5 2.5 0.39
165 d1chua2 L-​aspartate oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.99 1.694 0.01 2.8 1.3 0.29
166 d1gdha1 D-​glycerate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.99 1.481 0.02 4.3 3.2 0.32
167 d1iowa1 D-​Ala-​D-​Ala ligase,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.99 1.090 0.02 1.9 3.3 0.29
168 d1ni5a1 Putative cell cycle protein MesJ,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 0.99 1.179 0.16 2.6 2.2 0.28
169 d1eucb1 Succinyl-​CoA synthetase,​ beta-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.99 0.823 0.04 3.2 1.8 0.41
170 d1iira_ UDP-​glucosyltransferase GtfB UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 0.98 0.828 0.12 3.4 2.6 0.47
171 d1o5za1 Folylpolyglutamate synthetase,​ C-​terminal domain MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 0.98 0.895 0.01 2.0 2.8 0.41
172 d1f8fa2 Benzyl alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.97 1.481 0.01 3.0 3.1 0.37
173 d1m3sa_ Hypothetical protein YckF SIS domain SIS domain α/β 0.97 0.710 0.06 1.7 2.5 0.28
174 d1efvb_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 0.96 1.116 0.02 2.5 2.5 0.27
175 d1j5pa4 Hypothetical protein TM1643 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.96 1.112 0.05 2.5 3.0 0.33
176 d1pl7a2 Ketose reductase (sorbitol dehydrogenase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.96 1.568 0.01 3.7 3.3 0.31
177 d1psda1 Phosphoglycerate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.96 1.246 0.01 2.5 2.7 0.32
178 d1e19a_ Carbamate kinase Carbamate kinase-​like Carbamate kinase-​like α/β 0.96 0.744 0.01 2.1 2.5 0.32
179 d1c1da1 Phenylalanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.95 1.484 0.03 2.9 3.2 0.28
180 d1o58a_ O-​acetylserine sulfhydrylase (Cysteine synthase) Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 0.95 1.482 0.08 3.8 2.2 0.39
181 d1rzua_ Glycogen synthase 1,​ GlgA UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 0.95 0.841 0.03 3.2 2.1 0.39
182 d1gcia_ Subtilisin Subtilisin-​like Subtilisin-​like α/β 0.95 0.841 0.01 2.5 2.9 0.32
183 d1np3a2 Class I ketol-​acid reductoisomerase (KARI) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.95 1.121 0.02 2.2 3.2 0.35
184 d1qora2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.95 1.482 0.01 3.3 2.7 0.36
185 d1j0aa_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 0.95 0.947 0.05 4.1 2.6 0.27
186 d1ufka_ Hypothetical protein TT0836 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.94 1.365 0.01 4.6 2.8 0.29
187 d1uufa2 Hypothetical protein YahK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.94 1.485 0.02 3.1 2.8 0.36
188 d1t5ba_ ACP phosphodiesterase AcpD Flavoproteins Flavodoxin-​like α/β 0.94 -0.556 0.92 1.9 3.3 0.34
189 d1kica_ Inosine-​adenosine-​guanosine preferring nucleoside hydrolase Nucleoside hydrolase Nucleoside hydrolase α/β 0.94 0.635 0.01 2.3 1.0 0.44
190 d1wdka3 Fatty oxidation complex alpha subunit,​ middle domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.94 1.360 0.05 2.0 2.7 0.38
191 d1vbfa_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.93 1.583 0.01 2.1 2.4 0.38
192 d1lssa_ Ktn Mja218 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.93 1.630 0.01 4.5 3.4 0.35
193 d1lj8a4 Mannitol 2-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.92 1.073 0.01 1.9 1.4 0.41
194 d1heta2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.92 1.629 0.02 3.3 3.2 0.27
195 d1kola2 Formaldehyde dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.91 1.494 0.01 2.7 3.0 0.36
196 d1l7da2 Nicotinamide nucleotide transhydrogenase dI component Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.91 1.121 0.05 1.3 2.3 0.31
197 d1o98a1 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain α/β 0.90 0.892 0.02 2.2 1.8 0.43
198 d1jkxa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 0.90 1.120 0.01 3.6 1.4 0.27
199 d1ptma_ 4-​hydroxythreonine-​4-​phosphate dehydrogenase PdxA Isocitrate/​Isopropylmalate dehydrogenase-​like Isocitrate/​Isopropylmalate dehydrogenase-​like α/β 0.90 0.797 0.01 2.1 1.1 0.35
200 d1leha1 Leucine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.89 1.336 0.03 2.0 2.9 0.28
201 d1ngva_ Amyloid beta precursor protein-​binding protein 1,​ APPBP1 Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 0.89 1.228 0.01 3.4 1.9 0.38
202 d1g60a_ Methyltransferase mboII S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.88 0.638 0.02 1.7 2.2 0.39
203 d1f14a2 Short chain L-​3-​hydroxyacyl CoA dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.88 1.157 0.04 2.2 2.8 0.37
204 d1gu7a2 2,​4-​dienoyl-​CoA reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.88 1.481 0.02 2.7 3.0 0.36
205 d1jvba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.88 1.481 0.01 3.0 3.0 0.37
206 d1id1a_ Rck domain from putative potassium channel Kch NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.88 1.482 0.01 4.5 3.3 0.37
207 d1b7go1 Glyceraldehyde-​3-​phosphate dehydrogenase (GAPDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.87 0.843 0.01 1.8 3.4 0.39
208 d1ff9a1 Saccharopine reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.87 1.113 0.02 2.9 3.2 0.36
209 d1mkya2 Probable GTPase Der,​ N-​terminal and middle domains P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.87 0.635 0.01 2.5 2.7 0.35
210 d1gtma1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.86 1.398 0.01 1.8 1.9 0.34
211 d1pixa1 Glutaconyl-​CoA decarboxylase A subunit ClpP/​crotonase ClpP/​crotonase α/β 0.86 0.662 0.01 2.9 1.9 0.46
212 d1q1na2 Cinnamyl alcohol dehydrogenase,​ ADH6 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.85 1.485 0.01 2.7 3.2 0.37
213 d1vh3a_ CMP:2-​keto-​3-​deoxy-​manno-​octonic acid (CMP-​KDO)synthetase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 0.85 0.842 0.02 1.4 2.0 0.32
214 d1fmta2 Methionyl-​tRNAfmet formyltransferase Formyltransferase Formyltransferase α/β 0.85 1.118 0.03 2.8 2.9 0.36
215 d1r5ja_ Putative phosphotransacetylase SPy1128 Isocitrate/​Isopropylmalate dehydrogenase-​like Isocitrate/​Isopropylmalate dehydrogenase-​like α/β 0.84 0.844 0.01 2.7 1.5 0.36
216 d1e5da1 Rubredoxin oxygen:oxidoreductase (ROO),​ C-​terminal domain Flavoproteins Flavodoxin-​like α/β 0.84 0.894 0.20 2.6 2.1 0.33
217 d1u7na_ Fatty acid/​phospholipid synthesis protein PlsX Isocitrate/​Isopropylmalate dehydrogenase-​like Isocitrate/​Isopropylmalate dehydrogenase-​like α/β 0.84 1.213 0.02 2.4 2.1 0.36
218 d1rkda_ Ribokinase Ribokinase-​like Ribokinase-​like α/β 0.84 1.111 0.03 2.5 2.7 0.41
219 d1v7ca_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 0.83 0.636 0.11 2.6 2.2 0.32
220 d1dl5a1 Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.83 1.120 0.01 1.6 2.4 0.39
221 d1lsua_ Ktn bsu222 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.83 1.633 0.01 2.9 3.2 0.35
222 d1gpea1 Glucose oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.83 1.635 0.01 1.7 1.3 0.50
223 d1ebfa1 Homoserine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.82 0.931 0.01 2.1 2.5 0.31
224 d1h6da1 Glucose-​fructose oxidoreductase,​ N-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.82 0.822 0.02 2.2 2.3 0.26
225 d1k6ja_ Negative transcriptional regulator NmrA NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.82 1.229 0.02 3.6 2.0 0.32
226 d1l3ia_ Precorrin-​6Y methyltransferase (CbiT) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.82 1.352 0.01 2.8 2.2 0.37
227 d1bg6a2 N-​(1-​D-​carboxylethyl)-​L-​norvaline dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.82 1.631 0.03 2.3 2.5 0.21
228 d1i1na_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.81 1.483 0.01 3.9 1.3 0.29
229 d1kyha_ Hypothetical protein YxkO Ribokinase-​like Ribokinase-​like α/β 0.81 1.112 0.01 1.8 2.1 0.37
230 d1nvta1 Shikimate 5-​dehydrogenase AroE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.81 1.624 0.01 2.4 2.5 0.35
231 d7reqb2 Methylmalonyl-​CoA mutase beta subunit,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.81 0.823 0.03 1.4 2.5 0.37
232 d1qkia1 Glucose 6-​phosphate dehydrogenase,​ N-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.80 0.826 0.02 2.2 2.4 0.40
233 d1hyea1 MJ0490,​ lactate/​malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.80 1.461 0.01 1.8 3.2 0.36
234 d1a9xb2 Carbamoyl phosphate synthetase,​ small subunit C-​terminal domain Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.79 0.652 0.01 1.3 2.0 0.35
235 d1tuga1 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.79 0.944 0.02 2.8 2.3 0.31
236 d1lnqa1 Potassium channel-​related protein MthK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.79 1.206 0.01 3.3 2.3 0.24
237 d1vm6a1 Dihydrodipicolinate reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.79 0.827 0.04 1.7 2.8 0.37
238 d1uxoa_ Hypothetical protein YdeN alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.78 0.823 0.01 2.1 2.0 0.41
239 d1npya1 Shikimate 5-​dehydrogenase-​like protein HI0607 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.78 1.489 0.01 2.3 2.4 0.34
240 d1ispa_ Lipase A alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.78 0.822 0.01 2.5 2.6 0.39
241 d1enpa_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.78 1.120 0.01 2.8 1.3 0.42
242 d1pfka_ ATP-​dependent phosphofructokinase Phosphofructokinase Phosphofructokinase α/β 0.78 0.994 0.07 1.2 1.8 0.31
243 d1jqba2 Bacterial secondary alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.78 1.609 0.01 2.4 3.1 0.28
244 d1i36a2 Conserved hypothetical protein MTH1747 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.76 1.118 0.01 2.5 3.2 0.33
245 d1p9la1 Dihydrodipicolinate reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.76 1.114 0.02 2.1 3.1 0.26
246 d1nv8a_ N5-​glutamine methyltransferase,​ HemK S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.76 1.127 0.01 2.1 2.0 0.40
247 d1h1da_ Catechol O-​methyltransferase,​ COMT S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.76 0.946 0.01 2.7 2.1 0.40
248 d1o54a_ Hypothetical protein TM0748 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.75 0.996 0.01 2.3 2.1 0.32
249 d1mv8a2 GDP-​mannose 6-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.75 1.631 0.02 2.6 1.0 0.37
250 d2masa_ Inosine-​uridine nucleoside N-​ribohydrolase,​ IU-​NH Nucleoside hydrolase Nucleoside hydrolase α/β 0.75 0.668 0.01 2.5 0.7 0.38
251 d1rjwa2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.75 1.482 0.01 2.8 3.2 0.24
252 d1feca1 Trypanothione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.75 1.632 0.01 1.6 2.5 0.42
253 d1dpga1 Glucose 6-​phosphate dehydrogenase,​ N-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.74 0.893 0.01 1.6 2.6 0.40
254 d1rq2a1 Cell-​division protein FtsZ Tubulin nucleotide-​binding domain-​like Tubulin nucleotide-​binding domain-​like α/β 0.74 0.841 0.03 2.2 3.0 0.40
255 d1dxya1 D-​2-​hydroxyisocaproate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.74 1.327 0.02 2.0 2.5 0.32
256 d1tdja1 Allosteric threonine deaminase N-​terminal domain Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 0.74 0.835 0.09 3.1 2.0 0.31
257 d1b74a2 Glutamate racemase Aspartate/​glutamate racemase ATC-​like α/β 0.73 0.862 0.02 2.1 2.0 0.26
258 d1t3ta2 FGAM synthase PurL,​ amidotransferase domain Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.73 0.891 0.01 2.1 0.7 0.29
259 d1pkla3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 0.73 0.843 0.01 2.4 1.5 0.22
260 d1s6ya1 6-​phospho-​beta-​glucosidase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.72 1.118 0.02 2.7 1.4 0.39
261 d1tjya_ AI-​2 receptor LsrB Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.72 0.822 0.04 2.9 1.9 0.31
262 d1dxya2 D-​2-​hydroxyisocaproate dehydrogenase Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.72 0.829 0.03 1.6 2.6 0.24
263 d1vk4a_ Hypothetical protein TM0415 Ribokinase-​like Ribokinase-​like α/β 0.72 0.844 0.02 1.9 2.3 0.38
264 d1pqwa_ Putative enoyl reductase domain of polyketide synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.72 1.353 0.01 1.8 2.9 0.35
265 d1rkxa_ CDP-​glucose-​4,​6-​dehydratase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.72 1.117 0.01 2.3 2.6 0.41
266 d1vi9a_ Pyridoxamine kinase Ribokinase-​like Ribokinase-​like α/β 0.72 0.837 0.01 1.9 2.4 0.31
267 d1o89a2 Hypothetical protein YhdH NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.72 1.652 0.02 2.8 2.4 0.34
268 d1m6ya2 TM0872,​ methyltransferase domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.71 1.184 0.01 2.0 2.7 0.33
269 d1tlta1 Virulence factor MviM NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.71 1.113 0.02 2.3 2.3 0.32
270 d1p5fa_ DJ-​1 Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.71 1.052 0.03 3.1 2.5 0.35
271 d1spxa_ Glucose dehydrogenase (5l265) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.71 1.119 0.01 2.7 2.9 0.36
272 d1w4xa1 Phenylacetone monooxygenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.70 1.694 0.02 1.1 1.2 0.36
273 d1dlja2 UDP-​glucose dehydrogenase (UDPGDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.70 1.632 0.01 2.1 2.8 0.35
274 d1dnpa2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 0.70 0.651 0.01 1.7 2.1 0.32
275 d1f4pa_ Flavodoxin Flavoproteins Flavodoxin-​like α/β 0.70 1.629 0.06 1.9 2.0 0.30
276 d1ej0a_ RNA methyltransferase FtsJ S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.69 1.117 0.02 2.9 2.2 0.36
277 d2naca2 Formate dehydrogenase Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.69 0.966 0.01 1.6 1.8 0.32
278 d1uz5a3 MoeA,​ central domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.69 1.012 0.02 1.6 2.4 0.27
279 d1vhqa_ Putative sigma cross-​reacting protein 27A (SCRP-​27A,​ EllB) Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.69 0.883 0.04 1.3 2.2 0.40
280 d2pgda2 6-​phosphogluconate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.69 1.120 0.02 2.0 2.9 0.35
281 d1o14a_ Putative sugar kinase TM0828 Ribokinase-​like Ribokinase-​like α/β 0.68 1.114 0.02 1.7 2.2 0.42
282 d1jaxa_ Coenzyme F420H2:NADP+ oxidoreductase (FNO) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.68 1.425 0.02 2.9 2.5 0.31
283 d1jg1a_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.68 1.593 0.01 2.0 2.4 0.38
284 d1ri5a_ mRNA cap (Guanine N-​7) methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.68 0.908 0.02 1.4 0.7 0.34
285 d1uxja1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.68 1.631 0.02 2.5 2.7 0.30
286 d1ngvb_ UBA3 Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 0.68 1.631 0.01 2.4 1.3 0.40
287 d1psda2 Phosphoglycerate dehydrogenase Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.68 1.111 0.02 2.0 2.6 0.35
288 d1qama_ rRNA adenine dimethylase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.67 1.337 0.01 2.3 1.5 0.36
289 d1ne2a_ Hypothetical protein Ta1320 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.67 1.629 0.01 2.2 2.3 0.38
290 d1hdoa_ Biliverdin IX beta reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.67 1.631 0.02 3.1 2.1 0.35
291 d1geea_ Glucose dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.67 1.117 0.01 3.2 2.3 0.38
292 d1nt2a_ Fibrillarin homologue S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.67 0.845 0.01 2.0 2.1 0.36
293 d7reqa2 Methylmalonyl-​CoA mutase alpha subunit,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.67 1.111 0.09 1.5 2.6 0.29
294 d1lc0a1 Biliverdin reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.67 0.939 0.02 2.4 2.4 0.24
295 d1i7qb_ Anthranilate synthase GAT subunit,​ TrpG Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.67 0.845 0.01 2.6 2.5 0.37
296 d1v4va_ UDP-​N-​acetylglucosamine 2-​epimerase UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 0.67 0.822 0.01 3.3 2.0 0.36
297 d1ldna1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.66 1.122 0.01 1.8 2.8 0.33
298 d1exma3 Elongation factor Tu (EF-​Tu),​ N-​terminal (G) domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.66 0.823 0.02 1.9 2.0 0.28
299 d1rtta_ Hypothetical protein PA1204 Flavoproteins Flavodoxin-​like α/β 0.66 1.111 0.04 1.8 2.6 0.30
300 d1xeaa1 Putative oxidoreductase VCA1048 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.66 0.898 0.04 2.2 2.4 0.34
301 d1p1ca_ Guanidinoacetate methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.65 1.112 0.01 2.2 2.2 0.37
302 d6ldha1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.65 1.443 0.01 2.1 2.1 0.34
303 d1p91a_ rRNA methyltransferase RlmA S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.65 1.015 0.01 1.8 1.4 0.40
304 d1nw9b_ Caspase-​9 Caspase-​like Caspase-​like α/β 0.65 0.759 0.02 1.5 2.5 0.31
305 d5nula_ Flavodoxin Flavoproteins Flavodoxin-​like α/β 0.65 1.444 0.12 1.4 2.0 0.33
306 d1eq2a_ ADP-​L-​glycero-​D-​mannoheptose 6-​epimerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.65 1.113 0.03 2.0 2.1 0.40
307 d1jw9b_ Molybdenum cofactor biosynthesis protein MoeB Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 0.65 1.634 0.01 3.7 3.4 0.27
308 d1ks9a2 Ketopantoate reductase PanE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.65 1.426 0.02 1.9 2.6 0.25
309 d1lhpa_ Pyridoxal kinase Ribokinase-​like Ribokinase-​like α/β 0.65 0.987 0.01 1.6 2.4 0.40
310 d1vima_ Hypothetical protein AF1796 SIS domain SIS domain α/β 0.64 0.989 0.04 1.7 2.5 0.27
311 d1gr0a1 Myo-​inositol 1-​phosphate synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.64 1.115 0.02 1.1 2.3 0.37
312 d2cmda1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.64 1.631 0.01 2.1 2.6 0.35
313 d2ae1a_ Tropinone reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.64 1.119 0.01 2.8 2.8 0.40
314 d1qo0a_ Amide receptor/​negative regulator of the amidase operon (AmiC) Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.64 0.718 0.01 2.3 1.2 0.38
315 d1ek6a_ Uridine diphosphogalactose-​4-​epimerase (UDP-​galactose 4-​epimerase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.64 1.115 0.02 2.3 1.9 0.37
316 d1ir6a_ Exonuclease RecJ DHH phosphoesterases DHH phosphoesterases α/β 0.64 1.078 0.14 1.4 1.9 0.33
317 d1dcta_ DNA methylase HaeIII S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.64 0.822 0.01 1.4 1.3 0.37
318 d1b16a_ Drosophila alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.64 1.494 0.01 4.6 2.7 0.37
319 d1mjfa_ Putative spermidine synthetase PF0127 (SpeE) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.63 1.377 0.00 1.9 1.7 0.30
320 d1sb8a_ UDP-​N-​acetylglucosamine 4-​epimerase WbpP NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.63 1.115 0.02 1.8 1.9 0.37
321 d1mjna_ Integrin CD11a/​CD18 (Leukocyte function associated antigen-​1,​ LFA-​1) vWA-​like vWA-​like α/β 0.63 0.898 0.01 2.4 1.9 0.33
322 d1gz6a_ (3R)-​hydroxyacyl-​CoA dehydrogenase domain of estradiol 17 beta-​Dehydrogenase 4 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.63 1.176 0.01 2.4 2.6 0.35
323 d1pn0a1 Phenol hydroxylase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.63 1.696 0.02 1.0 2.1 0.30
324 d1g8aa_ Fibrillarin homologue S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.62 1.049 0.01 2.3 1.3 0.36
325 d1u2xa_ ADP-​specific phosphofructokinase Ribokinase-​like Ribokinase-​like α/β 0.62 0.630 0.02 2.8 1.9 0.40
326 d1hwxa1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.62 1.121 0.03 1.6 1.9 0.26
327 d1gcaa_ Galactose/​glucose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.61 0.831 0.02 3.1 2.0 0.31
328 d1k68a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 0.61 0.722 0.01 2.5 2.7 0.27
329 d1j5va_ 2-​keto-​3-​deoxygluconate kinase Ribokinase-​like Ribokinase-​like α/β 0.61 1.222 0.03 1.6 2.4 0.39
330 d1i24a_ Sulfolipid biosynthesis protein SQD1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.61 1.118 0.01 1.8 1.8 0.35
331 d1obfo1 Glyceraldehyde-​3-​phosphate dehydrogenase (GAPDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 0.719 0.02 1.4 1.4 0.38
332 d1o6za1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 1.329 0.01 1.6 2.5 0.36
333 d1t4ba1 Aspartate beta-​semialdehyde dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 1.115 0.01 1.0 2.1 0.32
334 d1sqga2 Ribosomal RNA small subunit methyltransferase B,​ RsmB (Sun,​ Fmu/​Fmv),​ C-​terminal domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.60 1.629 0.01 1.9 2.0 0.36
335 d1a4ia1 Methylenetetrahydrofolate dehydrogenase/​cyclohydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 1.119 0.01 1.4 2.5 0.30
336 d1u8xx1 Maltose-​6'​-​phosphate glucosidase GlvA NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 1.114 0.01 2.2 1.1 0.25
337 d1iuka_ Hypothetical protein TT1466 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.60 0.835 0.03 1.6 1.6 0.35
338 d1nvmb1 Acetaldehyde dehydrogenase (acylating) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.59 1.114 0.02 2.6 2.5 0.33
339 d1uwka_ Urocanate hydratase HutU Urocanase (Pfam 01175) Urocanase (Pfam 01175) multi 0.59 0.813 0.01 3.8 1.5 0.35
340 d1ua4a_ ADP-​dependent glucokinase Ribokinase-​like Ribokinase-​like α/β 0.59 0.787 0.01 1.5 2.1 0.28
341 d1oi7a2 Succinyl-​CoA synthetase,​ alpha-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.59 0.822 0.03 1.3 3.0 0.38
342 d1inla_ Spermidine synthase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.59 1.228 0.01 3.8 1.5 0.30
343 d1bdba_ Cis-​biphenyl-​2,​3-​dihydrodiol-​2,​3-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.59 1.118 0.01 2.5 1.3 0.42
344 d1orra_ CDP-​tyvelose-​2-​epimerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.59 1.115 0.01 2.1 1.8 0.33
345 d1miob_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 0.59 1.111 0.05 2.3 1.2 0.33
346 d1iy8a_ Levodione reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.58 1.119 0.01 4.9 2.1 0.31
347 d1bx4a_ Adenosine kinase Ribokinase-​like Ribokinase-​like α/β 0.58 0.949 0.01 1.9 1.0 0.42
348 d1i9ga_ Probable methyltransferase Rv2118c S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.57 1.113 0.01 1.9 1.6 0.29
349 d1m72a_ Caspase-​1 Caspase-​like Caspase-​like α/β 0.57 0.720 0.02 1.2 2.5 0.39
350 d1qsga_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.56 1.119 0.01 2.0 2.7 0.37
351 d1qp8a1 Putative formate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.56 1.230 0.02 3.2 2.6 0.23
352 d1mkza_ MoaB Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.56 0.641 0.03 1.7 2.3 0.29
353 d1nria_ Hypothetical protein HI0754 SIS domain SIS domain α/β 0.56 0.841 0.02 1.5 1.9 0.31
354 d1h2ba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.55 1.421 0.01 2.3 2.5 0.26
355 d1r6da_ dTDP-​glucose 4,​6-​dehydratase (RmlB) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.55 1.115 0.03 1.5 2.0 0.40
356 d1vm7a_ Ribokinase Ribokinase-​like Ribokinase-​like α/β 0.55 1.221 0.03 1.5 1.4 0.29
357 d1e7wa_ Dihydropteridin reductase (pteridine reductase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.54 1.117 0.01 2.4 1.6 0.36
358 d1cyda_ Carbonyl reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.54 1.117 0.01 4.9 2.1 0.37
359 d1t0ba_ GK2113 homologue Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.54 0.825 0.01 2.0 2.0 0.35
360 d1xcba2 Transcriptional repressor Rex,​ C-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.54 1.122 0.02 1.5 1.7 0.31
361 d1u1ia1 Myo-​inositol 1-​phosphate synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.54 0.702 0.03 1.4 1.7 0.36
362 d1kk1a3 Initiation factor eIF2 gamma subunit,​ N-​terminal (G) domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.53 0.827 0.01 1.9 2.1 0.27
363 d1vjpa1 Hypothetical protein TM1419 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.53 1.017 0.03 1.7 0.8 0.35
364 d1hyha1 L-​2-​hydroxyisocapronate dehydrogenase,​ L-​HICDH NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.53 1.187 0.01 1.8 2.7 0.30
365 d1diha1 Dihydrodipicolinate reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.53 1.116 0.03 3.0 2.8 0.34
366 d1enya_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.53 1.176 0.01 2.1 1.9 0.37
367 d1gpma2 GMP synthetase Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.53 0.842 0.03 0.8 2.1 0.32
368 d1m1nb_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 0.52 0.864 0.03 4.2 0.8 0.33
369 d1qlwa_ A novel bacterial esterase alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.52 0.826 0.01 1.4 1.1 0.41
370 d1vl5a_ Hypothetical protein BH2331 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.52 1.114 0.01 2.1 1.5 0.29
371 d1t2da1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.51 1.630 0.01 1.5 3.0 0.34
372 d1teaa2 Hydroxyisobutyrate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.51 1.165 0.03 2.2 2.8 0.23
373 d1ja9a_ 1,​3,​6,​8-​tetrahydroxynaphthalene reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.51 1.120 0.01 4.6 1.4 0.35
374 d1qzza2 Aclacinomycin-​10-​hydroxylase RdmB S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.51 1.333 0.01 1.8 1.1 0.28
375 d1jtva_ Human estrogenic 17beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.50 1.123 0.01 2.0 1.9 0.38
376 d1uaya_ Type II 3-​hydroxyacyl-​CoA dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.50 1.117 0.01 1.8 2.0 0.37
377 d1n5da_ Carbonyl reductase/​20beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.49 1.122 0.01 2.3 2.0 0.39
378 d1vl8a_ Gluconate 5-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.49 1.117 0.01 2.3 2.1 0.35
379 d1nw3a_ Catalytic,​ N-​terminal domain of histone methyltransferase Dot1l S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.49 0.844 0.03 2.3 0.6 0.39
380 d1ixka_ Hypothetical methyltransferase PH1374 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.49 1.114 0.01 2.9 1.8 0.37
381 d1f6ba_ SAR1 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.49 0.844 0.01 2.0 1.8 0.27
382 d1hxha_ 3beta/​17beta hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.48 1.120 0.01 2.3 1.7 0.38
383 d1dgma_ Adenosine kinase Ribokinase-​like Ribokinase-​like α/β 0.48 0.847 0.01 1.8 1.0 0.42
384 d1e6ua_ GDP-​4-​keto-​6-​deoxy-​d-​mannose epimerase/​reductase (GDP-​fucose synthetase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.48 0.842 0.01 2.2 1.6 0.28
385 d1o5ia_ beta-​keto acyl carrier protein reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.48 1.117 0.03 2.2 1.7 0.31
386 d1u2za_ Catalytic,​ N-​terminal domain of histone methyltransferase Dot1l S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.48 1.116 0.04 1.2 0.7 0.33
387 d1fmca_ 7-​alpha-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.48 1.118 0.01 4.5 1.6 0.35
388 d1b8pa1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.47 1.118 0.02 2.6 1.4 0.37
389 d1nxqa_ R-​specific alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.47 1.120 0.01 2.4 2.2 0.31
390 d1dcfa_ Receiver domain of the ethylene receptor CheY-​like Flavodoxin-​like α/β 0.46 0.691 0.01 3.1 3.0 0.37
391 d1oaaa_ Sepiapterin reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.45 1.121 0.01 1.8 1.8 0.38
392 d1jx6a_ Quorum-​sensing signal (autoinducer-​2) binding protein LuxP Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.45 0.670 0.02 1.2 1.4 0.31
393 d1gega_ meso-​2,​3-​butanediol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.45 1.118 0.01 2.1 2.5 0.34
394 d1jsxa_ Glucose-​inhibited division protein B (GidB) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.45 1.306 0.01 2.4 1.2 0.36
395 d2rsla_ gamma,​delta resolvase,​ catalytic domain Resolvase-​like Resolvase-​like α/β 0.44 0.691 0.05 0.7 2.1 0.23
396 d1h5qa_ Mannitol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.43 1.117 0.01 4.0 2.2 0.35
397 d1hdca_ 3-​alpha,​20-​beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.43 1.120 0.01 4.1 1.5 0.34
398 d1db3a_ GDP-​mannose 4,​6-​dehydratase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.42 1.114 0.01 1.8 1.6 0.39
399 d1imja_ Ccg1/​TafII250-​interacting factor B (Cib) alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.42 0.720 0.01 3.0 1.1 0.30
400 d1vl0a_ DTDP-​4-​dehydrorhamnose reductase RfbD NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.41 1.116 0.02 1.0 2.1 0.41
401 d1j3va2 Hydroxyisobutyrate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.40 1.121 0.02 1.3 2.0 0.26
402 d1qyra_ High level kasugamycin resistance protein KsgA S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.40 1.385 0.01 2.1 1.6 0.24
403 d1vlla_ Archaeal alanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.39 1.229 0.01 2.2 0.9 0.32
404 d1gdha2 D-​glycerate dehydrogenase Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.39 1.117 0.01 1.5 1.9 0.25
405 d1q7ca_ beta-​keto acyl carrier protein reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.39 1.118 0.01 2.4 1.4 0.37
406 d1px0a_ Halohydrin dehalogenase HheC NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.38 1.121 0.01 1.7 1.9 0.34
407 d1f3la_ Arginine methyltransferase,​ HMT1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.37 1.168 0.01 0.2 1.8 0.36
408 d1iexa2 Beta-​D-​glucan exohydrolase,​ C-​terminal domain Beta-​D-​glucan exohydrolase,​ C-​terminal domain Flavodoxin-​like α/β 0.37 0.687 0.01 0.8 1.7 0.31
409 d1uira_ Spermidine synthase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.36 1.536 0.01 0.8 1.2 0.38
410 d1ooea_ Dihydropteridin reductase (pteridine reductase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.36 1.119 0.01 1.2 2.0 0.35
411 d1snya_ Carbonyl reductase sniffer NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.35 1.119 0.01 3.4 1.9 0.37
412 d1pg4a_ Acetyl-​CoA synthetase Acetyl-​CoA synthetase-​like Acetyl-​CoA synthetase-​like multi 0.35 0.732 0.01 2.6 1.5 0.39
413 d1qmga2 Class II ketol-​acid reductoisomerase (KARI) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.34 1.115 0.01 0.8 1.9 0.34
414 d1fjha_ 3-​alpha-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.33 1.118 0.01 1.1 1.6 0.40
415 d1uuya_ Plant CNX1 G domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.33 1.049 0.01 1.8 1.7 0.27
416 d1g38a_ DNA methylase TaqI S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.32 0.667 0.00 1.5 0.5 0.31
417 d1dusa_ Hypothetical protein MJ0882 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.31 1.440 0.00 3.3 1.0 0.31
418 d1gy8a_ Uridine diphosphogalactose-​4-​epimerase (UDP-​galactose 4-​epimerase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.30 0.879 0.02 1.0 1.7 0.39
419 d1uwva2 rRNA (Uracil-​5-​)-​methyltransferase RumA,​ catalytic domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.30 0.917 0.00 1.7 0.8 0.36
420 d1hrda1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.30 1.125 0.02 0.5 1.8 0.33
421 d1g55a_ DNMT2 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.30 0.650 0.00 1.3 1.2 0.28
422 d1vjoa_ Alanine-​glyoxylate aminotransferase PLP-​dependent transferases PLP-​dependent transferases α/β 0.29 0.843 0.02 0.5 1.9 0.37
423 d1jlra_ Uracil PRTase,​ Upp PRTase-​like PRTase-​like α/β 0.29 0.964 0.01 1.1 0.8 0.32
424 d1k2wa_ Sorbitol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.29 1.120 0.01 1.7 2.5 0.34
425 d1kpga_ CmaA1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.29 1.483 0.03 0.5 1.2 0.37
426 d1jdpa_ Hormone binding domain of the atrial natriuretic peptide receptor Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.29 0.708 0.01 2.4 1.8 0.27
427 d1fp2a2 Isoflavone O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.27 1.018 0.01 2.2 1.5 0.31
428 d1t43a_ N5-​glutamine methyltransferase,​ HemK S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.26 1.114 0.01 1.4 1.5 0.27
SCOP domains with score worse than the threshold
429 d1h4xa_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 1.98 -1.636 0.14 3.8 4.5 0.42
430 d1fs0g_ ATP synthase (F1-​ATPase),​ gamma subunit ATP synthase (F1-​ATPase),​ gamma subunit Pyruvate kinase C-​terminal domain-​like α/β 1.88 0.551 0.02 3.7 3.5 0.41
431 d1j3aa_ Ribosomal protein L13 Ribosomal protein L13 Ribosomal protein L13 α/β 1.84 -1.531 0.01 3.6 2.9 0.36
432 d1q77a_ Hypothetical protein Aq 178 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.82 -0.161 0.03 3.6 3.1 0.42
433 d1q3qa2 Thermosome,​ A-​domain GroEL apical domain-​like The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 1.81 -1.582 0.10 1.6 2.6 0.35
434 d1dhsa_ Deoxyhypusine synthase,​ DHS DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.81 0.549 0.01 2.9 2.5 0.46
435 d1v0wa1 Phospholipase D Phospholipase D/​nuclease Phospholipase D/​nuclease α+β 1.66 -1.225 0.01 2.6 2.2 0.45
436 d1th8b_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 1.65 0.557 0.12 3.3 3.4 0.41
437 d1m1xb2 Integrin beta A domain vWA-​like vWA-​like α/β 1.63 -1.127 0.03 2.9 2.2 0.45
438 d1on3a2 Methylmalonyl-​CoA carboxyltransferase (transcarboxylase 12S) ClpP/​crotonase ClpP/​crotonase α/β 1.61 -1.520 0.01 3.1 2.5 0.47


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1jx7a_ Hypothetical protein YchN (hh: 0.991)

SCOP Superfamily: YchN-​like  |  SCOP Fold: YchN-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.86  Contact: 1044
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:0.99 rmsd:0.29 AHM:0.32 LBcontacta:0.99 LBcontactb:0.99 LHM:0.10
id:1.00 blosum:0.97 compass:0.94 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.62 gdtts:0.65 tmscore:0.75 rmsd:0.82 AHM:0.75 LBcontacta:0.58 LBcontactb:0.77 LHM:0.60
id:0.13 blosum:0.21 compass:0.36 pearson:0.37

hit structure      alignment
DALI alignment (Z-score: 13.0 Raw score:806.90)
Query          1 gmeNKKMNLLLFSGDY--DKALASLIIANAAREME--IEVTIFCAFWGLLLLRDPekasq     56
d1jx7a_        1 ---MQKIVIVANGAPYgsESLFNSLRLAIALREQEsnLDLRLFLMSDAVTAGLRG-----     52

Query         57 edkslyeqafssltpreaeelplskmnlggigkkmlLEMMkeekaPKLSDLLSGARKKEV    116
d1jx7a_       53 ----------------------------------qkPGEG-----YNIQQMLEILTAQNV     73

Query        117 KFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI    160
d1jx7a_       74 PVKLCKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF    117


hit structure      alignment
FAST alignment (Normalized score: 12.96 Raw score:1774.00)
Query          1 GMENKKMNLLLFSGD---YDKALASLIIANAARE--MEIEVTIFCAFWGLLLLRDPEKAS     55
d1jx7a_        1 ---MQKIVIVANGA-PYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGL------     50

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEE------KAPKLSDLLS    109
d1jx7a_       51 --------------------------------------------RGQKPGEGYNIQQMLE     66

Query        110 GARKKEVKFYAXQLSVEIMGFKKE-ELFPEVQIMDVKEYLKNALESDLQLFI--    160
d1jx7a_       67 ILTAQNVPVKLCKTCTDGRG-ISTLPLIDGVEIGTLVELAQWTLSADKVL--TF    117


hit structure      alignment
TMalign alignment (TM-score: 0.61 Raw score:97.67)
Query          1 GMENKKMNLLLFSGDY--DKALASLIIANAARE-M-EIEVTIFCAFWGLLLLRDPEKASQ     56
d1jx7a_        1 ---MQKIVIVANGAPYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGLRG-----     52

Query         57 EDKSLYEQAFSSLTPREAEE-LPLSKMNLGGIGKKMLLEMMKEEKAPKLS-DLLSGARKK    114
d1jx7a_       53 ----------------Q-KPG-------------E--G---------YNIQQMLEILTAQ     71

Query        115 EVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI    160
d1jx7a_       72 NVPVKLCKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF    117


hit structure      alignment
HHsearch alignment (Probability: 0.99 E-value:0.00)
DALI match       **********  ..*****************.  *****************         
Query          5 KKMNLLLFSG--DYDKALASLIIANAAREMEI--EVTIFCAFWGLLLLRDPEKASQEDKS     60
d1jx7a_        2 QKIVIVANGAPYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGLRGQKPG-----     56

DALI match                                                *******************
Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYA    120
d1jx7a_       57 ---------------------------------------EGYNIQQMLEILTAQNVPVKL     77

DALI match       **************************************
Query        121 XQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQL    158
d1jx7a_       78 CKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVL    115



top
2: d1l1sa_ Hypothetical protein MTH1491 (hh: 0.991)

SCOP Superfamily: YchN-​like  |  SCOP Fold: YchN-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.89  Contact: 886
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.24 AHM:0.25 LBcontacta:0.98 LBcontactb:0.97 LHM:0.10
id:0.94 blosum:0.73 compass:0.80 pearson:0.99
Scaled scores:
dali:0.80 daliz:0.60 gdtts:0.75 tmscore:0.79 rmsd:0.85 AHM:0.78 LBcontacta:0.53 LBcontactb:0.71 LHM:0.60
id:0.05 blosum:0.14 compass:0.31 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 12.7 Raw score:767.50)
Query          1 gmeNKKMNLLLFSGDYDKALASLIIANAAREME--IEVTIFCAFWGLLLLRDpekasqed     58
d1l1sa_        1 ---DYRVVFHIDEDDESRVLLLISNVRNLMADLesVRIEVVAYSMGVNVLRR--------     49

Query         59 kslyeqafssltpREAEelplskmnlggigkkmllemmkeekapklSDLLSGARKKEVKF    118
d1l1sa_       50 -------------DSEY-----------------------------SGDVSELTGQGVRF     67

Query        119 YAXQLSVEIMGFKKEELFPEVQIMD--VKEYLKNA-LESDlQLFI    160
d1l1sa_       68 CACSNTLRASGMDGDDLLEGVDVVSsgVGHIVRRQtEGWA-YIRP    111


hit structure      alignment
FAST alignment (Normalized score: 12.67 Raw score:1688.00)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAARE--MEIEVTIFCAFWGLLLLRDPEKASQED     58
d1l1sa_        1 ---DYRVVFHIDEDDESRVLLLISNVRNLMADLESVRIEVVAYSMGVNVLR---------     48

Query         59 KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP---KLSDLLSGARKKE    115
d1l1sa_       49 --------------------------------------------RDSEYSGDVSELTGQG     64

Query        116 VKFYAXQLSVEIMGFKKEELFPEVQIM--DVKEYLKNALES--DLQLFI--    160
d1l1sa_       65 VRFCACSNTLRASGMDGDDLLEGVDVVSSGVGHIVRRQT--EGWAYI--RP    111


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:95.28)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAARE-M-EIEVTIFCAFWGLLLLRDPEKASQED     58
d1l1sa_        1 ---DYRVVFHIDEDDESRVLLLISNVRNLMADLESVRIEVVAYSMGVNVLRRD-------     50

Query         59 KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKF    118
d1l1sa_       51 --------------S-E----------------------------YSGDVSELTGQGVRF     67

Query        119 YAXQLSVEIMGFKKEELFPEVQIM-D-VKEYLKNAL-ESDLQLFI    160
d1l1sa_       68 CACSNTLRASGMDGDDLLEGVDVVSSGVGHIVRRQTEGWA-YIRP    111


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       **********************  ......*****************             
Query          6 KMNLLLFSGDYDKALASLIIAN--AAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYE     63
d1l1sa_        3 RVVFHIDEDDESRVLLLISNVRNLMADLESVRIEVVAYSMGVNVLRRD------------     50

DALI match                                                *******************
Query         64 QAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYAXQL    123
d1l1sa_       51 --------------------------------------SEYSGDVSELTGQGVRFCACSN     72

DALI match       ******************  ..********...
Query        124 SVEIMGFKKEELFPEVQI--MDVKEYLKNALES    154
d1l1sa_       73 TLRASGMDGDDLLEGVDVVSSGVGHIVRRQTEG    105



top
3: d1o94a2 Trimethylamine dehydrogenase,​ C-​terminal domain (svm: 1.693)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 620
Modified z-scores:
dali:0.96 daliz:0.97 gdtts:0.94 tmscore:0.94 rmsd:0.27 AHM:0.27 LBcontacta:0.93 LBcontactb:0.87 LHM:0.37
id:0.92 blosum:0.82 compass:0.74 pearson:0.96
Scaled scores:
dali:0.78 daliz:0.56 gdtts:0.69 tmscore:0.69 rmsd:0.81 AHM:0.77 LBcontacta:0.59 LBcontactb:0.71 LHM:0.19
id:0.08 blosum:0.15 compass:0.20 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:399.70)
Query          1 -----------------------------------gmeNKKMNLLLFSGDydkaLASLII     25
d1o94a2        1 rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkiGKRVVILNADTY----FMAPSL     56

Query         26 ANAAREMEIEVTIFCAfwGLLLlrdpekasqedkslyeqafssltprEAEELplskmnlg     85
d1o94a2       57 AEKLATAGHEVTIVSG--VHLA------------------------nYMHFT--------     82

Query         86 gigkkmllemmkeekapKLSDLLSGARKKEVKFYAX-------------QLSVEI----m    128
d1o94a2       83 ----------------lEYPNMMRRLHELHVEELGDhfcsriepgrmeiYNIWGDgskrt    126

Query        129 gfkkeelfpevqimDVKEylknalESDLQLFI----    160
d1o94a2      127 yrgpgvsprdantsHRWI------EFDSLVLVtgrh    156


hit structure      alignment
FAST alignment (Normalized score: 4.56 Raw score:720.10)
Query          1 GMEN---------------------------------------KKMNLLLFSGDYDKALA     21
d1o94a2        1 ----RWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKKIGKRVVILNADT----YFM     52

Query         22 SLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSK     81
d1o94a2       53 APSLAEKLATAGHEVTIVSGV---------------------------------------     73

Query         82 MNLGGIGKKMLLEMMKEEKAP----------KLSDLLSGARKKEVKFYAXQLSVEIMGFK    131
d1o94a2       74 ---------------------HLANYMHFTLEYPNMMRRLHELHVEEL------------    100

Query        132 KEELFPEVQIMDVKEYLKNA--------------------------------------LE    153
d1o94a2      101 --------GDHFC-------SRIEPGRMEIYNIWGDGSKRTYRGPGVSPRDANTSHRWIE    145

Query        154 SDLQLFI-----    160
d1o94a2      146 FDSLVL-VTGRH    156


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:68.80)
Query          1 ------------------------------------GMENKKMNLLLFSGDYDKALASLI     24
d1o94a2        1 RWNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKK-KIGKRVVILNAD-TY---FMAPS     55

Query         25 IANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNL     84
d1o94a2       56 LAEKLATAGHEVTIVSG--V-HLA----------------------N-YMHF--------     81

Query         85 GGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYA-X------------QLSVEI-MG-    129
d1o94a2       82 --------T--------LEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDG-SK    124

Query        130 ---------------FKKEELFPEVQIMDVKEYLKNALESDLQLFI---    160
d1o94a2      125 RTYRGPGVSPRDANT-------------SHRW--IE--FDSLVLVTGRH    156


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.01)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1o94a2       51 FMAPSLAEKLATAGHEVTIV     70



top
4: d1ps9a2 2,​4-​dienoyl-​CoA reductase,​ C-​terminal domain (svm: 1.693)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 612
Modified z-scores:
dali:0.95 daliz:0.95 gdtts:0.90 tmscore:0.92 rmsd:0.34 AHM:0.41 LBcontacta:0.89 LBcontactb:0.84 LHM:0.34
id:0.64 blosum:0.27 compass:0.60 pearson:0.90
Scaled scores:
dali:0.75 daliz:0.49 gdtts:0.57 tmscore:0.60 rmsd:0.76 AHM:0.62 LBcontacta:0.47 LBcontactb:0.62 LHM:0.20
id:0.02 blosum:0.06 compass:0.21 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:392.80)
Query          1 -------------------------GMENKKMNLLLfsgdydkALASLIIANAARE----     31
d1ps9a2        1 vprtppidgidhpkvlsyldvlrdkAPVGNKVAIIG------cGGIGFDTAMYLSQpges     54

Query         32 ---------------------------------mEIEVTIFCAFWgLLLLRdpekasqed     58
d1ps9a2       55 tsqniagfcnewgidsslqqagglspqgmqiprsPRQIVMLQRKA-SKPGQ---------    104

Query         59 kslyeqafssltprEAEElplskmnlggigkkmllemmkeekapKLSDLLSGARKKEVKF    118
d1ps9a2      105 --------------GLGK-------------------------tTGWIHRTTLLSRGVKM    125

Query        119 YAXqlsveimgfkkeelfpevqiMDVK-------------eyLKNAleSDLQLFI----    160
d1ps9a2      126 IPG--------------------VSYQkidddglhvvingetQVLA--VDNVVICagqe    162


hit structure      alignment
FAST alignment (Normalized score: 3.59 Raw score:577.30)
Query          1 GMEN-----------------------------KKMNLLLFSGDYDK---ALASLIIANA     28
d1ps9a2        1 ----VPRTPPIDGIDHPKVLSYLDVLRDKAPVGNKVAI---------IGCGGIGFDTAMY     47

Query         29 AREM---------------------------------------EIEVTIFCAFWGLLLLR     49
d1ps9a2       48 LS--QPGESTSQNIAGFCNEWGIDSSLQQAGGLSPQGMQIPRSPRQIVMLQR--------     97

Query         50 DPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP-------    102
d1ps9a2       98 -----------------------------------------------------KASKPGQ    104

Query        103 -----KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA------    151
d1ps9a2      105 GLGKTTGWIHRTTLLSRGVKMI--------------------PGVSY-------QKIDDD    137

Query        152 ------------LESDLQLFI-----    160
d1ps9a2      138 GLHVVINGETQVLAVDNVVI-CAGQE    162


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:44.93)
Query          1 ------------GMENKKMNLL----------------LFSGD--YDKALASLII-----     25
d1ps9a2        1 VPRTPPIDGIDH-----PKVLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGEST     55

Query         26 ---------------------------------ANAAREMEIEVTIFCAFWGLLLLRDPE     52
d1ps9a2       56 SQNIAGFCNEWGIDSSLQQAGGLSPQGMQIPRS-PRQI-------V-M---LQR------     97

Query         53 KASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSD------    106
d1ps9a2       98 -----------------KAS---KPGQG--LGK-TTGWIHRTTLL--SRGVKMIPGVSYQ    132

Query        107 ---LLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQ--IMDVKEYLKNALESDLQLFI-    160
d1ps9a2      133 KID--------DDGLHV-----------VINGETQVLAV-------------D-NVVICA    159

Query        161 ---    161
d1ps9a2      160 GQE    162


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.34)
DALI match       ************       
Query         20 LASLIIANAAREMEIEVTI     38
d1ps9a2       39 GIGFDTAMYLSQPGESTSQ     57



top
5: d3grsa2 Glutathione reductase (svm: 1.631)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 559
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.87 tmscore:0.90 rmsd:0.36 AHM:0.38 LBcontacta:0.86 LBcontactb:0.87 LHM:0.33
id:0.71 blosum:0.50 compass:0.77 pearson:0.94
Scaled scores:
dali:0.76 daliz:0.48 gdtts:0.54 tmscore:0.57 rmsd:0.76 AHM:0.67 LBcontacta:0.47 LBcontactb:0.69 LHM:0.20
id:0.01 blosum:0.09 compass:0.29 pearson:0.29

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:360.20)
Query          1 ------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCaf     42
d3grsa2        1 sqipgaslgitsdgffqlEELPGRSVIVG------aGYIAVEMAGILSALGSKTSLMI--     52

Query         43 wGLLLlrdpekasqedkslyeqafssltpreAEELPlskmnlggigkkmllemmkeekap    102
d3grsa2       53 -RHDK-------------------------vLRSFD----------------------sm     64

Query        103 KLSDLLSGARKKEVKFYAX-----------------QLSVeiMGFKkeelfpevqimDVK    145
d3grsa2       65 ISTNCTEELENAGVEVLKFsqvkevkktlsglevsmVTAV--PGRL---------pvMTM    113

Query        146 EylknaLESDLQLFI--    160
d3grsa2      114 I-----PDVDCLLWAig    125


hit structure      alignment
FAST alignment (Normalized score: 4.22 Raw score:596.80)
Query          1 GMEN----------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIE     35
d3grsa2        1 ----SQIPGASLGITSDGFFQLEELPGRSVI---------VGAGYIAVEMAGILSALGSK     47

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM     95
d3grsa2       48 TSLMIR------------------------------------------------------     53

Query         96 MKEEKAP-----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDV    144
d3grsa2       54 -------HDKVLRSFDSMISTNCTEELENAGVEVL--------------------KFSQ-     85

Query        145 KEYLKN----------------------------ALESDLQLFI---    160
d3grsa2       86 ------VKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLW-AIG    125


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:65.59)
Query          1 -------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCA     41
d3grsa2        1 SQIPGASLGITSDGFFQLEEL-PGRSVIVG------AGYIAVEMAGILSALGSKTSLMIR     53

Query         42 FWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGG--IGKKMLLEMMKEE     99
d3grsa2       54 ---HDKV-------------------------L--RSF------DSM-------------     64

Query        100 KAPKLSDLLSGARKKEVKFYA-X-----------------QLSVEIMGFKKEELFPEVQI    141
d3grsa2       65 ---ISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTA-VP--G-R---------L    108

Query        142 MDVKEYLKNALESDLQLF-I-    160
d3grsa2      109 PV-MT--MI-PDVDCLLWAIG    125


hit structure      alignment
HHsearch alignment (Probability: 0.20 E-value:0.00)
DALI match       *********************.                                      
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d3grsa2       32 YIAVEMAGILSALGSKTSLMIRH-----------------------------------DK     56

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d3grsa2       57 VLRSFDSMISTNCTEELENAGV     78



hit structures. 
top
6: d1ebda2 Dihydrolipoamide dehydrogenase (svm: 1.615)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.48  Contact: 575
Modified z-scores:
dali:0.93 daliz:0.93 gdtts:0.89 tmscore:0.90 rmsd:0.35 AHM:0.40 LBcontacta:0.86 LBcontactb:0.85 LHM:0.28
id:0.95 blosum:0.89 compass:0.71 pearson:0.93
Scaled scores:
dali:0.76 daliz:0.49 gdtts:0.58 tmscore:0.58 rmsd:0.76 AHM:0.65 LBcontacta:0.48 LBcontactb:0.67 LHM:0.27
id:0.11 blosum:0.18 compass:0.22 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:359.30)
Query          1 ------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAf     42
d1ebda2        1 pnfkfsnrildstgalnlGEVPKSLVVIG------gGYIGIELGTAYANFGTKVTILEG-     53

Query         43 wgLLLLrdpekasqedkslyeqafssltpreAEELplskmnlggigkkmllemmkeekap    102
d1ebda2       54 --AGEI-----------------------lsGFEK------------------------q     64

Query        103 KLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqIMDVK----------------e    146
d1ebda2       65 MAAIIKKRLKKKGVEVVTN-------------------ALAKGaeeredgvtvtyeange    105

Query        147 yLKNAleSDLQLFI    160
d1ebda2      106 tKTID--ADYVLVT    117


hit structure      alignment
FAST alignment (Normalized score: 4.53 Raw score:620.00)
Query          1 GMEN----------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIE     35
d1ebda2        1 ----PNFKFSNRILDSTGALNLGEVPKSLVV---------IGGGYIGIELGTAYANFGTK     47

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM     95
d1ebda2       48 VTILEGA-----------------------------------------------------     54

Query         96 MKEEKAP----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVK    145
d1ebda2       55 -------GEILSGFEKQMAAIIKKRLKKKGVEVV--------------------TNALA-     86

Query        146 EYLKNA----------------------LESDLQLFI--    160
d1ebda2       87 ------KGAEEREDGVTVTYEANGETKTIDADYVL--VT    117


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.45)
Query          1 -------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCA     41
d1ebda2        1 PNFKFSNRILDSTGALNLGEV-PKSLVVIG------GGYIGIELGTAYANFGTKVTILEG     53

Query         42 FWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL-PLSKMNLGGIGKKMLLEMMKEEK    100
d1ebda2       54 -A-GEIL----------------------S--GFEKQ-----------------------     64

Query        101 APKLSDLLS-GARKKEVKFYAXQL---------------SVEIMGFKKEELFPEVQIM-D    143
d1ebda2       65 ---MAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTY-----------------EANG    104

Query        144 VKEYLKNALESDLQLFI    160
d1ebda2      105 ETK--TI--DADYVLVT    117


hit structure      alignment
HHsearch alignment (Probability: 0.18 E-value:0.00)
DALI match       ******************                                          
Query         22 SLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSK     81
d1ebda2       34 GIELGTAYANFGTKVTIL-----------------------------------EGAGEIL     58

DALI match                           
Query         82 MNLGGIGKKMLLEMMKEEKA    101
d1ebda2       59 SGFEKQMAAIIKKRLKKKGV     78



top
7: d1lvla2 Dihydrolipoamide dehydrogenase (svm: 1.528)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 550
Modified z-scores:
dali:0.93 daliz:0.93 gdtts:0.91 tmscore:0.91 rmsd:0.32 AHM:0.38 LBcontacta:0.88 LBcontactb:0.87 LHM:0.35
id:0.81 blosum:0.82 compass:0.74 pearson:0.94
Scaled scores:
dali:0.77 daliz:0.50 gdtts:0.63 tmscore:0.62 rmsd:0.78 AHM:0.69 LBcontacta:0.50 LBcontactb:0.71 LHM:0.21
id:0.04 blosum:0.15 compass:0.24 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:353.40)
Query          1 -----------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfw     43
d1lvla2        1 mlplggpvisstealapKALPQHLVVVG------gGYIGLELGIAYRKLGAQVSVVEA--     52

Query         44 gLLLLrdpekasqedkslyeqafssltprEAEElplskmnlggigkkmllemmkeekapK    103
d1lvla2       53 -RERI-----------------------lPTYD------------------------seL     64

Query        104 LSDLLSGARKKEVKFYAX------------qLSVEImgfkkeelfpevqimdvkeyLKNA    151
d1lvla2       65 TAPVAESLKKLGIALHLGhsvegyengcllaNDGKG------------------gqLRLE    106

Query        152 leSDLQLFI--    160
d1lvla2      107 --ADRVLVAvg    115


hit structure      alignment
FAST alignment (Normalized score: 4.50 Raw score:610.50)
Query          1 GMEN---------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIEV     36
d1lvla2        1 ----MLPLGGPVISSTEALAPKALPQHLVV---------VGGGYIGLELGIAYRKLGAQV     47

Query         37 TIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMM     96
d1lvla2       48 SVVEA-------------------------------------------------------     52

Query         97 KEEKAP-----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVK    145
d1lvla2       53 ------RERILPTYDSELTAPVAESLKKLGIALH--------------------LGHSV-     85

Query        146 EYLKNA-------------------LESDLQLFI----    160
d1lvla2       86 ------EGYENGCLLANDGKGGQLRLEADRVL--VAVG    115


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:63.78)
Query          1 ------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1lvla2        1 MLPLGGPVISSTEALAPKAL-PQHLVVVG------GGYIGLELGIAYRKLGAQVSVVEA-     52

Query         43 WGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP    102
d1lvla2       53 -RERILP--------------------TYDSEL---------------------------     64

Query        103 KLSDLLSGARKKEVKFYA-X-------------QLSVEIMGFKKEELFPEVQIMDVKEYL    148
d1lvla2       65 -TAPVAESLKKLGIALHLGHSVEGYENGCLLANDG--K--------------GGQ--L--    103

Query        149 KNALESDLQLFI-    160
d1lvla2      104 RL-EADRVLVAVG    115


hit structure      alignment
HHsearch alignment (Probability: 0.19 E-value:0.00)
DALI match       ********************                                        
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1lvla2       31 YIGLELGIAYRKLGAQVSVV-----------------------------------EARER     55

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d1lvla2       56 ILPTYDSELTAPVAESLKKLGI     77



top
8: d1onfa2 Glutathione reductase (svm: 1.673)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.54  Contact: 539
Modified z-scores:
dali:0.92 daliz:0.91 gdtts:0.89 tmscore:0.90 rmsd:0.36 AHM:0.38 LBcontacta:0.87 LBcontactb:0.87 LHM:0.25
id:0.95 blosum:0.96 compass:0.81 pearson:0.95
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.58 tmscore:0.57 rmsd:0.76 AHM:0.67 LBcontacta:0.46 LBcontactb:0.67 LHM:0.28
id:0.10 blosum:0.23 compass:0.31 pearson:0.31

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:336.20)
Query          1 ------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAf     42
d1onfa2        1 fppvkgientissdeffnIKESKKIGIVG------sGYIAVELINVIKRLGIDSYIFAR-     53

Query         43 wgLLLLrdpekasqedkslyeqafssltprEAEELplskmnlggigkkmllemmkeekap    102
d1onfa2       54 --GNRI-----------------------lRKFDE------------------------s     64

Query        103 KLSDLLSGARKKEVKFY--AXQLsveimgfkkeelfpevqiMDVKEYLknaLESDLQLF-    159
d1onfa2       65 VINVLENDMKKNNINIVtfADVV-----eikkvsdknlsihLSDGRIY---EHFDHVIYc    116

Query        160 i    160
d1onfa2      117 v    117


hit structure      alignment
FAST alignment (Normalized score: 4.62 Raw score:632.20)
Query          1 -----------------GMEN-KKMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIF     39
d1onfa2        1 FPPVKGIENTISSDEFFNIKESKKIGI---------VGSGYIAVELINVIKRLGIDSYIF     51

Query         40 CAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEE     99
d1onfa2       52 AR----------------------------------------------------------     53

Query        100 KAP-----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYL    148
d1onfa2       54 ---GNRILRKFDESVINVLENDMKKNNINIV--------------------TFADV----     86

Query        149 KN--------------------ALESDLQLFI---    160
d1onfa2       87 --VEIKKVSDKNLSIHLSDGRIYEHFDHVI--YCV    117


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:61.66)
Query          1 -------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCA     41
d1onfa2        1 FPPVKGIENTISSDEFFNIKE-SKKIGIVG-S-----GYIAVELINVIKRLGIDSYIFAR     53

Query         42 FWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL-PLSKMNLGGIGKKMLLEMMKEEK    100
d1onfa2       54 ---GNRIL---------------------R--KFDES-----------------------     64

Query        101 APKLS-DLLSGARKKEVKFYAXQLS------------VEIMGFKKEELFPEVQIMDV--K    145
d1onfa2       65 ---VINVLENDMKKNNINIVTFADVVEIKKVSDKNLS-----------------IHLSDG    104

Query        146 EYLKNALESDLQLFI-    160
d1onfa2      105 RI-YE--HFDHVIYCV    117


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.01)
DALI match       **********************.  ...                                
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1onfa2       32 YIAVELINVIKRLGIDSYIFARGNRILR--------------------------------     59

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d1onfa2       60 ---KFDESVINVLENDMKKNNI     78



top
9: d1h6va2 Mammalian thioredoxin reductase (svm: 1.632)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.51  Contact: 537
Modified z-scores:
dali:0.92 daliz:0.93 gdtts:0.91 tmscore:0.91 rmsd:0.34 AHM:0.36 LBcontacta:0.85 LBcontactb:0.85 LHM:0.38
id:0.89 blosum:0.85 compass:0.78 pearson:0.95
Scaled scores:
dali:0.78 daliz:0.51 gdtts:0.63 tmscore:0.63 rmsd:0.77 AHM:0.69 LBcontacta:0.49 LBcontactb:0.68 LHM:0.17
id:0.07 blosum:0.16 compass:0.29 pearson:0.32

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:352.20)
Query          1 ----------------gmENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCafwG     44
d1h6va2        1 pgdkeycissddlfslpyCPGKTLVVG------aSYVALECAGFLAGIGLDVTVMV---R     51

Query         45 LLLlrdpekasqedkslyeqafssltpreAEELPlskmnlggigkkmllemmkeekapKL    104
d1h6va2       52 SIL--------------------------LRGFD----------------------qdMA     63

Query        105 SDLLSGARKKEVKFYAX--------------------qLSVEImgfkkeelfpevqimDV    144
d1h6va2       64 NKIGEHMEEHGIKFIRQfvptkieqieagtpgrlkvtaKSTNS--------------eET    109

Query        145 KEylknaLESDLQLFI--    160
d1h6va2      110 IE-----DEFNTVLLAvg    122


hit structure      alignment
FAST alignment (Normalized score: 4.15 Raw score:579.90)
Query          1 GMEN--------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIEVT     37
d1h6va2        1 ----PGDKEYCISSDDLFSLPYCPGKTLV---------VGASYVALECAGFLAGIGLDVT     47

Query         38 IFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMK     97
d1h6va2       48 VMVRS-------------------------------------------------------     52

Query         98 EEKAP---------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYL    148
d1h6va2       53 -----ILLRGFDQDMANKIGEHMEEHGIKFI--------------------RQFV-----     82

Query        149 KN----------------------------ALESDLQLFI----    160
d1h6va2       83 --PTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFNTVL--LAVG    122


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:63.69)
Query          1 -----------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFW     43
d1h6va2        1 PGDKEYCISSDDLFSLPYC-PGKTLVVG------ASYVALECAGFLAGIGLDVTVMVR--     51

Query         44 GLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKK--MLLEMMKEEKA    101
d1h6va2       52 -SIL--------------------------L--RG----------FDQD-----------     61

Query        102 PKLSDLLSGARKKEVKFYA-X--------------------QLSVEIMGFKKEELFPEVQ    140
d1h6va2       62 -MANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKST-NS-------------    106

Query        141 IMDVKEYLKNALESDLQLF-I-    160
d1h6va2      107 -EE-TIE--D--EFNTVLLAVG    122


hit structure      alignment
HHsearch alignment (Probability: 0.18 E-value:0.01)
DALI match       *********************.  ...                                 
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1h6va2       30 YVALECAGFLAGIGLDVTVMVRSILLR---------------------------------     56

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d1h6va2       57 ---GFDQDMANKIGEHMEEHGI     75



top
10: d3lada2 Dihydrolipoamide dehydrogenase (svm: 1.585)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.48  Contact: 560
Modified z-scores:
dali:0.93 daliz:0.93 gdtts:0.89 tmscore:0.90 rmsd:0.38 AHM:0.46 LBcontacta:0.88 LBcontactb:0.89 LHM:0.25
id:0.91 blosum:0.82 compass:0.69 pearson:0.93
Scaled scores:
dali:0.76 daliz:0.48 gdtts:0.58 tmscore:0.57 rmsd:0.75 AHM:0.64 LBcontacta:0.48 LBcontactb:0.71 LHM:0.32
id:0.07 blosum:0.15 compass:0.22 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:346.00)
Query          1 ------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAf     42
d3lada2        1 papvdqdvivdstgaldfQNVPGKLGVIG------aGVIGLELGSVWARLGAEVTVLEA-     53

Query         43 wGLLLlrdpekasqedkslyeqafssltpreAEELPlskmnlggigkkmllemmkeekap    102
d3lada2       54 -MDKF--------------------------LPAVD----------------------eq     64

Query        103 KLSDLLSGARKKEVKFY--AXQLsveimgfkkeelfpevqiMDVKeyLKNAlESDLQLFI    160
d3lada2       65 VAKEAQKILTKQGLKILlgARVT------gtevknkqvtvkFVDAegEKSQ-AFDKLIVA    117

Query        161 --    161
d3lada2      118 vg    119


hit structure      alignment
FAST alignment (Normalized score: 4.17 Raw score:574.80)
Query          1 GMEN----------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIE     35
d3lada2        1 ----PAPVDQDVIVDSTGALDFQNVPGKLGV---------IGAGVIGLELGSVWARLGAE     47

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM     95
d3lada2       48 VTVLEA------------------------------------------------------     53

Query         96 MKEEKAP-----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDV    144
d3lada2       54 -------MDKFLPAVDEQVAKEAQKILTKQGLKIL--------------------LGAR-     85

Query        145 KEYLKN----------------------ALESDLQLFI----    160
d3lada2       86 ------VTGTEVKNKQVTVKFVDAEGEKSQAFDKLI--VAVG    119


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.92)
Query          1 -------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCA     41
d3lada2        1 PAPVDQDVIVDSTGALDFQNV-PGKLGVIG------AGVIGLELGSVWARLGAEVTVLEA     53

Query         42 FWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL-PLSKMNLGGIGKKMLLEMMKEEK    100
d3lada2       54 M--DKFL----------------------P--AVDEQ-----------------------     64

Query        101 APKLS-DLLSGARKKEVKFYAXQL---------------SVEIMGFKKEELFPEVQIMDV    144
d3lada2       65 ---VAKEAQKILTKQGLKILLGARVTGTEVKNKQVTVKF-----------------VDAE    104

Query        145 KEYLKNALESDLQLF-I-    160
d3lada2      105 GE--KS-QAFDKLIVAVG    119


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.01)
DALI match       **********************. ....                                
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d3lada2       32 VIGLELGSVWARLGAEVTVLEAMDKFLP--------------------------------     59

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d3lada2       60 ---AVDEQVAKEAQKILTKQGL     78



hit structures. 
top
11: d1jeha2 Dihydrolipoamide dehydrogenase (svm: 1.618)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 569
Modified z-scores:
dali:0.93 daliz:0.93 gdtts:0.89 tmscore:0.90 rmsd:0.38 AHM:0.45 LBcontacta:0.87 LBcontactb:0.87 LHM:0.40
id:0.78 blosum:0.76 compass:0.70 pearson:0.93
Scaled scores:
dali:0.76 daliz:0.49 gdtts:0.57 tmscore:0.59 rmsd:0.75 AHM:0.64 LBcontacta:0.49 LBcontactb:0.70 LHM:0.13
id:0.03 blosum:0.13 compass:0.22 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:346.10)
Query          1 -------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCA     41
d1jeha2        1 pgieideekivsstgalslKEIPKRLTIIG------gGIIGLEMGSVYSRLGSKVTVVEF     54

Query         42 fwgLLLLrdpekasqedkslyeqafssltprEAEElplskmnlggigkkmllemmkeeka    101
d1jeha2       55 ---QPQI-----------------------gASMD------------------------g     64

Query        102 pKLSDLLSGARKKEVKFYAX------------------qLSVEIMgfkkeelfpevqimd    143
d1jeha2       65 eVAKATQKFLKKQGLDFKLStkvisakrnddknvveivvEDTKTN--------------k    110

Query        144 VKEYlknalESDLQLFI    160
d1jeha2      111 QENL-----EAEVLLVA    122


hit structure      alignment
FAST alignment (Normalized score: 4.16 Raw score:581.50)
Query          1 GMEN-----------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEI     34
d1jeha2        1 ----PGIEIDEEKIVSSTGALSLKEIPKRLTI---------IGGGIIGLEMGSVYSRLGS     47

Query         35 EVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLE     94
d1jeha2       48 KVTVVEF-----------------------------------------------------     54

Query         95 MMKEEKAP-----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMD    143
d1jeha2       55 --------QPQIGASMDGEVAKATQKFLKKQGLDFK--------------------LSTK     86

Query        144 VKEYLKNA---------------------------LESDLQLFI--    160
d1jeha2       87 --------VISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLL--VA    122


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:64.16)
Query          1 --------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFC     40
d1jeha2        1 PGIEIDEEKIVSSTGALSLKEI-PKRLTIIG-G-----GIIGLEMGSVYSRLGSKVTVVE     53

Query         41 AFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL-PLSKMNLGGIGKKMLLEMMKEE     99
d1jeha2       54 F--QPQIG----------------------A--SMDGE----------------------     65

Query        100 KAPKLSDLLSGARKKEVKFYA-X-------------------QLSVEIMGFKKEELFPEV    139
d1jeha2       66 ---VAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDT--K-------------    107

Query        140 QIMDVKEYLKNALESDLQLFI    160
d1jeha2      108 -TNK-QE--NL--EAEVLLVA    122


hit structure      alignment
HHsearch alignment (Probability: 0.17 E-value:0.00)
DALI match       **********************.  ...                                
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1jeha2       33 IIGLEMGSVYSRLGSKVTVVEFQPQIGA--------------------------------     60

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d1jeha2       61 ---SMDGEVAKATQKFLKKQGL     79



top
12: d1q1ra2 Putidaredoxin reductase (svm: 1.526)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.38  Contact: 540
Modified z-scores:
dali:0.92 daliz:0.94 gdtts:0.87 tmscore:0.89 rmsd:0.31 AHM:0.26 LBcontacta:0.90 LBcontactb:0.88 LHM:0.19
id:0.87 blosum:0.78 compass:0.82 pearson:0.94
Scaled scores:
dali:0.79 daliz:0.55 gdtts:0.61 tmscore:0.63 rmsd:0.78 AHM:0.76 LBcontacta:0.56 LBcontactb:0.78 LHM:0.37
id:0.07 blosum:0.13 compass:0.29 pearson:0.31

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:383.50)
Query          1 -------------------------------gMENKKMNLLLfsgdydkALASLIIANAA     29
d1q1ra2        1 rplpvasgavgkannfrylrtledaecirrqlIADNRLVVIG------gGYIGLEVAATA     54

Query         30 REMEIEVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreAEELPlskmnlggigk     89
d1q1ra2       55 IKANMHVTLLDT---AARV------------------------lERVTA-----------     76

Query         90 kmllemmkeekapklSDLLSGARKKEVKFY--AXQLsveimgfkkeelfpevqiMDVKey    147
d1q1ra2       77 -----------ppvsAFYEHLHREAGVDIRtgTQVC---gfemstdqqkvtavlCEDG--    120

Query        148 LKNAleSDLQLFI--    160
d1q1ra2      121 TRLP--ADLVIAGig    133


hit structure      alignment
FAST alignment (Normalized score: 4.48 Raw score:653.70)
Query          1 -------------------------------GMENKKMNLLLFSGDYDK---ALASLIIA     26
d1q1ra2        1 RPLPVASGAVGKANNFRYLRTLEDAECIRRQLIADNRLVV---------IGGGYIGLEVA     51

Query         27 NAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGG     86
d1q1ra2       52 ATAIKANMHVTLLD----------------------------------------------     65

Query         87 IGKKMLLEMMKEEKAP-------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKE    133
d1q1ra2       66 ----------------TAARVLERVTAPPVSAFYEHLHREAGVDIR--------------     95

Query        134 ELFPEVQIMDVKEYLKNA----------------------LESDLQLFI----    160
d1q1ra2       96 ------TGTQV-------CGFEMSTDQQKVTAVLCEDGTRLPADLVI--AGIG    133


hit structure      alignment
TMalign alignment (TM-score: 0.32 Raw score:51.98)
Query          1 --------------------------------GMENKKMNLLLFSGDYDKALASLIIANA     28
d1q1ra2        1 RPLPVASGAVGKANNFRYLRTLEDAECIRRQL---IADNRLVVIGGG-YIGLEVAATAIK     56

Query         29 AREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIG     88
d1q1ra2       57 AN-----MHVTL---LDT-----------------------AA----RVLE---R--V--     74

Query         89 KK--MLL--EMMKEEKAPKLSDLLSGARKKEV-KF--YA----------------XQLSV    125
d1q1ra2       75 TAPP--VSA--------FYEHLHREAGV---DI-RTG-TQVCGFEMSTDQQKVTAVLCED    119

Query        126 EIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI---    160
d1q1ra2      120 G--------------TRL--PA---D-----LVIAGIG    133


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.02)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1q1ra2       45 YIGLEVAATAIKANMHVTLL     64



top
13: d1mo9a2 NADH-​dependent 2-​ketopropyl coenzyme M oxidoreductase/​carboxylase (svm: 1.632)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.55  Contact: 553
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.89 tmscore:0.90 rmsd:0.34 AHM:0.40 LBcontacta:0.85 LBcontactb:0.84 LHM:0.31
id:0.45 blosum:0.35 compass:0.76 pearson:0.95
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.58 tmscore:0.58 rmsd:0.76 AHM:0.66 LBcontacta:0.46 LBcontactb:0.66 LHM:0.27
id:-0.02 blosum:0.06 compass:0.20 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:324.40)
Query          1 ------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAf     42
d1mo9a2        1 gvnakgvfdhatlveeldYEPGSTVVVVG------gSKTAVEYGCFFNATGRRTVMLVR-     53

Query         43 wgLLLLrdpekasqedkslyeqafssltprEAEElplskmnlggigkkmllemmkeekap    102
d1mo9a2       54 --TEPL------------------------KLIK-----------------------dne     64

Query        103 KLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqiMDVKeYLKNalESDLQLFI--    160
d1mo9a2       65 TRAYVLDRMKEQGMEIISGsnvtrieedangrvqavvamTPNG-EMRI--ETDFVFLGlg    121


hit structure      alignment
FAST alignment (Normalized score: 4.25 Raw score:591.30)
Query          1 GMEN----------------------KKMNLLLFSGDYDK---ALASLIIANAAREMEIE     35
d1mo9a2        1 ----GVNAKGVFDHATLVEELDYEPGSTVVV---------VGGSKTAVEYGCFFNATGRR     47

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM     95
d1mo9a2       48 TVMLVRT-----------------------------------------------------     54

Query         96 MKEEKAP----------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVK    145
d1mo9a2       55 -------EPLKLIKDNETRAYVLDRMKEQGMEII--------------------SGSN--     85

Query        146 EYLKNA-------------------------LESDLQLFI----    160
d1mo9a2       86 ------VTRIEEDANGRVQAVVAMTPNGEMRIETDFVF--LGLG    121


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:61.52)
Query          1 ------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1mo9a2        1 GVNAKGVFDHATLVEELDYEPGSTVVVVG-G-----SKTAVEYGCFFNATGRRTVMLVR-     53

Query         43 WGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEE---LPLSKMNLGGIGKKMLLEMMKEE     99
d1mo9a2       54 --TEPL------------------------KLIKDNE-----------------------     64

Query        100 KAPKLS-DLLSGARKKEVKFYAXQL------------------SVEIMGFKKEELFPEVQ    140
d1mo9a2       65 ----TRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVVAM----------------T    104

Query        141 IMDVKEYLKNALESDLQLF-I-    160
d1mo9a2      105 PNG-EM--RI--ETDFVFLGLG    121


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.01)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1mo9a2       32 KTAVEYGCFFNATGRRTVML     51



top
14: d1trba2 Thioredoxin reductase (svm: 1.691)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 501
Modified z-scores:
dali:0.89 daliz:0.93 gdtts:0.90 tmscore:0.89 rmsd:0.26 AHM:0.27 LBcontacta:0.88 LBcontactb:0.83 LHM:0.18
id:0.72 blosum:0.46 compass:0.62 pearson:0.83
Scaled scores:
dali:0.79 daliz:0.55 gdtts:0.71 tmscore:0.68 rmsd:0.82 AHM:0.73 LBcontacta:0.60 LBcontactb:0.75 LHM:0.37
id:0.03 blosum:0.05 compass:0.17 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:338.20)
Query          1 -----------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVT     37
d1trba2        1 lglpseeafkgrgvsacatsdgfFYRNQKVAVIG------gGNTAVEEALYLSNIASEVH     54

Query         38 IFCAfwgLLLLrdpekasqedkslyeqafssltpreaeelplskmnlggigkkmllemmk     97
d1trba2       55 LIHR---RDGF-------------------------------------------------     62

Query         98 eekapkLSDLLSGARKKE----VKFYAX------------------QLSVEImgfkkeel    135
d1trba2       63 ----raEKILIKRLMDKVengnIILHTNrtleevtgdqmgvtgvrlRDTQNS--------    110

Query        136 fpevqimDVKEylknaLESDLQLFI--    160
d1trba2      111 ------dNIES-----LDVAGLFVAig    126


hit structure      alignment
FAST alignment (Normalized score: 3.82 Raw score:542.20)
Query          1 -----------------------GMENKKMNLLLFSGDYDKALASLIIANAAREME--IE     35
d1trba2        1 LGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGG------GNTAVEEALYLSN--IASE     52

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM     95
d1trba2       53 VHLIHR------------------------------------------------------     58

Query         96 MKEEKAPK------LSDLLSGARKK-----EVKFYAXQLSVEIMGFKKEELFPEVQIMDV    144
d1trba2       59 --------RDGFRAEKILIKRLMD-KVENGNIILH--------------------TNRTL     89

Query        145 KEYLKNA--------------------------LESDLQLFI----    160
d1trba2       90 -------EEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLF--VAIG    126


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:63.43)
Query          1 ----------------------G-MENKKMNLLLFSGDYDKALASLIIANAAREMEIEVT     37
d1trba2        1 LGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIG-G----G-NTAVEEALYLSNIASEVH     54

Query         38 IFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMK     97
d1trba2       55 LIHR--RDGF-----------------------------R-A-------------E----     65

Query         98 EEKAPKLSDLLSGAR-KKEVKFYA-X-----------------QLSVEIMGFKKEELFPE    138
d1trba2       66 ----KILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNS-----------    110

Query        139 VQIMDVKEYLKNALESDLQLFI-    160
d1trba2      111 ---DN-IE--SLD-VAGLFVAIG    126


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.05)
DALI match       **********************.  ....                               
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1trba2       37 NTAVEEALYLSNIASEVHLIHRRDGFRAEKI-----------------------------     67

DALI match                               ............****
Query         80 SKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFY    119
d1trba2       68 -----------------------LIKRLMDKVENGNIILH     84



top
15: d1qx4a2 cytochrome b5 reductase (svm: 1.285)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.41  Contact: 663
Modified z-scores:
dali:0.93 daliz:0.92 gdtts:0.92 tmscore:0.92 rmsd:0.33 AHM:0.30 LBcontacta:0.88 LBcontactb:0.89 LHM:0.19
id:0.92 blosum:0.73 compass:0.57 pearson:0.89
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.61 tmscore:0.62 rmsd:0.76 AHM:0.71 LBcontacta:0.46 LBcontactb:0.70 LHM:0.35
id:0.07 blosum:0.13 compass:0.21 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:387.00)
Query          1 --------------gmeNKKMNLLLFSGdydkALASLIIANAARE---MEIEVTIFCAF-     42
d1qx4a2        1 gkfairadkksnpvvrtVKSVGMIAGGT---gITPMLQVIRAVLKdpnDHTVCYLLFANq     57

Query         43 --wgLLLLrdpekasqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeek    100
d1qx4a2       58 sekdILLR----------------------------------------------------     65

Query        101 apklSDLLSGARKKE--VKFYAXqlSVEIMGFKKeelfpevqiMDVKEYLK-NALE--sD    155
d1qx4a2       66 ----PELEELRNEHSsrFKLWYT--VDKAPDAWD----ysqgfVNEEMIRDhLPPPgeeT    115

Query        156 LQLFI---------------------------    160
d1qx4a2      116 LILMCgpppmiqfaclpnlervghpkercftf    147


hit structure      alignment
FAST alignment (Normalized score: 3.31 Raw score:506.80)
Query          1 GMEN------------------KKMNLLLFSGDYDKALASLIIANAARE---MEIEVTIF     39
d1qx4a2        1 ----GKFAIRADKKSNPVVRTVKSVGMIAG---GTGITPMLQVIRAVLKDPNDHTVCYLL     53

Query         40 CAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEE     99
d1qx4a2       54 F-----------------------------------------------------------     54

Query        100 KAPK----------LSDLLSGARKK---EVKFYAXQLSVEIMGFKKEELFPEVQIMDVKE    146
d1qx4a2       55 ----ANQSEKDILLRPELEELRNE-HSSRFKLWYT-------------------------     84

Query        147 ---------------YLKNALES---------DLQLFI----------------------    160
d1qx4a2       85 VDKAPDAWDYSQGFVNEEMIR--DHLPPPGEETLIL--MCGPPPMIQFACLPNLERVGHP    140

Query        161 -------    161
d1qx4a2      141 KERCFTF    147


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:70.04)
Query          1 GM--------------ENKKMNLLLFSGDYDKALASLIIANAAR-E--MEIEVTIFCAFW     43
d1qx4a2        1 GKFAIRADKKSNPVVRTVKSVGMIAG-GT--GITPMLQVIRAVLKDPNDHTVCYLLFA-N     56

Query         44 GLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK    103
d1qx4a2       57 -QS--E--------------------KD-ILL----------------------------     64

Query        104 LSDLLSGARKKE--VKFYAXQLSVEIMGF-KKEELFPEVQIM---DVKEYLK--NALE-S    154
d1qx4a2       65 RPELEELRNEHSSRFKLWYT---V-DKAPDAWD------YSQGFVNEEMIRDHLPPPGEE    114

Query        155 DLQLFI---------------------------    160
d1qx4a2      115 TLILMCGPPPMIQFACLPNLERVGHPKERCFTF    147


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.94)
DALI match                                               
Query          3 ENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1qx4a2       46 DHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTV     85



hit structures. 
top
16: d1h7wa3 Dihydropyrimidine dehydrogenase,​ domain 3 (svm: 1.698)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 500
Modified z-scores:
dali:0.90 daliz:0.94 gdtts:0.90 tmscore:0.89 rmsd:0.32 AHM:0.42 LBcontacta:0.90 LBcontactb:0.86 LHM:0.25
id:0.78 blosum:0.76 compass:0.77 pearson:0.87
Scaled scores:
dali:0.80 daliz:0.57 gdtts:0.69 tmscore:0.66 rmsd:0.76 AHM:0.62 LBcontacta:0.62 LBcontactb:0.80 LHM:0.26
id:0.05 blosum:0.14 compass:0.25 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:358.40)
Query          1 -----------------------------------------GMENKKMNLLLfsgdydkA     19
d1h7wa3        1 pktddifqgltqdqgfytskdflplvaksskagmcachsplPSIRGAVIVLG------aG     54

Query         20 LASLIIANAAREMEI-EVTIFCAFWgLLLLrdpekasqedkslyeqafssltpreaeelp     78
d1h7wa3       55 DTAFDCATSALRCGArRVFLVFRKG-FVNI------------------------------     83

Query         79 lskmnlggigkkmllemmkeekapkLSDLLSGARKKEVKFYAX-----------------    121
d1h7wa3       84 -----------------------raVPEEVELAKEEKCEFLPFlsprkvivkggrivavq    120

Query        122 -qLSVE----IMGFkkeelfpevqimdvkeyLKNAleSDLQLF---i    160
d1h7wa3      121 fvRTEQdetgKWNE------------dedqiVHLK--ADVVISafgs    153


hit structure      alignment
FAST alignment (Normalized score: 3.86 Raw score:603.80)
Query          1 GME--------------------------------------------NKKMNLLLFSGDY     16
d1h7wa3        1 ---PKTDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMCACHSPLPSIRGAVIV-------     50

Query         17 DK---ALASLIIANAAREME-IEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPR     72
d1h7wa3       51 --LGAGDTAFDCATSALRCGARRVFLVFR-------------------------------     77

Query         73 EAEELPLSKMNLGGIGKKMLLEMMKEEKAPK--------LSDLLSGARKKEVKFYAXQLS    124
d1h7wa3       78 -------------------------------KGFVNIRAVPEEVELAKEEKCEFL-----    101

Query        125 VEIMGFKKEELFPEVQIMDVKEYLKNA---------------------------------    151
d1h7wa3      102 ---------------PFLSP-------RKVIVKGGRIVAVQFVRTEQDETGKWNEDEDQI    139

Query        152 --LESDLQLFI-----    160
d1h7wa3      140 VHLKADVVI--SAFGS    153


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:47.57)
Query          1 ------------GMENKKMNLLL------------------------------FSGDYDK     18
d1h7wa3        1 PKTDDIFQGLTQ----DQGFYTSKDFLPLVAKSSKAGMCACHSPLPSIRGAVIVLGAGDT     56

Query         19 ALASLIIAN-AAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL     77
d1h7wa3       57 AFDCATSALRCGAR-R--V-F-----L-VFR----------------------KGF-VNI     83

Query         78 PLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSG--------------ARKKEVKFYAX--    121
d1h7wa3       84 RA---------VPEEV--E----LAKEEKCEFLPFLSPRKVIVKGGR----IVAVQFVRT    124

Query        122 -------QLSVEIMGFKK-EELFPEVQ--IMDVKEYLKNALESDLQLFI---    160
d1h7wa3      125 EQDETGK------WNEDEDQ-I-VHLKAD---------------VVISAFGS    153


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.04)
DALI match             ******************        
Query         98 EEKAPKLSDLLSGARKKEVKFYAXQLSVEIMG    129
d1h7wa3       80 FVNIRAVPEEVELAKEEKCEFLPFLSPRKVIV    111



top
17: d1c0pa1 D-​aminoacid oxidase,​ N-​terminal domain (svm: 1.634)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.43  Contact: 712
Modified z-scores:
dali:0.95 daliz:0.93 gdtts:0.76 tmscore:0.82 rmsd:0.56 AHM:0.56 LBcontacta:0.96 LBcontactb:0.93 LHM:0.27
id:0.94 blosum:0.28 compass:0.32 pearson:0.87
Scaled scores:
dali:0.75 daliz:0.46 gdtts:0.35 tmscore:0.39 rmsd:0.68 AHM:0.58 LBcontacta:0.51 LBcontactb:0.69 LHM:0.31
id:0.08 blosum:0.06 compass:0.13 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.2 Raw score:441.10)
Query          1 --GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLRDPekasqed     58
d1c0pa1        1 lmMHSQKRVVVLG------sGVIGLSSALILARKGYSVHILAR---DLPEDVS-------     44

Query         59 kslyeqafssltpreAEEL-------plskmnLGGIGKKMLLEMMKEEK-----------    100
d1c0pa1       45 ----------sqtfaSPWAganwtpfmtltdgPRQAKWEESTFKKWVELvptghamwlkg     94

Query        101 -----------------------------------------------apKLSDLLSGARK    113
d1c0pa1       95 trrfaqnedgllghwykditpnyrplpssecppgaigvtydtlsvhapkYCQYLARELQK    154

Query        114 KEVKFYAXqlsveimgfkkeelfpevqiMDVKEyLKNALESDLQLFI-------------    160
d1c0pa1      155 LGATFERR--------------------TVTSL-EQAFDGADLVVNAtglgaksiagidd    193

Query        161 ------------------------------------------------------------    161
d1c0pa1      194 qarggprveaerivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaae    253

Query        161 ---------------    161
d1c0pa1      254 dvaqlvdeafqryhg    268


hit structure      alignment
FAST alignment (Normalized score: 3.76 Raw score:778.60)
Query          1 GM----ENKKMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEK     53
d1c0pa1        1 --LMMHSQKRVVV---------LGSGVIGLSSALILARKGYSVHIL--------------     35

Query         54 ASQEDKSLYEQAFSSLTPREAEELPLSKMNL-----------------------------     84
d1c0pa1       36 -------------------------------ARDLPEDVSSQTFASPWAGANWTPFMTLT     64

Query         85 ---GGIGKKMLLEMMKEEKAP---------------------------------------    102
d1c0pa1       65 DGPRQAKWEESTFKKWV----ELVPTGHAMWLKGTRRFAQNEDGLLGHWYKDITPNYRPL    120

Query        103 -----------------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEV    139
d1c0pa1      121 PSSECPPGAIGVTYDTLSVHAPKYCQYLARELQKLGATFE-------------------R    161

Query        140 QIM-DVKEYLKNA-LESDLQLFI-------------------------------------    160
d1c0pa1      162 RTVTSLEQA----FDGADLVV--NATGLGAKSIAGIDDQARGGPRVEAERIVLPLDRTKS    215

Query        161 -----------------------------------------------------    161
d1c0pa1      216 PLSLGRGSARAAKEKEVTLVHAYGFSSAGYQQSWGAAEDVAQLVDEAFQRYHG    268


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:72.53)
Query          1 ----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d1c0pa1        1 LMMH--SQKRVVVLG--S----GVIGLSSALILARKGYSVHILAR---DLPED-V-----     43

Query         57 EDKSLYEQAFSSLTPR-EA-EELPLSKMNLGGIGKKMLL-----------------EMM-     96
d1c0pa1       44 -------------SSQT-FA-SPWA---------GANWTPFMTLTDGPRQAKWEES-TFK     78

Query         97 KEEKA----P--------------------------------------------------    102
d1c0pa1       79 KWVELVPTGHAMWLKGTRRFAQNEDGLLGHWYKDITPNYRPLPSSECPPGAIGVTYDTLS    138

Query        103 -----KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVK-EYLKNALESDL    156
d1c0pa1      139 VHAPKYCQYLARELQKLGATFERR--T-------------------VTS-LEQAFDGADL    176

Query        157 QLFI--------------------------------------------------------    160
d1c0pa1      177 VVNATGLGAKSIAGIDDQARGGPRVEAERIVLPLDRTKSPLSLGRGSARAAKEKEVTLVH    236

Query        161 --------------------------------    161
d1c0pa1      237 AYGFSSAGYQQSWGAAEDVAQLVDEAFQRYHG    268


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.03)
DALI match       ..........        ********************
Query          2 MENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIF     39
d1c0pa1        3 MHSQKRVVVLGSG-----VIGLSSALILARKGYSVHIL     35



top
18: d1w4xa2 Phenylacetone monooxygenase (svm: 1.695)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 516
Modified z-scores:
dali:0.89 daliz:0.88 gdtts:0.92 tmscore:0.92 rmsd:0.35 AHM:0.42 LBcontacta:0.87 LBcontactb:0.87 LHM:0.22
id:0.89 blosum:0.71 compass:0.57 pearson:0.90
Scaled scores:
dali:0.75 daliz:0.43 gdtts:0.65 tmscore:0.63 rmsd:0.77 AHM:0.65 LBcontacta:0.49 LBcontactb:0.70 LHM:0.33
id:0.08 blosum:0.13 compass:0.19 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:339.70)
Query          1 ----------------------------gmENKKMNLLLFSgdYDKALASLIIANAArem     32
d1w4xa2        1 vpqlpnfpglkdfagnlyhtgnwphepvdfSGQRVGVIGTG--SSGIQVSPQIAKQA---     55

Query         33 eIEVTIFCAFW-------------------------------------------------     43
d1w4xa2       56 -AELFVFQRTPhfavparnapldpefladlkkryaefreesrntpggthryqgpksalev    114

Query         44 -----------------------------------------------------glllLRD     50
d1w4xa2      115 sdeelvetlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerLVP    174

Query         51 PekasqedkslyeqaFSSLTpreaEELPlskmnlggigkkmllemmkeekapkLSDLLSg    110
d1w4xa2      175 K--------------GYPFG--tkRLIL-------------------------EIDYYE-    192

Query        111 ARKKE-VKFYAXQlsveimgfkkeelfpevqIMDVK---------eyLKNAleSDLQLFI    160
d1w4xa2      193 MFNRDnVHLVDTL------------------SAPIEtitprgvrtseREYE--LDSLVLA    232

Query        161 ---    161
d1w4xa2      233 tgf    235


hit structure      alignment
FAST alignment (Normalized score: 2.51 Raw score:486.50)
Query          1 ----------------------------GMENKKMNLLLFSGDYDK---ALASLIIANAA     29
d1w4xa2        1 VPQLPNFPGLKDFAGNLYHTGNWPHEPVDFSGQRVGV---------IGTGSSGIQVSPQI     51

Query         30 REME--IEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNL---     84
d1w4xa2       52 AK--QAAELFVFQR-------------------------------------------TPH     66

Query         85 ------------------------------------------------------------     85
d1w4xa2       67 FAVPARNAPLDPEFLADLKKRYAEFREESRNTPGGTHRYQGPKSALEVSDEELVETLERY    126

Query         85 -----------------GGIGKKMLLEMMKEEKAPKLSD---------------------    106
d1w4xa2      127 WQEGGPDILAAYRDILRDRDANERVAEFIRN--------KIRNTVRDPEVAERLVPKGYP    178

Query        107 ----------LLSGARKK-EVKFYAXQLSVEIMGFKKEELFPEVQ--IMDVKEYLKNA--    151
d1w4xa2      179 FGTKRLILEIDYYEMFNRDNVHLVD--------------------TLSAPI-------ET    211

Query        152 ------------LESDLQLFI-----    160
d1w4xa2      212 ITPRGVRTSEREYELDSLV--LATGF    235


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:68.59)
Query          1 ----------------------------GMENKKMNLLLFSGDYDKALASLIIANAAREM     32
d1w4xa2        1 VPQLPNFPGLKDFAGNLYHTGNWPHEPVDFSGQRVGVIG-T-G--S--SGIQVSPQIAKQ     54

Query         33 EIEVTIFCAFWGLLLL--------------------------------------------     48
d1w4xa2       55 AAELFVFQR--TPHFAVPARNAPLDPEFLADLKKRYAEFREESRNTPGGTHRYQGPKSAL    112

Query         49 ----------------------------------------R-DPE--K------------     53
d1w4xa2      113 EVSDEELVETLERYWQEGGPDILAAYRDILRDRDANERVAEFIRNKIRNTVRDPEVAERL    172

Query         54 -ASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGAR    112
d1w4xa2      173 V------------PK-GYP----FGTK---R-----L---I---------LE-IDYYEMF    194

Query        113 KKE-VKFYAXQLSVEIMGFKKEELFPEVQIMDVKE-----YL----KNALESDLQLFI--    160
d1w4xa2      195 NRDNVHLVDT--LS----------------APIETITPRGVRTSEREY-ELDSLVLATGF    235


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.46)
DALI match       ........    *******
Query         22 SLIIANAAREMEIEVTIFC     40
d1w4xa2       44 GIQVSPQIAKQAAELFVFQ     62



top
19: d1fl2a2 Alkyl hydroperoxide reductase subunit F (AhpF),​ C-​terminal domains (svm: 1.685)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.48  Contact: 527
Modified z-scores:
dali:0.90 daliz:0.94 gdtts:0.92 tmscore:0.90 rmsd:0.25 AHM:0.27 LBcontacta:0.92 LBcontactb:0.85 LHM:0.19
id:0.78 blosum:0.47 compass:0.66 pearson:0.87
Scaled scores:
dali:0.79 daliz:0.57 gdtts:0.75 tmscore:0.71 rmsd:0.83 AHM:0.74 LBcontacta:0.66 LBcontactb:0.78 LHM:0.37
id:0.04 blosum:0.05 compass:0.19 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:347.80)
Query          1 --------------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEI     34
d1fl2a2        1 wrnmnvpgedqyrtkgvtycphcdgpLFKGKRVAVIG------gGNSGVEAAIDLAGIVE     54

Query         35 EVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreaeelplskmnlggigkkmlle     94
d1fl2a2       55 HVTLLEF---APEM----------------------------------------------     65

Query         95 mmkeekapkLSDLLSGARKKE-VKFYAX------------------QLSVEImgfkkeel    135
d1fl2a2       66 -------kaDQVLQDKLRSLKnVDIILNaqttevkgdgskvvgleyRDRVSG--------    110

Query        136 fpevqimdvkeyLKNAleSDLQLFI---    160
d1fl2a2      111 ----------diHNIE--LAGIFVQigl    126


hit structure      alignment
FAST alignment (Normalized score: 3.98 Raw score:565.30)
Query          1 --------------------------GMENKKMNLLLFSGDYDK---ALASLIIANAARE     31
d1fl2a2        1 WRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV---------IGGGNSGVEAAIDLAG     51

Query         32 ME-IEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKK     90
d1fl2a2       52 I-VEHVTLLEF-------------------------------------------------     61

Query         91 MLLEMMKEEKAPK------LSDLLSGARKK-EVKFYAXQLSVEIMGFKKEELFPEVQIMD    143
d1fl2a2       62 -------------APEMKADQVLQDKLRSLKNVDII--------------------LNAQ     88

Query        144 VKEYLKNA--------------------------LESDLQLFI-----    160
d1fl2a2       89 --------TTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIF--VQIGL    126


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:64.81)
Query          1 --------------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEI     34
d1fl2a2        1 WRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIG------GGNSGVEAAIDLAGIVE     54

Query         35 EVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLE     94
d1fl2a2       55 HVTLLEF--APEM--------------------------KA-------------------     67

Query         95 MMKEEKAPKLSDLLSGARKKE-VKFYAX-------------------QLSVEIMGFKKEE    134
d1fl2a2       68 ---------DQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDR-VS--------    109

Query        135 LFPEVQIMDVKEYLKNALESDLQ-LFI--    160
d1fl2a2      110 -------GD-IH--NI--ELAGIFVQIGL    126


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.19)
DALI match       ******************
Query         22 SLIIANAAREMEIEVTIF     39
d1fl2a2       42 GVEAAIDLAGIVEHVTLL     59



top
20: d1ps9a3 2,​4-​dienoyl-​CoA reductase,​ middle domain (svm: 1.690)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 666
Modified z-scores:
dali:0.93 daliz:0.94 gdtts:0.92 tmscore:0.92 rmsd:0.33 AHM:0.34 LBcontacta:0.90 LBcontactb:0.90 LHM:0.21
id:0.96 blosum:0.78 compass:0.70 pearson:0.95
Scaled scores:
dali:0.78 daliz:0.50 gdtts:0.60 tmscore:0.63 rmsd:0.79 AHM:0.72 LBcontacta:0.46 LBcontactb:0.69 LHM:0.36
id:0.11 blosum:0.14 compass:0.25 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:393.70)
Query          1 ---------------------------------------GMENKKMNLLLfsgdydkALA     21
d1ps9a3        1 intcigcnqacldqifvgkvtsclvnprachetkmpilpAVQKKNLAVVG------aGPA     54

Query         22 SLIIANAAREMEIEVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreaeELPLsk     81
d1ps9a3       55 GLAFAINAAARGHQVTLFDA---HSEI------------------------ggqFNIA--     85

Query         82 mnlgGIGKKmllemmkeekaPKLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqI    141
d1ps9a3       86 --kqIPGKE--------efyETLRYYRRMIEVTGVTLKLN------------------hT    117

Query        142 MDVKEYlknaLESDLQLFI-----------------------------------------    160
d1ps9a3      118 VTADQL----QAFDETILAsgipnralaqplidsgktvhliggcdvameldarraiaqgt    173

Query        161 ------    161
d1ps9a3      174 rlalei    179


hit structure      alignment
FAST alignment (Normalized score: 3.87 Raw score:654.60)
Query          1 GME------------------------------------------NKKMNLLLFSGDYDK     18
d1ps9a3        1 ---INTCIGCNQACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAV---------     48

Query         19 ---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLT-PREA     74
d1ps9a3       49 VGAGPAGLAFAINAAARGHQVTLFD------------------------------AHSEI     78

Query         75 EELPLSKMNLGGIGKKMLLEMMKEEKAP------------------KLSDLLSGARKKEV    116
d1ps9a3       79 ----------------------------GGQFNIAKQIPGKEEFYETLRYYRRMIEVTGV    110

Query        117 KFYAXQLSVEIMGFKKEELFPE-VQIMDVKEYLKNA-LESDLQLFI--------------    160
d1ps9a3      111 TLK-------------------LNHTVTADQ-----LQAFDETI--LASGIPNRALAQPL    144

Query        161 -----------------------------------    161
d1ps9a3      145 IDSGKTVHLIGGCDVAMELDARRAIAQGTRLALEI    179


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:70.82)
Query          1 ---------------------------------------GMENKKMNLLLFSGDYDKALA     21
d1ps9a3        1 INTCIGCNQACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAVVG------AGPA     54

Query         22 SLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREA-EELPLS     80
d1ps9a3       55 GLAFAINAAARGHQVTLFDA--HSEIG-------------------------GQ-FNIA-     85

Query         81 KMNLGGIGKKMLLE-MMKEEKAPKLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEV    139
d1ps9a3       86 --K-QIPGKE--EFY-------ETLRYYRRMIEVTGVTLKLNH-T---------------    117

Query        140 QIMDVKEYLKNALESDLQLFI---------------------------------------    160
d1ps9a3      118 ----VTADQL-QAFDETILASGIPNRALAQPLIDSGKTVHLIGGCDVAMELDARRAIAQG    172

Query        161 -------    161
d1ps9a3      173 TRLALEI    179


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.01)
DALI match       ..........        ********************
Query          2 MENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIF     39
d1ps9a3       40 AVQKKNLAVVGAG-----PAGLAFAINAAARGHQVTLF     72



hit structures. 
top
21: d1vdca2 Thioredoxin reductase (svm: 1.690)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 483
Modified z-scores:
dali:0.88 daliz:0.93 gdtts:0.88 tmscore:0.88 rmsd:0.27 AHM:0.30 LBcontacta:0.87 LBcontactb:0.82 LHM:0.18
id:0.80 blosum:0.64 compass:0.65 pearson:0.85
Scaled scores:
dali:0.78 daliz:0.55 gdtts:0.69 tmscore:0.67 rmsd:0.80 AHM:0.71 LBcontacta:0.60 LBcontactb:0.76 LHM:0.40
id:0.06 blosum:0.10 compass:0.20 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:320.00)
Query          1 ------------------------------GMENKKMNLLLfsgdydkALASLIIANAAR     30
d1vdca2        1 rlsfvgsgevlggfwnrgisacavcdgaapIFRNKPLAVIG------gGDSAMEEANFLT     54

Query         31 EMEIEVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreaeelplskmnlggigkk     90
d1vdca2       55 KYGSKVYIIHR---RDAF------------------------------------------     69

Query         91 mllemmkeekapkLSDLLSGARKKE-VKFYAX--------------------QLSVEImg    129
d1vdca2       70 -----------raSKIMQQRALSNPkIDVIWNssvveaygdgerdvlgglkvKNVVTG--    116

Query        130 fkkeelfpevqimDVKEylknalESDLQLF-i    160
d1vdca2      117 ------------dVSDL------KVSGLFFai    130


hit structure      alignment
FAST alignment (Normalized score: 3.62 Raw score:522.40)
Query          1 GM--------------------------------ENKKMNLLLFSGDYDK---ALASLII     25
d1vdca2        1 --RLSFVGSGEVLGGFWNRGISACAVCDGAAPIFRNKPLAV---------IGGGDSAMEE     49

Query         26 ANAAREME--IEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMN     83
d1vdca2       50 ANFLTK--YGSKVYIIHR------------------------------------------     65

Query         84 LGGIGKKMLLEMMKEEKAPK------LSDLLSGARKK-EVKFYAXQLSVEIMGFKKEELF    136
d1vdca2       66 --------------------RDAFRASKIMQQRALSNPKIDVI-----------------     88

Query        137 PEVQIMDVKEYLKNA----------------------------LESDLQLFI---    160
d1vdca2       89 ---WNSS--------VVEAYGDGERDVLGGLKVKNVVTGDVSDLKVSGLF--FAI    130


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.97)
Query          1 -----------------------------G-MENKKMNLLLFSGDYDKALASLIIANAAR     30
d1vdca2        1 RLSFVGSGEVLGGFWNRGISACAVCDGAAPIFRNKPLAVIG--G----GDSAMEEANFLT     54

Query         31 EMEI-EVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGK     89
d1vdca2       55 -KYGSKVYIIHR--RDAF--------------------------RA--------------     71

Query         90 KMLLEMMKEEKAPKLSDLLSGARKKE-VKFYAX---------------------QLSVEI    127
d1vdca2       72 --------------SKIMQQRALSNPKIDVIWNSSVVEAYGDGERDVLGGLKVKNVV-T-    115

Query        128 MGFKKEELFPEVQIMDVKEYLKNALESDLQLF-I    160
d1vdca2      116 ---------------GDVS--DL--KVSGLFFAI    130


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.07)
DALI match       *********** ******                    
Query        105 SDLLSGARKKE-VKFYAXQLSVEIMGFKKEELFPEVQI    141
d1vdca2       73 KIMQQRALSNPKIDVIWNSSVVEAYGDGERDVLGGLKV    110



top
22: d1cqxa3 Flavohemoglobin,​ C-​terminal domain (svm: 0.745)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.49  Contact: 571
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.92 tmscore:0.91 rmsd:0.34 AHM:0.35 LBcontacta:0.88 LBcontactb:0.91 LHM:0.16
id:0.96 blosum:0.78 compass:0.48 pearson:0.88
Scaled scores:
dali:0.75 daliz:0.47 gdtts:0.61 tmscore:0.62 rmsd:0.78 AHM:0.70 LBcontacta:0.47 LBcontactb:0.77 LHM:0.48
id:0.10 blosum:0.14 compass:0.17 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:378.80)
Query          1 -gMENKKMNLLLFSGDYDKALASLIIANAarEMEIEVTIFCAFwgllllrdpekasqedk     59
d1cqxa3        1 dvDAKTPIVLISGGVGLTPMVSMLKVALQ--APPRQVVFVHGA-----------------     41

Query         60 slyeqafssltPREAeelplskmnlggigkkmllemmkeekapklsdlLSGARKKE-VKF    118
d1cqxa3       42 --------rnsAVHA----------------------------mrdrlREAAKTYEnLDL     65

Query        119 YAXqlsVEIMG--FKKEELfpevqiMDVKEYLKNALE-sDLQLF----------------    159
d1cqxa3       66 FVF---YDQPLpeDVQGRDydypglVDVKQIEKSILLpdADYYIcgpipfmrmqhdalkn    122

Query        160 -------------------i    160
d1cqxa3      123 lgihearihyevfgpdlfae    142


hit structure      alignment
FAST alignment (Normalized score: 3.24 Raw score:488.30)
Query          1 GM---ENKKMNLLLFSGDYDK----ALASLIIANAA-REMEIEVTIFCA-------FWGL     45
d1cqxa3        1 --DVDAKTPIVLIS-------GGVGLTPMVSMLKVALQAPPRQVVFVH-GARNSAVHAMR     50

Query         46 LLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK-L    104
d1cqxa3       51 D---------------------------------------------------------RL     53

Query        105 SDLLSGARK-KEVKFYAXQLSVEIMGF---------KKEELFPEVQI------MDVKEYL    148
d1cqxa3       54 REAAKT---YENLDLFVF---------YDQPLPEDVQGRD-------YDYPGLVDVKQIE     94

Query        149 KNALES----DLQLFI-------------------------------------    160
d1cqxa3       95 KSI---LLPDADYY--ICGPIPFMRMQHDALKNLGIHEARIHYEVFGPDLFAE    142


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:72.51)
Query          1 --GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQED     58
d1cqxa3        1 DVDAK-TPIVLISGGVGLTPMVSMLKVALQ--APPRQVVFVHGAR---------------     42

Query         59 KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKE-VK    117
d1cqxa3       43 -------NS--AVHAMR----------------------------DR-LREAAKTYENLD     64

Query        118 FYAXQLSVEIMG--FK-KEELFPEVQI---MDVKEYLK-NALESDLQLFI----------    160
d1cqxa3       65 LFVF---YDQPLPEDVQGRDY----DYPGLVDVKQIEKSILLPDADYYICGPIPFMRMQH    117

Query        161 -------------------------    161
d1cqxa3      118 DALKNLGIHEARIHYEVFGPDLFAE    142


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.66)
DALI match       ....................  **********
Query          9 LLLFSGDYDKALASLIIANAAREMEIEVTIFC     40
d1cqxa3        8 IVLISGGVGLTPMVSMLKVALQAPPRQVVFVH     39



top
23: d1xfia_ Hypothetical protein At2g17340 (svm: 1.291)

SCOP Superfamily: Hypothetical protein At2g17340  |  SCOP Fold: Hypothetical protein At2g17340  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.40  Contact: 709
Modified z-scores:
dali:0.95 daliz:0.95 gdtts:0.92 tmscore:0.92 rmsd:0.37 AHM:0.37 LBcontacta:0.92 LBcontactb:0.89 LHM:0.26
id:0.85 blosum:0.53 compass:0.54 pearson:0.87
Scaled scores:
dali:0.77 daliz:0.52 gdtts:0.61 tmscore:0.64 rmsd:0.74 AHM:0.66 LBcontacta:0.51 LBcontactb:0.71 LHM:0.25
id:0.04 blosum:0.08 compass:0.14 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:424.50)
Query          1 ------------------------------------------------------------      1
d1xfia_        1 emvpfpqlpmpiennyractipyrfpsddpkkatpneiswinvfansipsfkkraesdit     60

Query          1 ------------------------------------------------------------      1
d1xfia_       61 vpdaparaekfaeryagiledlkkdpeshggppdgillcrlreqvlrelgfrdifkkvkd    120

Query          1 ------------------------------------------------------------      1
d1xfia_      121 eenakaislfpqvvslsdaieddgkrlenlvrgifagnifmsflascqnlvprpwviddl    180

Query          1 --------GMENKKMNLLLfSGDYDKAL-ASLIIANAAREMEIEVTIFCA-----FWGL-     45
d1xfia_      181 enfqakwiNKSWKKAVIFV-DNSGADIIlGILPFARELLRRGAQVVLAANelpsiNDITc    239

Query         46 -LLLRdpekasqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapkL    104
d1xfia_      240 tELTE----------------------------------------------------ilS    247

Query        105 SDL--lsgaRKKE-VKFYAXQLSVeimgfkkeelfpevqimDVKEYLKNALESDLQLFI-    160
d1xfia_      248 QLKngqllgVDTSkLLIANSGNDL----------pvidlsrVSQELAYLSSDADLVIVEg    297

Query        161 ----------------------------------------------    161
d1xfia_      298 mgrgietnlyaqfkcdslkigmvkhlevaeflggrlydcvfkfnev    343


hit structure      alignment
FAST alignment (Normalized score: 2.91 Raw score:681.50)
Query          1 GME---------------------------------------------------------      3
d1xfia_        1 ---EMVPFPQLPMPIENNYRACTIPYRFPSDDPKKATPNEISWINVFANSIPSFKKRAES     57

Query          4 ------------------------------------------------------------      4
d1xfia_       58 DITVPDAPARAEKFAERYAGILEDLKKDPESHGGPPDGILLCRLREQVLRELGFRDIFKK    117

Query          4 ------------------------------------------------------------      4
d1xfia_      118 VKDEENAKAISLFPQVVSLSDAIEDDGKRLENLVRGIFAGNIFMSFLASCQNLVPRPWVI    177

Query          4 --------------NKKMNLLLFSGDYDK-ALASLIIANAAREMEIEVTIFCAFW-----     43
d1xfia_      178 DDLENFQAKWINKSWKKAVIFVDN-SGADIILGILPFARELLRRGAQVVLAA---NELPS    233

Query         44 -----GLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKE     98
d1xfia_      234 INDITCTEL---------------------------------------------------    242

Query         99 EKAPKLSDLLSGARKK------------------EVKFYAXQLSVEIMGFKKEELFPEVQ    140
d1xfia_      243 ----------------TEILSQLKNGQLLGVDTSKLLIANS-------------------    267

Query        141 IM-----------DVKEYLKNALESDLQLFI-----------------------------    160
d1xfia_      268 --GNDLPVIDLSRVSQELAYLSSDADLVI--VEGMGRGIETNLYAQFKCDSLKIGMVKHL    323

Query        161 --------------------    161
d1xfia_      324 EVAEFLGGRLYDCVFKFNEV    343


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:68.32)
Query          1 ------------------------------------------------------------      1
d1xfia_        1 EMVPFPQLPMPIENNYRACTIPYRFPSDDPKKATPNEISWINVFANSIPSFKKRAESDIT     60

Query          1 ------------------------------------------------------------      1
d1xfia_       61 VPDAPARAEKFAERYAGILEDLKKDPESHGGPPDGILLCRLREQVLRELGFRDIFKKVKD    120

Query          1 ------------------------------------------------------------      1
d1xfia_      121 EENAKAISLFPQVVSLSDAIEDDGKRLENLVRGIFAGNIFMSFLASCQNLVPRPWVIDDL    180

Query          1 --------GMENKKMNLLLFSGDYDKAL-ASLIIANAAREMEIEVTIFCA--F---WGL-     45
d1xfia_      181 ENFQAKWINKSWKKAVIFVDNS-GADIILGILPFARELLRRGAQVVLAANELPSINDITC    239

Query         46 -LLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKL    104
d1xfia_      240 TELTE------------------------IL----------------------------S    247

Query        105 SDL-LSGA-RKKE-VKFYAXQLSVEI------MGFKKEELFPEVQIMDVKE-YLK-NALE    153
d1xfia_      248 QLKNGQLLGVDTSKLLIANSGND--LPVIDLS---------------RVSQELAYLSSDA    290

Query        154 SDLQLFI----------------------------------------------    160
d1xfia_      291 DLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAEFLGGRLYDCVFKFNEV    343


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.49)
DALI match                      
Query        107 LLSGARKKEVKFYAX    121
d1xfia_      213 FARELLRRGAQVVLA    227



top
24: d1trba1 Thioredoxin reductase (svm: 1.697)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 562
Modified z-scores:
dali:0.91 daliz:0.95 gdtts:0.92 tmscore:0.92 rmsd:0.28 AHM:0.31 LBcontacta:0.92 LBcontactb:0.89 LHM:0.17
id:0.86 blosum:0.76 compass:0.66 pearson:0.92
Scaled scores:
dali:0.82 daliz:0.59 gdtts:0.68 tmscore:0.69 rmsd:0.81 AHM:0.73 LBcontacta:0.56 LBcontactb:0.73 LHM:0.38
id:0.06 blosum:0.13 compass:0.22 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:393.90)
Query          1 -gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCafwGLLLlrdpekasqedk     59
d1trba1        1 gttkhsKLLILG------sGPAGYTAAVYAARANLQPVLIT---GMEK------------     39

Query         60 slyeqafssltpreaeELPLskmnlggigKKMLleMMKEE-----kapKLSDLLSGARKK    114
d1trba1       40 -------------ggqLTTT---------TEVE--NWPGDpndltgplLMERMHEHATKF     75

Query        115 EVKFY-AXQLsveimgfkkeelfpevqiMDVKEYlknalESDLQLFI-------------    160
d1trba1       76 ETEIIfDHIN------kvdlqnrpfrlnGDNGEY-----TCDALIIAtgasaryhspnta    124

Query        161 ------------------------------------------------------------    161
d1trba1      125 ifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcmaaldae    184

Query        161 -----    161
d1trba1      185 ryldg    189


hit structure      alignment
FAST alignment (Normalized score: 3.91 Raw score:680.70)
Query          1 GMENK------KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDP     51
d1trba1        1 -----GTTKHSKLLI---------LGSGPAGYTAAVYAARANLQPVLITGM---------     37

Query         52 EKASQEDKSLYEQAFSSLTPREAEE---LPLSKMNLGGIGKKM---LLEMMKEEKAP---    102
d1trba1       38 -------------------------EKGGQLT-----------TTTEVENW------PGD     55

Query        103 --------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA---    151
d1trba1       56 PNDLTGPLLMERMHEHATKFETEII-------------------FDHIN--------KVD     88

Query        152 --------------LESDLQLFI-------------------------------------    160
d1trba1       89 LQNRPFRLNGDNGEYTCDALI--IATGASARYHSPNTAIFEGQLELENGYIKVQSGIHGN    146

Query        161 -------------------------------------------    161
d1trba1      147 ATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDG    189


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:69.20)
Query          1 -----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKAS     55
d1trba1        1 GTTKH----SKLLILG------SGPAGYTAAVYAARANLQPVLITGME--KG--------     40

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKE------EKAPKLSDLLS    109
d1trba1       41 ------------------GQLTT----T--TE-V-ENW-PGDPNDLTGP---LLMERMHE     70

Query        110 GARKKEVKFYAXQLS------------VEIMGFKKEELFPEVQIMDVKEYLKNALESDLQ    157
d1trba1       71 HATKFETEIIFDHINKVDLQNRPFRLN-----------------GDNGE--YT--CDALI    109

Query        158 LFI---------------------------------------------------------    160
d1trba1      110 IATGASARYHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQA    169

Query        161 --------------------    161
d1trba1      170 ITSAGTGCMAALDAERYLDG    189


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.06)
DALI match            ......        ********************
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIF     39
d1trba1        1 GTTKHSKLLILGSG-----PAGYTAAVYAARANLQPVLI     34



top
25: d1jzta_ Hypothetical protein YNL200c (YNU0 YEAST) (svm: 1.593)

SCOP Superfamily: YjeF N-​terminal domain-​like  |  SCOP Fold: YjeF N-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 666
Modified z-scores:
dali:0.90 daliz:0.95 gdtts:0.91 tmscore:0.89 rmsd:0.24 AHM:0.25 LBcontacta:0.90 LBcontactb:0.82 LHM:0.22
id:0.73 blosum:0.65 compass:0.69 pearson:0.91
Scaled scores:
dali:0.77 daliz:0.54 gdtts:0.68 tmscore:0.72 rmsd:0.83 AHM:0.77 LBcontacta:0.54 LBcontactb:0.65 LHM:0.36
id:0.03 blosum:0.12 compass:0.24 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:420.50)
Query          1 ---------------------------------------------------gmENKKMNL      9
d1jzta_        1 lkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgkteteKGKHVFV     60

Query         10 LLfSGDYdKALASLIIANAAREMEIEVTIFCafwGLLLlrdpekasqedkslyeqafssl     69
d1jzta_       61 IA-GPGN-NGGDGLVCARHLKLFGYNPVVFY---PKRS----------------------     93

Query         70 tpREAEelplskmnlggigkkmllemmkeekapKLSDLLSGARKKEVKFYAXqlsveimg    129
d1jzta_       94 --ERTE---------------------------FYKQLVHQLNFFKVPVLSQ--------    116

Query        130 fkkeelfpevQIMDvkeYLKNAL--ESDLQLFI---------------------------    160
d1jzta_      117 ----------DEGN---WLEYLKpeKTLCIVDAifgfsfkppmrepfkgiveelckvqni    163

Query        161 ------------------------------------------------------------    161
d1jzta_      164 ipivsvdvptgwdvdkgpisqpsinpavlvsltvpkpcsshirenqtthyvggrfiprdf    223

Query        161 --------------------    161
d1jzta_      224 ankfgfepfgyestdqilkl    243


hit structure      alignment
FAST alignment (Normalized score: 4.04 Raw score:797.30)
Query          1 G----------------------------------------------------MENKKMN      8
d1jzta_        1 -LKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVF     59

Query          9 LLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSS     68
d1jzta_       60 VIAG--PGNNGGDGLVCARHLKLFGYNPVVFYP---------------------------     90

Query         69 LTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP-------KLSDLLSGARKKEVKFYAX    121
d1jzta_       91 ----------------------------------KRSERTEFYKQLVHQLNFFKVPVLS-    115

Query        122 QLSVEIMGFKKEELFPEVQIMDVK----EYLKNAL---ESDLQLFI--------------    160
d1jzta_      116 ------------------------QDEGNWLEYL-KPEKTLCIV--DAIFGFSFKPPMRE    148

Query        161 ------------------------------------------------------------    161
d1jzta_      149 PFKGIVEELCKVQNIIPIVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIREN    208

Query        161 -----------------------------------    161
d1jzta_      209 QTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL    243


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:70.86)
Query          1 --------------------------------------------GME------N-KKMNL      9
d1jzta_        1 LKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFV     60

Query         10 LLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSL     69
d1jzta_       61 IA-GPG-NNGGDGLVCARHLKLFGYNPVVFYP-K--R-----------------------     92

Query         70 TPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYAXQLSVEIMG    129
d1jzta_       93 -SERTE---------------------------FYKQLVHQLNFFKVPVLSQD-------    117

Query        130 FKKEELFPEVQIMDVKEYLKNALESDLQLFI-----------------------------    160
d1jzta_      118 -----------EGNWLEYLK-PEKTLCIVDAIFGFSFKPPMREPFKGIVEELCKVQNIIP    165

Query        161 ------------------------------------------------------------    161
d1jzta_      166 IVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIRENQTTHYVGGRFIPRDFAN    225

Query        161 ------------------    161
d1jzta_      226 KFGFEPFGYESTDQILKL    243


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.03)
DALI match       ........ .... ***********************. 
Query          4 NKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1jzta_       53 EKGKHVFVIAGPGNNGGDGLVCARHLKLFGYNPVVFYPK     91



hit structures. 
top
26: d1fw8a_ Phosphoglycerate kinase (svm: 0.785)

SCOP Superfamily: Phosphoglycerate kinase  |  SCOP Fold: Phosphoglycerate kinase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 738
Modified z-scores:
dali:0.94 daliz:0.95 gdtts:0.89 tmscore:0.90 rmsd:0.35 AHM:0.33 LBcontacta:0.94 LBcontactb:0.91 LHM:0.29
id:0.87 blosum:0.60 compass:0.68 pearson:0.93
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.52 tmscore:0.57 rmsd:0.76 AHM:0.71 LBcontacta:0.52 LBcontactb:0.71 LHM:0.28
id:0.05 blosum:0.11 compass:0.23 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:484.70)
Query          1 ------------------------------------------------------------      1
d1fw8a_        1 skyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenlryhieeegsrk     60

Query          1 ------------------------------------------------------------      1
d1fw8a_       61 vdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpqraagfllekel    120

Query          1 -------gMENKKMNLLLFS-GDYDKaLASLIIANAAremeiEVTIFCAFWGLL-LLRDp     51
d1fw8a_      121 kyfgkaleNPTRPFLAILGGaKVADK-IQLIDNLLDK-----VDSIIIGGGMAFtFKKV-    173

Query         52 ekasqedkslyeqafSSLTPReAEELplskmnlggigkkmllemmkeekapKLSDLLSGA    111
d1fw8a_      174 ----------lenteIGDSIF-DKAG-----------------------aeIVPKLMEKA    199

Query        112 RKKEVKFYAXQlsVEIM-------------gFKKE----elfpevqimDVKEYLKNALES    154
d1fw8a_      200 KAKGVEVVLPV--DFIIadafsadantktvtDKEGipagwqgldngpeSRKLFAATVAKA    257

Query        155 DLQLFI------------------------------------------------------    160
d1fw8a_      258 KTIVWNgppgvfefekfaagtkalldevvkssaagntviigggdtatvakkygvtdkish    317

Query        161 ------------------------------------------------------------    161
d1fw8a_      318 vstgggaslellegkelpgvaflsekkslssklsvqdldlkdkrvfirvdfnvpldgkki    377

Query        161 --------------------------------------    161
d1fw8a_      378 tsnqrivaalptikyvlehhpryvvlashlgrpngern    415


hit structure      alignment
FAST alignment (Normalized score: 2.52 Raw score:648.60)
Query          1 GM----------------------------------------------------------      2
d1fw8a_        1 --SKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGS     58

Query          3 ------------------------------------------------------------      3
d1fw8a_       59 RKVDGQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGFDLPQRAAGFLLEK    118

Query          3 -----------ENKKMNLLLFSGDYDKALASLIIANAAREMEIE---VTIFCAFWGLLLL     48
d1fw8a_      119 ELKYFGKALENPTRPFLAILGGAKVADKIQLIDNLL--------DKVDSIIIGGGMA---    167

Query         49 RDPEKASQEDKSLYEQAF-----------SSLTPREAEELPLSKMNLGGIGKKMLLEMMK     97
d1fw8a_      168 ------------------FTFKKVLENTEIGDSI--------------------------    183

Query         98 EEKAP-------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIM--------    142
d1fw8a_      184 -----FDKAGAEIVPKLMEKAKAKGVEVVLPV--------------------DFIIADAF    218

Query        143 ---------------------------DVKEYLKNALESDLQLFI---------------    160
d1fw8a_      219 SADANTKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIV--WNGPPGVFEFEKFAA    276

Query        161 ------------------------------------------------------------    161
d1fw8a_      277 GTKALLDEVVKSSAAGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPG    336

Query        161 ------------------------------------------------------------    161
d1fw8a_      337 VAFLSEKKSLSSKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEH    396

Query        161 -------------------    161
d1fw8a_      397 HPRYVVLASHLGRPNGERN    415


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.58)
Query          1 ------------------------------------------------------------      1
d1fw8a_        1 SKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGSRK     60

Query          1 ------------------------------------------------------------      1
d1fw8a_       61 VDGQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGFDLPQRAAGFLLEKEL    120

Query          1 ---------GMENKKMNLLL-----------------------FS---------------     13
d1fw8a_      121 KYFGKALEN-PTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAFTFKKVLENTEI    179

Query         14 ------------------------------------------------------------     14
d1fw8a_      180 GDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVTDKEGIPAGWQG    239

Query         14 -GD-YDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTP     71
d1fw8a_      240 LDNGPESRKLFAATVAKAK----TIVWNGPPGV-F----------------E--F--EKF    274

Query         72 REAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKK-EVKFYAXQLSVEIMGF    130
d1fw8a_      275 AAGTKA--------------------------LLDEVVKSSAAGNTVIIGGGDTAT---V    305

Query        131 KKEELFPE-V--QI-MDVKEYLKNALE---------------------------------    153
d1fw8a_      306 AKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEKKSLSSKLSVQDLDLKDKRVFIR    365

Query        154 --------------------------------------------------SDLQLFI    160
d1fw8a_      366 VDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGRPNGERN-------    415


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.09)
DALI match                                  *****************
Query         85 GGIGKKMLLEM---------MKEEKAPKLSDLLSGARKKEVKFY    119
d1fw8a_      164 GGMAFTFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVV    207



top
27: d1o94a3 Trimethylamine dehydrogenase,​ middle domain (svm: 1.691)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 699
Modified z-scores:
dali:0.94 daliz:0.94 gdtts:0.92 tmscore:0.92 rmsd:0.33 AHM:0.32 LBcontacta:0.92 LBcontactb:0.90 LHM:0.40
id:0.77 blosum:0.28 compass:0.51 pearson:0.86
Scaled scores:
dali:0.77 daliz:0.49 gdtts:0.58 tmscore:0.62 rmsd:0.79 AHM:0.73 LBcontacta:0.49 LBcontactb:0.67 LHM:0.13
id:0.02 blosum:0.06 compass:0.14 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:415.40)
Query          1 ---------------------------------------------GMENKKMNLLLfsgd     15
d1o94a3        1 dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqTKNKDSVLIVG----     56

Query         16 ydkALASLIIANAAREMEIEVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreae     75
d1o94a3       57 --aGPSGSEAARVLMESGYTVHLTDT---AEKI------------------------ggh     87

Query         76 ELPLskmnlgGIGKKMLlemmkeekapKLSDLLSGARKKE-----VKFYAXQLSveimgf    130
d1o94a3       88 LNQV----aaLPGLGEW--------syHRDYRETQITKLLkknkeSQLALGQKP------    129

Query        131 kkeelfpevqimDVKEYLKNalESDLQLFI------------------------------    160
d1o94a3      130 -----------mTADDVLQY--GADKVIIAtgasectlwnelkaresewaendikgiyli    176

Query        161 ---------------------------------------------------------    161
d1o94a3      177 gdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv    233


hit structure      alignment
FAST alignment (Normalized score: 3.61 Raw score:696.90)
Query          1 GM-----------------------------------------------ENKKMNLLLFS     13
d1o94a3        1 --DIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLI----     54

Query         14 GDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLT     70
d1o94a3       55 -----VGAGPSGSEAARVLMESGYTVHLT-------------------------------     78

Query         71 --PREAEELPLSKMNLG---------GIGKKMLLEMMKEEKAP---KLSDLLSGARK---    113
d1o94a3       79 DTAEKI-----------GGHLNQVAALPGLGE-----------WSYHRDYRETQITKLLK    116

Query        114 --KEVKFYAXQLSVEIMGFKKEELFPEV---QIMDVKEYLKNALESDLQLFI--------    160
d1o94a3      117 KNKESQLA--------------------LGQKPMTADDVLQ--YGADKVI--IATGASEC    152

Query        161 ------------------------------------------------------------    161
d1o94a3      153 TLWNELKARESEWAENDIKGIYLIGDAEAPRLIADATFTGHRVAREIEEANPQIAIPYKR    212

Query        161 ---------------------    161
d1o94a3      213 ETIAWGTPHMPGGNFKIEYKV    233


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:63.43)
Query          1 ------------------------------------------GMENKK-MNLLLFSGDYD     17
d1o94a3        1 DIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFRQTKNKDSVLIVGAG-P     59

Query         18 KALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL     77
d1o94a3       60 SGSEAARVLMESG-----YTVHL----TD-----------------------TAEKIG-G     86

Query         78 PLSKMNLGGI-GKKMLLEMMKEEKAPKLSDLLSGARKKE-VKFYA----XQLSVEIM--G    129
d1o94a3       87 HLN--QVAALPGLGEWSY-H----RDYRETQITKLLKKNKESQLALGQK--PMTADDVL-    136

Query        130 FKKEELFPEVQIMD------------------------V--KEYLK-NA-----------    151
d1o94a3      137 ----------QYGADKVIIATGASECTLWNELKARESEWAENDIKGI-YLIGDAEAPRLI    185

Query        152 -------------LESDL-QLF----------------------------I    160
d1o94a3      186 ADATFTGHRVARE--IEEANPQIAIPYKRETIAWGTPHMPGGNFKIEYKV-    233


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.04)
DALI match       *******************
Query         21 ASLIIANAAREMEIEVTIF     39
d1o94a3       60 SGSEAARVLMESGYTVHLT     78



top
28: d1nhpa2 NADH peroxidase (svm: 1.599)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 513
Modified z-scores:
dali:0.89 daliz:0.90 gdtts:0.85 tmscore:0.86 rmsd:0.36 AHM:0.34 LBcontacta:0.84 LBcontactb:0.86 LHM:0.24
id:0.90 blosum:0.73 compass:0.80 pearson:0.94
Scaled scores:
dali:0.75 daliz:0.46 gdtts:0.56 tmscore:0.55 rmsd:0.75 AHM:0.70 LBcontacta:0.47 LBcontactb:0.71 LHM:0.31
id:0.09 blosum:0.13 compass:0.29 pearson:0.31

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:328.10)
Query          1 --------------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEI     34
d1nhpa2        1 ipgkdldniylmrgrqwaiklkqktvDPEVNNVVVIG------sGYIGIEAAEAFAKAGK     54

Query         35 EVTIFCAfwgLLLLrdpekasqedkslyeqafssltpreAEELPlskmnlggigkkmlle     94
d1nhpa2       55 KVTVIDI---LDRP------------------------lGVYLD----------------     71

Query         95 mmkeekapKLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqimDVKEyLKNAleS    154
d1nhpa2       72 ------keFTDVLTEEMEANNITIATG------etveryegdgrvqkvVTDK-NAYD--A    116

Query        155 DLQLF-i    160
d1nhpa2      117 DLVVVav    123


hit structure      alignment
FAST alignment (Normalized score: 4.27 Raw score:599.40)
Query          1 -------------------------GMEN-KKMNLLLFSGDYDK---ALASLIIANAARE     31
d1nhpa2        1 IPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVV---------IGSGYIGIEAAEAFAK     51

Query         32 MEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKM     91
d1nhpa2       52 AGKKVTVI----------------------------------------------------     59

Query         92 LLEMMKEEKAP--------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFP    137
d1nhpa2       60 -----------DILDRPLGVYLDKEFTDVLTEEMEANNITIA------------------     90

Query        138 EVQIMDVKEYLKNA------------------LESDLQLFI--    160
d1nhpa2       91 --TGETV-------ERYEGDGRVQKVVTDKNAYDADLVVV-AV    123


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:53.16)
Query          1 ------------------------GMENKK-MNLLLFSGDYDKALASLIIANAAREMEIE     35
d1nhpa2        1 IPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVI-GSG-YIGIEAAEAFAKAG----K     54

Query         36 VTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKK--MLL     93
d1nhpa2       55 KVTVI---DIL------------------------D-RP-LGVY---------LDKE--F     74

Query         94 --EMMKEEKAPKLS-DLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKE--YL    148
d1nhpa2       75 TD---------VLTEEMEANNI---T-IATGE-TV----------------ERYEGDGRV    104

Query        149 KNA--------LESDLQLFI-    160
d1nhpa2      105 QKVVTDKNAYD-AD-LVVVAV    123


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.02)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1nhpa2       40 YIGIEAAEAFAKAGKKVTVI     59



top
29: d1j6ua1 UDP-​N-​acetylmuramate-​alanine ligase MurC (svm: 1.692)

SCOP Superfamily: MurCD N-​terminal domain  |  SCOP Fold: MurCD N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.62  Contact: 524
Modified z-scores:
dali:0.89 daliz:0.92 gdtts:0.90 tmscore:0.89 rmsd:0.28 AHM:0.32 LBcontacta:0.89 LBcontactb:0.86 LHM:0.19
id:0.81 blosum:0.67 compass:0.64 pearson:0.90
Scaled scores:
dali:0.77 daliz:0.54 gdtts:0.69 tmscore:0.67 rmsd:0.79 AHM:0.71 LBcontacta:0.57 LBcontactb:0.76 LHM:0.36
id:0.06 blosum:0.12 compass:0.21 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:315.20)
Query          1 gmeNKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCafwGLLLlrdpekasqedks     60
d1j6ua1        1 ---HMKIHFVG-----igGIGMSAVALHEFSNGNDVYGSN---IEET-------------     36

Query         61 lyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdLLSGARKKEVKFYA    120
d1j6ua1       37 ---------------------------------------------eRTAYLRKLGIPIFV     51

Query        121 XqlsveimgfkkeelfpevqimdVKEYlknALESDLQLFI--------------------    160
d1j6ua1       52 P---------------------hSADN---WYDPDLVIKTpavrddnpeivrarmervpi     87

Query        161 --    161
d1j6ua1       88 en     89


hit structure      alignment
FAST alignment (Normalized score: 4.38 Raw score:522.60)
Query          1 GMENKKMNLLLFSGDYDK----ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d1j6ua1        1 ---HMKIHF---------VGIGGIGMSAVALHEFSNGNDVYGSN----------------     32

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKL---SDLLSGARK    113
d1j6ua1       33 ------------------------------------------------IEETERTAYLRK     44

Query        114 KEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA---LESDLQLFI----------    160
d1j6ua1       45 LGIPIF--------------------VPHSA-------DNWYDPDLVI--KTPAVRDDNP     75

Query        161 --------------    161
d1j6ua1       76 EIVRARMERVPIEN     89


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:56.36)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1j6ua1        1 -H--MKIHFVGI-G----GIGMSAVALHEFSNGNDVYGSNI---EET-------------     36

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYA    120
d1j6ua1       37 -------------E------------------------------R-TAY-LRKLGIPIFV     51

Query        121 XQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI--------------------    160
d1j6ua1       52 P---------------------HSADN-WY--DPDLVIKTPAVRDDNPEIVRARMERVPI     87

Query        161 --    161
d1j6ua1       88 EN     89


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.06)
DALI match                           
Query        100 KAPKLSDLLSGARKKEVKFY    119
d1j6ua1       69 AVRDDNPEIVRARMERVPIE     88



top
30: d2uaga1 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD (svm: 1.633)

SCOP Superfamily: MurCD N-​terminal domain  |  SCOP Fold: MurCD N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.63  Contact: 524
Modified z-scores:
dali:0.91 daliz:0.93 gdtts:0.90 tmscore:0.89 rmsd:0.25 AHM:0.28 LBcontacta:0.88 LBcontactb:0.85 LHM:0.18
id:0.63 blosum:0.61 compass:0.62 pearson:0.89
Scaled scores:
dali:0.79 daliz:0.56 gdtts:0.68 tmscore:0.68 rmsd:0.82 AHM:0.73 LBcontacta:0.55 LBcontactb:0.73 LHM:0.38
id:0.02 blosum:0.11 compass:0.23 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:292.70)
Query          1 -GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAFwgLLLLrdpekasqedk     59
d2uaga1        1 aDYQGKNVVIIG------lGLTGLSCVDFFLARGVTPRVMDTR--MTPP-----------     41

Query         60 slyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdllSGARKkEVKFY    119
d2uaga1       42 -----------------------------------------------glDKLPE-AVERH     53

Query        120 AXqlsveimgfkkeelfpevqimdvkeYLKNALESDLQLFI-------------------    160
d2uaga1       54 TG-----------------------slNDEWLMAADLIVASpgialahpslsaaadagie     90

Query        161 ---    161
d2uaga1       91 ivg     93


hit structure      alignment
FAST alignment (Normalized score: 4.07 Raw score:496.40)
Query          1 -GMENKKMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d2uaga1        1 ADYQGKNVVI---------IGLGLTGLSCVDFFLARGVTPRVMDT---------------     36

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSD-----LLSGA    111
d2uaga1       37 --------------------------------------------------RMTPPGLDK-     45

Query        112 RKK---EVKFYAXQLSVEIMGFKKEELFPEVQIMDVKE----YLKNALESDLQLFI----    160
d2uaga1       46 ---LPEAVERH---------------------------TGSLNDEWLMAADLIV--ASPG     73

Query        161 --------------------    161
d2uaga1       74 IALAHPSLSAAADAGIEIVG     93


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:58.17)
Query          1 -GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLL-LRDPEKASQED     58
d2uaga1        1 ADYQGKNVVIIG--L----GLTGLSCVDFFLARGVTPRVMDTR-MTPPGL-D--------     44

Query         59 KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKF    118
d2uaga1       45 -------------------------------------------------K--LPE-AVER     52

Query        119 YAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI------------------    160
d2uaga1       53 HTGS---------------------L--NDEWLMAADLIVASPGIALAHPSLSAAADAGI     89

Query        161 ----    161
d2uaga1       90 EIVG     93


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.02)
DALI match                           
Query        100 KAPKLSDLLSGARKKEVKFY    119
d2uaga1       73 GIALAHPSLSAAADAGIEIV     92



hit structures. 
top
31: d1feca2 Trypanothione reductase (svm: 1.631)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.43  Contact: 581
Modified z-scores:
dali:0.90 daliz:0.89 gdtts:0.87 tmscore:0.89 rmsd:0.38 AHM:0.41 LBcontacta:0.84 LBcontactb:0.85 LHM:0.24
id:0.79 blosum:0.66 compass:0.72 pearson:0.94
Scaled scores:
dali:0.72 daliz:0.41 gdtts:0.53 tmscore:0.54 rmsd:0.75 AHM:0.65 LBcontacta:0.43 LBcontactb:0.65 LHM:0.34
id:0.04 blosum:0.12 compass:0.23 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:319.50)
Query          1 --------------GMENKKMNLLLfsgdydkALASLIIANAAREME---IEVTIFCAfw     43
d1feca2        1 gddlcitsneafylDEAPKRALCVG------gGYISIEFAGIFNAYKargGQVDLAYR--     52

Query         44 gLLLLrdpekasqedkslyeqafssltpreAEELPlskmnlggigkkmllemmkeekapK    103
d1feca2       53 -GDMI-------------------------LRGFD----------------------seL     64

Query        104 LSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqiMDVKEylknaLESDLQLFI---    160
d1feca2       65 RKQLTEQLRANGINVRTH---enpakvtknadgtrhvvFESGA----eADYDVVMLAigr    117


hit structure      alignment
FAST alignment (Normalized score: 3.76 Raw score:514.20)
Query          1 GMEN------------------KKMNLLLFSGDYDK---ALASLIIANAARE---MEIEV     36
d1feca2        1 ----GDDLCITSNEAFYLDEAPKRALC---------VGGGYISIEFAGIFNAYKARGGQV     47

Query         37 TIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMM     96
d1feca2       48 DLAYR-----------------------------GDMI----------------------     56

Query         97 KEEKAP-------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLK    149
d1feca2       57 ------LRGFDSELRKQLTEQLRANGINVR------------------------------     80

Query        150 NA-------------------------LESDLQLFI-----    160
d1feca2       81 --THENPAKVTKNADGTRHVVFESGAEADYDVVM--LAIGR    117


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:59.05)
Query          1 ---------------GMENKKMNLLLFSGDYDKALASLIIANAAREME-IEVTIFCAFWG     44
d1feca2        1 GDDLCITSNEAFYLD-EAPKRALCVG-GG--YISIEFAGIFNAYK-ARGGQVDLAYRG--     53

Query         45 LLLLRDPEKASQEDKSLYEQAFSSLTPR-EAEELPLSKMNLGGIGKKMLLEMMKEEKAPK    103
d1feca2       54 DMILR-------------------GFDSELRK----------------------------     66

Query        104 LSDLLSGARKKEVKFYAXQL---------------SVEIMGFKKEELFPEVQIMDV-KEY    147
d1feca2       67 QL-TEQ-LRANGINVRTHENPAKVTKNADGTRHVV-------------------FESGA-    104

Query        148 LKNALESDLQLFI---    160
d1feca2      105 -EA--DYDVVMLAIGR    117


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.02)
DALI match       *************   .********.  ...                             
Query         20 LASLIIANAAREM---EIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEE     76
d1feca2       28 YISIEFAGIFNAYKARGGQVDLAYRGDMILR-----------------------------     58

DALI match                                
Query         77 LPLSKMNLGGIGKKMLLEMMKEEKA    101
d1feca2       59 ------GFDSELRKQLTEQLRANGI     77



top
32: d1p3da1 UDP-​N-​acetylmuramate-​alanine ligase MurC (svm: 1.690)

SCOP Superfamily: MurCD N-​terminal domain  |  SCOP Fold: MurCD N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.58  Contact: 575
Modified z-scores:
dali:0.91 daliz:0.93 gdtts:0.91 tmscore:0.90 rmsd:0.29 AHM:0.34 LBcontacta:0.88 LBcontactb:0.87 LHM:0.19
id:0.72 blosum:0.69 compass:0.63 pearson:0.92
Scaled scores:
dali:0.77 daliz:0.53 gdtts:0.68 tmscore:0.66 rmsd:0.78 AHM:0.68 LBcontacta:0.53 LBcontactb:0.75 LHM:0.36
id:0.03 blosum:0.12 compass:0.20 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:318.50)
Query          1 ---GMEN-KKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCafwgLLLLrdpekasq     56
d1p3da1        1 iipEMRRvQQIHFIG-----igGAGMSGIAEILLNEGYQISGSD----IADG--------     43

Query         57 edkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsDLLSGARKKEV    116
d1p3da1       44 -------------------------------------------------VVTQRLAQAGA     54

Query        117 KFYAXqlsveimgfkkeelfpevqimdVKEYlknALESDLQLFI----------------    160
d1p3da1       55 KIYIG---------------------hAEEH---IEGASVVVVSsaikddnpelvtskqk     90

Query        161 ------    161
d1p3da1       91 ripviq     96


hit structure      alignment
FAST alignment (Normalized score: 4.53 Raw score:561.50)
Query          1 GMEN--------KKMNLLLFSGDYDK----ALASLIIANAAREMEIEVTIFCAFWGLLLL     48
d1p3da1        1 ----IIPEMRRVQQIHF---------IGIGGAGMSGIAEILLNEGYQISGS---------     38

Query         49 RDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK---LS    105
d1p3da1       39 -------------------------------------------------------DIADG     43

Query        106 DLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKE---YLKNALESDLQLFI--    160
d1p3da1       44 VVTQRLAQAGAKIY---------------------------IGHAEEHIEGASVVV--VS     74

Query        161 ----------------------    161
d1p3da1       75 SAIKDDNPELVTSKQKRIPVIQ     96


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:58.20)
Query          1 --GME--NKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d1p3da1        1 IIPEMRRVQQIHFIGI-----GGAGMSGIAEILLNEGYQISGSD----IA-DG-------     43

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLL-SGARKKE    115
d1p3da1       44 ------------------------------------------------V--VTQRLAQAG     53

Query        116 VKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI---------------    160
d1p3da1       54 AKIYIGH---------------------AEEHI-E--GASVVVVSSAIKDDNPELVTSKQ     89

Query        161 -------    161
d1p3da1       90 KRIPVIQ     96


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.14)
DALI match       ***************
Query         25 IANAAREMEIEVTIF     39
d1p3da1       24 IAEILLNEGYQISGS     38



top
33: d1h7wa4 Dihydropyrimidine dehydrogenase,​ domain 2 (svm: 1.691)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 650
Modified z-scores:
dali:0.93 daliz:0.94 gdtts:0.87 tmscore:0.89 rmsd:0.37 AHM:0.37 LBcontacta:0.92 LBcontactb:0.91 LHM:0.21
id:0.94 blosum:0.65 compass:0.66 pearson:0.89
Scaled scores:
dali:0.77 daliz:0.51 gdtts:0.53 tmscore:0.58 rmsd:0.77 AHM:0.72 LBcontacta:0.50 LBcontactb:0.72 LHM:0.37
id:0.07 blosum:0.11 compass:0.21 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:409.80)
Query          1 GMENKKMNLLLfsgdydkALASLIIANAAREMEI-EVTIFCAfwGLLLlrdpekasqedk     59
d1h7wa4        1 EAYSAKIALLG------aGPASISCASFLARLGYsDITIFEK--QEYV------------     40

Query         60 slyeqafssltpreaEELPLskmnlggigKKMLLemmkeekapKLSDLLSGARKKEVKFY    119
d1h7wa4       41 ------------gglSTSEI---------PQFRL------pydVVNFEIELMKDLGVKII     73

Query        120 AXqlsveimgfkkeelfpevqimdVKEYLKNA-LESDLQLFI------------------    160
d1h7wa4       74 CG----------------kslsenEITLNTLKeEGYKAAFIGiglpevlrdpkvkealsp    117

Query        161 ------------------------------------------------------------    161
d1h7wa4      118 ikfnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqyga    177

Query        161 -------------------    161
d1h7wa4      178 svsakpelplfytpvdlvd    196


hit structure      alignment
FAST alignment (Normalized score: 3.79 Raw score:670.30)
Query          1 GMENKKMNLLLFSGDYDK---ALASLIIANAAREME-IEVTIFCAFWGLLLLRDPEKASQ     56
d1h7wa4        1 EAYSAKIAL---------LGAGPASISCASFLARLGYSDITIFEK---------------     36

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNL------------GGIGKKMLLEMMKEEKAP--    102
d1h7wa4       37 ----------------------------QEYVGGLSTSEIPQFR--------------LP     54

Query        103 --KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQ--------IMDVKEYLKNAL    152
d1h7wa4       55 YDVVNFEIELMKDLGVKII---------------------CGKSLSENEITLNTLKE--E     91

Query        153 ESDLQLFI----------------------------------------------------    160
d1h7wa4       92 GYKAAF--IGIGLPEVLRDPKVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGM    149

Query        161 -----------------------------------------------    161
d1h7wa4      150 ANTTVESVNDGKQASWYIHKYIQAQYGASVSAKPELPLFYTPVDLVD    196


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:67.08)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEI-EVTIFCAFWGLLLLRDPEKASQEDK     59
d1h7wa4        1 EAYSAKIALLG-A-----GPASISCASFLARLGYSDITIFEKQ--EYVG-----------     41

Query         60 SLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLL---EMMKEEKAPKLSDLLSGARKKEV    116
d1h7wa4       42 -----------G--LSTSEI------PQ-FR--LPYD---------VVNFEIELMKDLGV     70

Query        117 KFYAXQL---SVEIMGFKKEELFPEVQIMDVKEYLKNAL--ESDLQLFI-----------    160
d1h7wa4       71 KIICGKSLSE-------------------NEITLNT-LKEEGYKAAFIGIGLPEVLRDPK    110

Query        161 ------------------------------------------------------------    161
d1h7wa4      111 VKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKY    170

Query        161 --------------------------    161
d1h7wa4      171 IQAQYGASVSAKPELPLFYTPVDLVD    196


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match       *************** *****
Query         20 LASLIIANAAREMEI-EVTIF     39
d1h7wa4       14 PASISCASFLARLGYSDITIF     34



top
34: d1vg0a1 Rab escort protein 1 (svm: 1.632)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 598
Modified z-scores:
dali:0.91 daliz:0.92 gdtts:0.92 tmscore:0.93 rmsd:0.37 AHM:0.34 LBcontacta:0.88 LBcontactb:0.90 LHM:0.28
id:0.83 blosum:0.12 compass:0.33 pearson:0.76
Scaled scores:
dali:0.77 daliz:0.48 gdtts:0.58 tmscore:0.62 rmsd:0.75 AHM:0.70 LBcontacta:0.44 LBcontactb:0.68 LHM:0.24
id:0.04 blosum:0.01 compass:0.08 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:400.60)
Query          1 --gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAFwgLLLLrdpekasqed     58
d1vg0a1        1 dnlpsdfDVIVIG------tGLPESIIAAACSRSGQRVLHVDSR--SYYG-----gnwas     47

Query         59 kslyeQAFSSLT--------------------------------------------prea     74
d1vg0a1       48 fsfsgLLSWLKEyqmwqeqileneeaiplsskdktiqhvevfcyasqritysqiikegrr    107

Query         75 eelPLSKmnlggigKKMLlEMMKeEKAP--------------------------------    102
d1vg0a1      108 fniDLVS-------KLLYsRGLL-IDLLiksnvsryaefknitrilafregtveqvpcsr    159

Query        103 ------------------------------------------------------------    103
d1vg0a1      160 advfnskqltmvekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvl    219

Query        103 ------------------------------------------KLSDLLSGARKKEVKFY-    119
d1vg0a1      220 hsiamettsctvdglkatkkflqclgrygntpflfplygqgeLPQCFCRMCAVFGGIYCl    279

Query        120 -AXQLsveimgfkkeelfpevqiMDVKEylknaLESDLQLFI------------------    160
d1vg0a1      280 rHSVQ---clvvdkesrkckaviDQFGQ----rIISKHFIIEdsylsentcsrvsrdcyn    332

Query        161 -------------------------------------------    161
d1vg0a1      333 dlpsnvyvcsgpdsglgndnavkqaetlfqqicpnedfcpapp    375


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:654.90)
Query          1 GMENK-------KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRD     50
d1vg0a1        1 -----DNLPSDFDVIV---------IGTGLPESIIAAACSRSGQRVLHVDS---------     37

Query         51 PEKASQE---------DKSLYEQAFSSLTPREAEELPLSKMNLGGIGKK-----------     90
d1vg0a1       38 -------RSYYGGNWASFSFSGLLSWL----------------------KEYQMWQEQIL     68

Query         91 ----------------------------------------------------MLLEMMKE     98
d1vg0a1       69 ENEEAIPLSSKDKTIQHVEVFCYASQRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLI    128

Query         99 EKAP--------------------------------------------------------    102
d1vg0a1      129 ----KSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCV    184

Query        103 ------------------------------------------------------------    103
d1vg0a1      185 EYEEHPDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMETTSCTVDGLKATKKFLQCL    244

Query        103 -----------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVK    145
d1vg0a1      245 GRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYC--------------------------    278

Query        146 EYLKNA---------------------------LESDLQLFI------------------    160
d1vg0a1      279 ------LRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFII-EDSYLSENTCSRVSRDCY    331

Query        161 --------------------------------------------    161
d1vg0a1      332 NDLPSNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFCPAPP    375


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:71.08)
Query          1 -----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF-WGLLL-LRDPEK     53
d1vg0a1        1 DNLPS----DFDVIVIGTG-LPESIIAAACSRSG----QRVLHVDSRS-YYGGN-WAS-F     48

Query         54 ASQE-DKSLYEQA---------------------F-------------------------     66
d1vg0a1       49 SFSGLLSWLKEYQMWQEQILENEEAIPLSSKDKTIQHVEVFCYASQRITYSQIIKEGRRF    108

Query         67 SSLTPREAEELPLSKMNLGGIGKK--MLLEMMKEEKAPK---------------------    103
d1vg0a1      109 -NIDL------V------SKL-LYSRGLLIDLL-IKSNVSRYAEFKNITRILAFREGTVE    153

Query        104 ------------------------------------------------------------    104
d1vg0a1      154 QVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEHPDEYRAYEGTTFSEYLKTQKLTPN    213

Query        104 ------------------------------------------------L-SDLLSGARKK    114
d1vg0a1      214 LQYFVLHSIAMETTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMCAVF    273

Query        115 EVKFYAXQLS----------------VEIMGFKKEELFPEVQIMDVKEYLKNALESDLQL    158
d1vg0a1      274 GGIYCLRHSVQCLVVDKESRKCKAVI-----------------DQFGQ--RI--IS-KHF    311

Query        159 FI----------------------------------------------------------    160
d1vg0a1      312 IIEDSYLSENTCSRVSRDCYNDLPSNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFC    371

Query        161 ----    161
d1vg0a1      372 PAPP    375


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.09)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1vg0a1       16 LPESIIAAACSRSGQRVLHV     35



top
35: d1rxwa2 Flap endonuclease-​1 (Fen-​1 nuclease) (svm: 1.423)

SCOP Superfamily: PIN domain-​like  |  SCOP Fold: PIN domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.35  Contact: 501
Modified z-scores:
dali:0.90 daliz:0.81 gdtts:0.65 tmscore:0.74 rmsd:0.58 AHM:0.59 LBcontacta:0.94 LBcontactb:0.94 LHM:0.29
id:0.95 blosum:0.42 compass:0.30 pearson:0.85
Scaled scores:
dali:0.72 daliz:0.35 gdtts:0.29 tmscore:0.29 rmsd:0.66 AHM:0.61 LBcontacta:0.49 LBcontactb:0.69 LHM:0.33
id:0.07 blosum:0.07 compass:0.12 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:317.90)
Query          1 ---------------GMENKKMNLLLF---SGDY-------------------DKALASL     23
d1rxwa2        1 adigdlfereeveleYFSGKKIAVDAFntlYQFIsiirqpdgtplkdsqgritSHLSGIL     60

Query         24 IIANAAREMEIEVTIFCAfwgllllrdpekasqeDKSLYEQAFSSLT---preaeelpls     80
d1rxwa2       61 YRVSNMVEVGIRPVFVFD-----------geppeFKKAEIEERKKRRaeaeemwiaalqa    109

Query         81 kmnLGGIgkkmllemmkeekapKLSDLLSGARkkeVKFYAXQLsveimgfkkeelfpevq    140
d1rxwa2      110 gdkDAKK-yaqaagrvdeyivdSAKTLLSYMG---IPFVDAPS-----------------    148

Query        141 imdVKEYLKNAL--ESDLQLF-----------------------------------i    160
d1rxwa2      149 -egEAQAAYMAAkgDVEYTGSqdydsllfgsprlarnlaidvkpeiiilesnlkrlg    204


hit structure      alignment
FAST alignment (Normalized score: 3.40 Raw score:613.40)
Query          1 ---------------GMENKKMNLLLFSGD--------------------------YDKA     19
d1rxwa2        1 ADIGDLFEREEVELEYFSGKKIAVDA----FNTLYQFISIIRQPDGTPLKDSQGRITSHL     56

Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1rxwa2       57 SGILYRVSNMVEVGIRPVFVF---------------------------------------     77

Query         80 SKMNLG--------GIGKKMLLEMMKEEKAPK----------------------------    103
d1rxwa2       78 ------DGEPPEFKKAEIEERKKRRAE-----AEEMWIAALQAGDKDAKKYAQAAGRVDE    126

Query        104 --LSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIM--DVKEYLKNAL--ESDLQ    157
d1rxwa2      127 YIVDSAKTLLSYMGIPFVDAP--------------------SEGEAQAAYMAAKGDVEYT    166

Query        158 LFI--------------------------------------    160
d1rxwa2      167 ---GSQDYDSLLFGSPRLARNLAIDVKPEIIILESNLKRLG    204


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:59.07)
Query          1 --------------G-MENKKMNLLLFS-GD-YDK------------------AL-ASL-     23
d1rxwa2        1 ADIGDLFEREEVELEYFSGKKIAVDAFNTLYQFISIIRQPDGTPLKDSQGRITSHLSGIL     60

Query         24 IIANAAREMEIEVTIFCAFW---------------GLLLLRDPEKASQEDKSLYEQAFSS     68
d1rxwa2       61 YRVSNMVEVGIRPVFVFDGEPPEFKKAEIEERKKR-------------------------     95

Query         69 LTPREAEELP--LSKMN-LG--GI------GK--KML---------LEMMKEEKAPKL--    104
d1rxwa2       96 ---------RAE--AEEMWIAA-LQAGDKDAKKY--AQAAGRVDEY-----------IVD    130

Query        105 SDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNAL---ESDLQLFI-    160
d1rxwa2      131 SAKTL-LSYMGIPFVDAPSE-----------------GEA-QAAYMAAKGDVEYTGSQDY    171

Query        161 ---------------------------------    161
d1rxwa2      172 DSLLFGSPRLARNLAIDVKPEIIILESNLKRLG    204


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.26)
DALI match       .........   ****
Query        104 LSDLLSGARKKEVKFY    119
d1rxwa2      129 VDSAKTLLSYMGIPFV    144



hit structures. 
top
36: d1v6sa_ Phosphoglycerate kinase (svm: 1.292)

SCOP Superfamily: Phosphoglycerate kinase  |  SCOP Fold: Phosphoglycerate kinase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.41  Contact: 660
Modified z-scores:
dali:0.91 daliz:0.93 gdtts:0.85 tmscore:0.86 rmsd:0.35 AHM:0.37 LBcontacta:0.91 LBcontactb:0.91 LHM:0.34
id:0.71 blosum:0.55 compass:0.71 pearson:0.95
Scaled scores:
dali:0.75 daliz:0.47 gdtts:0.51 tmscore:0.54 rmsd:0.76 AHM:0.69 LBcontacta:0.52 LBcontactb:0.78 LHM:0.21
id:0.01 blosum:0.10 compass:0.24 pearson:0.32

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:461.10)
Query          1 ------------------------------------------------------------      1
d1v6sa_        1 mrtlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgr     60

Query          1 ------------------------------------------------------------      1
d1v6sa_       61 pkgpdpkyslapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepge    120

Query          1 -----------------------------------------------------------G      1
d1v6sa_      121 ekndpelsaryarlgeafvldafgsahrahasvvgvarllpayagflmekevralsrllK    180

Query          2 MENKKMNLLLFSGDYDKALASLIIANAAremeiEVTIFCAFWGLLLL-RDPEkasqedks     60
d1v6sa_      181 DPERPYAVVLGGAKVSDKIGVIESLLPR-----IDRLLIGGAMAFTFlKALG--------    227

Query         61 lyeqafSSLTPreaeelplskmnlggigkkmllemmkeekapKLSDLLSGARKKEVKFYA    120
d1v6sa_      228 ----geVGRSL------------------------veedrldLAKDLLGRAEALGVRVYL    259

Query        121 XQlsVEIM-------------GFKK---eelfpevqimDVKEYLKNALESDLQLFI----    160
d1v6sa_      260 PE--DVVAaerieagvetrvfPARAipvpymgldigpkTREAFARALEGARTVFWNgpmg    317

Query        161 ------------------------------------------------------------    161
d1v6sa_      318 vfevppfdegtlavgqaiaalegaftvvgggdsvaavnrlglkerfghvstgggaslefl    377

Query        161 -------------    161
d1v6sa_      378 ekgtlpglevleg    390


hit structure      alignment
FAST alignment (Normalized score: 2.85 Raw score:711.00)
Query          1 GM----------------------------------------------------------      2
d1v6sa_        1 --MRTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHL     58

Query          3 ------------------------------------------------------------      3
d1v6sa_       59 GRPKGPDPKYSLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEP    118

Query          3 ------------------------------------------------------------      3
d1v6sa_      119 GEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRL    178

Query          3 ---ENKKMNLLLFSGDYDKALASLIIANAAREMEIE--VTIFCAFWGLLLLRDPEKASQE     57
d1v6sa_      179 LKDPERPYAVVLGGA---KVSDKIGVIESLLP----RIDRLLIGGAMAFT----------    221

Query         58 DKSLYEQAF--------SSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP-------    102
d1v6sa_      222 ---------FLKALGGEVGRSL-------------------------------VEEDRLD    241

Query        103 KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIM--------------------    142
d1v6sa_      242 LAKDLLGRAEALGVRVYLPE--------------------DVVAAERIEAGVETRVFPAR    281

Query        143 --------------DVKEYLKNALESDLQLFI----------------------------    160
d1v6sa_      282 AIPVPYMGLDIGPKTREAFARALEGARTVF--WNGPMGVFEVPPFDEGTLAVGQAIAALE    339

Query        161 ---------------------------------------------------    161
d1v6sa_      340 GAFTVVGGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLEG    390


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:60.50)
Query          1 ------------------------------------------------------------      1
d1v6sa_        1 MRTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLGR     60

Query          1 ------------------------------------------------------------      1
d1v6sa_       61 PKGPDPKYSLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEPGE    120

Query          1 ------------------------------------------------------------      1
d1v6sa_      121 EKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRLLK    180

Query          1 GMENK-KMNLLL-----------------------FS-----------------------     13
d1v6sa_      181 -DPERPYAVVLGGAKVSDKIGVIESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDR    239

Query         14 ---------------------------------------------------GD-YDKALA     21
d1v6sa_      240 LDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVETRVFPARAIPVPYMGLDIGPKTREA    299

Query         22 SLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSK     81
d1v6sa_      300 FARALEGAR----TVFWN-GPMGVF----------------E--V--PPFDEGTLA----    330

Query         82 MNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYAXQLSVEIMGFKKEEL-FPE-V    139
d1v6sa_      331 ----------------------VGQAIAAL-EGAFTVVGGG-DSV---AAVNRLGLKERF    363

Query        140 --QIM-DVKEYLKNALE----------SDLQLFI    160
d1v6sa_      364 GHVSTGGGASLEFLEKGTLPGLEVLEG-------    390


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.04)
DALI match                                 ********************. .           
Query         85 GGIGKKMLLEM--------MKEEKAPKLSDLLSGARKKEVKFYAXQLSV-----------    125
d1v6sa_      216 GAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVET    275

DALI match             ....          *****************
Query        126 ---EIMGFKKEELFPEVQIMDVKEYLKNALESDLQLF    159
d1v6sa_      276 RVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFW    312



top
37: d1k0ia1 p-​Hydroxybenzoate hydroxylase,​ PHBH (svm: 1.693)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.41  Contact: 559
Modified z-scores:
dali:0.89 daliz:0.94 gdtts:0.90 tmscore:0.90 rmsd:0.32 AHM:0.30 LBcontacta:0.90 LBcontactb:0.86 LHM:0.29
id:0.67 blosum:0.53 compass:0.66 pearson:0.90
Scaled scores:
dali:0.80 daliz:0.56 gdtts:0.63 tmscore:0.66 rmsd:0.77 AHM:0.73 LBcontacta:0.56 LBcontactb:0.73 LHM:0.21
id:0.02 blosum:0.08 compass:0.21 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.3 Raw score:413.00)
Query          1 gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLrdpekasqedks     60
d1k0ia1        1 --mktQVAIIG------aGPSGLLLGQLLHKAGIDNVILER---QTPD------------     37

Query         61 lyeqafssltprEAEELPLskmnlggigKKMLleMMKEE---------------------     99
d1k0ia1       38 ------------YVLGRIR---------AGVL-eQGMVDllreagvdrrmardglvhegv     75

Query        100 --------------------------kapKLSDLLSGARKKEVKFY-AXQLsveimgfkk    132
d1k0ia1       76 eiafagqrrridlkrlsggktvtvygqteVTRDLMEAREACGATTVyQAAE----vrlhd    131

Query        133 eelfpevqiMDVK-eyLKNAleSDLQLFI-------------------------------    160
d1k0ia1      132 lqgerpyvtFERDgerLRLD--CDYIAGCdgfhgisrqsipaermqhgrlflagdaahiv    189

Query        161 ------------------------------------------------------------    161
d1k0ia1      190 pptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlh    249

Query        161 -------------------------------------------    161
d1k0ia1      250 rfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie    292


hit structure      alignment
FAST alignment (Normalized score: 3.00 Raw score:647.60)
Query          1 GMENK---KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKA     54
d1k0ia1        1 -----MKTQVAI---------IGAGPSGLLLGQLLHKAGIDNVILER-------------     33

Query         55 SQEDKSLYEQAFSSLTPR----EAEELPLSKMNLGGIGKKML-----LEMMKEEKAP---    102
d1k0ia1       34 ------------------QTPDYVLGRI--------------RAGVLEQGMVD----LLR     57

Query        103 -----------------------------------------------KLSDLLSGARKKE    115
d1k0ia1       58 EAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACG    117

Query        116 VKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA------------------------    151
d1k0ia1      118 ATTV--------------------------------YQAAEVRLHDLQGERPYVTFERDG    145

Query        152 ----LESDLQLFI-----------------------------------------------    160
d1k0ia1      146 ERLRLDCDYIA--GCDGFHGISRQSIPAERMQHGRLFLAGDAAHIVPPTGAKGLNLAASD    203

Query        161 ------------------------------------------------------------    161
d1k0ia1      204 VSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQ    263

Query        161 -----------------------------    161
d1k0ia1      264 TELEYYLGSEAGLATIAENYVGLPYEEIE    292


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:72.98)
Query          1 --GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQED     58
d1k0ia1        1 MK----TQVAIIG------AGPSGLLLGQLLHKAGIDNVILER---QT-PD---------     37

Query         59 KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM---M---------------K-E-     98
d1k0ia1       38 ------------Y-VL-GRIR---------A--GVLEQGMVDLLREAGVDRRMARDGLVH     72

Query         99 -------------------------EKA---PKLSDLLSGARKKEVKFY-AXQLS-----    124
d1k0ia1       73 EGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDL    132

Query        125 ---------VEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLF-I--------------    160
d1k0ia1      133 QGERPYVTF---------------ERDGERL--RL--DCDYIAGCDGFHGISRQSIPAER    173

Query        161 ------------------------------------------------------------    161
d1k0ia1      174 MQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRR    233

Query        161 -----------------------------------------------------------    161
d1k0ia1      234 IWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE    292


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.08)
DALI match       *******************
Query         21 ASLIIANAAREMEIEVTIF     39
d1k0ia1       13 SGLLLGQLLHKAGIDNVIL     31



top
38: d1qfja2 NAD(P)H:flavin oxidoreductase (svm: 0.724)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 649
Modified z-scores:
dali:0.89 daliz:0.87 gdtts:0.88 tmscore:0.89 rmsd:0.35 AHM:0.38 LBcontacta:0.79 LBcontactb:0.86 LHM:0.16
id:0.94 blosum:0.63 compass:0.55 pearson:0.91
Scaled scores:
dali:0.71 daliz:0.39 gdtts:0.53 tmscore:0.55 rmsd:0.76 AHM:0.68 LBcontacta:0.38 LBcontactb:0.64 LHM:0.43
id:0.08 blosum:0.12 compass:0.21 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:334.40)
Query          1 -GMENKKMNLLLFSGdydKALASLIIANAAREME--IEVTIFCAF---wgLLLLrdpeka     54
d1qfja2        1 rDDEERPMILIAGGT---GFSYARSILLTALARNpnRDITIYWGGreeqhLYDL------     51

Query         55 sqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdlLSGARKK    114
d1qfja2       52 --------------------------------------------------celEALSLKH     61

Query        115 E-VKFYAXqlSVEImGFKKeelfpevQIMD--VKEYLKN--aLESDLQLFI---------    160
d1qfja2       62 PgLQVVPV--VEQPeAGWR-------GRTGtvLTAVLQDhgtLAEHDIYIAgrfemakia    112

Query        161 -----------------------    161
d1qfja2      113 rdlfcsernaredrlfgdafafi    135


hit structure      alignment
FAST alignment (Normalized score: 3.90 Raw score:572.40)
Query          1 -GMENKKMNLLLFSGDYDKALASLIIANAARE--MEIEVTIFCAFWGLLLLRDPEKASQE     57
d1qfja2        1 RDDEERPMILIAG---GTGFSYARSILLTALARNPNRDITIYW-----------------     40

Query         58 DKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK----------LSDL    107
d1qfja2       41 ----------------------------------------------GGREEQHLYDLCEL     54

Query        108 LSGARKK-EVKFYAXQLSVEIMGFKKEELFPEVQIM--------------DVKEYLKNAL    152
d1qfja2       55 EALSLKHPGLQVVPV---------------------VEQPEAGWRGRTGTVLTAVLQDH-     92

Query        153 ES-----DLQLFI----------------------------------    160
d1qfja2       93 --GTLAEHDIY--IAGRFEMAKIARDLFCSERNAREDRLFGDAFAFI    135


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:66.96)
Query          1 -GMENKKMNLLLFSGDYDKALASLIIANAAREME--IEVTIFCAFWGL-LLLRDPEKASQ     56
d1qfja2        1 RDDEERPMILIAGG-T--GFSYARSILLTALARNPNRDITIYWGGREEQHL---------     48

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGAR-KKE    115
d1qfja2       49 ----------------YDL-----------------------------CE-LEALSLKHP     62

Query        116 -VKFYAXQLSVEIMG-FKKEELFPEVQIMD--VKEYL--KNAL-ESDLQLFI--------    160
d1qfja2       63 GLQVVPV-VE--QPEAGWR-------GRTGTVLTAVLQDHGTLAEHDIYIAGRFEMAKIA    112

Query        161 -----------------------    161
d1qfja2      113 RDLFCSERNAREDRLFGDAFAFI    135


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.26)
DALI match       ............ . ................*********
Query          3 ENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1qfja2        3 DEERPMILIAGGTGFSYARSILLTALARNPNRDITIYWGG     42



top
39: d1ep3b2 Dihydroorotate dehydrogenase B,​ PyrK subunit (svm: 1.505)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 660
Modified z-scores:
dali:0.89 daliz:0.91 gdtts:0.90 tmscore:0.89 rmsd:0.29 AHM:0.31 LBcontacta:0.88 LBcontactb:0.87 LHM:0.24
id:0.82 blosum:0.48 compass:0.57 pearson:0.89
Scaled scores:
dali:0.75 daliz:0.48 gdtts:0.62 tmscore:0.66 rmsd:0.80 AHM:0.73 LBcontacta:0.52 LBcontactb:0.74 LHM:0.35
id:0.04 blosum:0.08 compass:0.19 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:351.00)
Query          1 ----gMENKKMNLLLFSGdydKALASLIIANAAREMEIEVTIFCAF---wgLLLLrdpek     53
d1ep3b2        1 pvaevTSTDKILIIGGGI---GVPPLYELAKQLEKTGCQMTILLGFasenvKILE-----     52

Query         54 asqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdllSGARK    113
d1ep3b2       53 -------------------------------------------------------NEFSN     57

Query        114 KE-VKFYAXqlSVEIMgfkkeelfpevqimdVKEYLKNALESDLQLFI------------    160
d1ep3b2       58 LKnVTLKIA--TDDGS--------ygtkghvGMLMNEIDFEVDALYTCgapamlkavakk    107

Query        161 -----------------------------------------------------    161
d1ep3b2      108 ydqlerlyismesrmacgigacyacvehdkedeshalkvcedgpvflgkqlsl    160


hit structure      alignment
FAST alignment (Normalized score: 3.84 Raw score:613.70)
Query          1 ----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d1ep3b2        1 PVAEVTSTDKILIIGG---GIGVPPLYELAKQLEKTGCQMTILL----------------     41

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLS--------DLL    108
d1ep3b2       42 -------------------------------------------------GFASENVKILE     52

Query        109 SGARK-KEVKFYAXQLSVEIMGFKKEELFPEVQIM-----------DVKEYLKNA---LE    153
d1ep3b2       53 NEFSNLKNVTLKIA---------------------TDDGSYGTKGHVGMLMN---EIDFE     88

Query        154 SDLQLFI-----------------------------------------------------    160
d1ep3b2       89 VDALY--TCGAPAMLKAVAKKYDQLERLYISMESRMACGIGACYACVEHDKEDESHALKV    146

Query        161 --------------    161
d1ep3b2      147 CEDGPVFLGKQLSL    160


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:68.15)
Query          1 ----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQ     56
d1ep3b2        1 PVAEVTSTDKILIIGG-GI--GVPPLYELAKQLEKTGCQMTILLGFA-------------     44

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKE-    115
d1ep3b2       45 ---------SE--NV-KI------------------------------L--ENEFSNLKN     60

Query        116 VKFYAXQLSVEIMGFKKE-----ELFPEVQIMDVKEYLKNALESDLQLFI----------    160
d1ep3b2       61 VTLKIA---T-DDGSYGTKGHVG--------MLMNEI-DF--EVDALYTCGAPAMLKAVA    105

Query        161 -------------------------------------------------------    161
d1ep3b2      106 KKYDQLERLYISMESRMACGIGACYACVEHDKEDESHALKVCEDGPVFLGKQLSL    160


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.30)
DALI match       ********************
Query         21 ASLIIANAAREMEIEVTIFC     40
d1ep3b2       22 PLYELAKQLEKTGCQMTILL     41



top
40: d1tq8a_ Hypothetical protein Rv1636 (svm: 1.087)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.51  Contact: 654
Modified z-scores:
dali:0.91 daliz:0.90 gdtts:0.86 tmscore:0.88 rmsd:0.36 AHM:0.35 LBcontacta:0.83 LBcontactb:0.85 LHM:0.20
id:0.95 blosum:0.74 compass:0.55 pearson:0.90
Scaled scores:
dali:0.72 daliz:0.42 gdtts:0.50 tmscore:0.52 rmsd:0.74 AHM:0.67 LBcontacta:0.42 LBcontactb:0.63 LHM:0.34
id:0.10 blosum:0.13 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:317.20)
Query          1 -GMENKKMNLLLFSgdYDKALASLIIANAAREMEIEVTIFCAF----wgLLLLrdpekas     55
d1tq8a_        1 sLSAYKTVVVGTDG--SDSSMRAVDRAAQIAGADAKLIIASAYlptapiYEIL-------     51

Query         56 qedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdlLSGARK--    113
d1tq8a_       52 -------------------------------------------------hdaKERAHNag     62

Query        114 -KEVKFYAXQLsveimgfkkeelfpevqimDVKEYLKNAL--ESDLQLFI----------    160
d1tq8a_       63 aKNVEERPIVG------------------aPVDALVNLADeeKADLLVVGnvglstiagr    104

Query        161 -----------------------    161
d1tq8a_      105 llgsvpanvsrrakvdvlivhtt    127


hit structure      alignment
FAST alignment (Normalized score: 3.56 Raw score:507.30)
Query          1 GMEN-----KKMNLLLFSGD--YDKALASLIIANAAREMEIEVTIFCA-----FWGLLLL     48
d1tq8a_        1 ----SLSAYKTVVVGT----DGSDSSMRAVDRAAQIAGADAKLIIAS-AYLPTAPIY---     48

Query         49 RDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK--LSD    106
d1tq8a_       49 -------------------------------------------------------EILHD     53

Query        107 LLSGARK---KEVKFYAXQLSVEIMGFKKEELFPEVQIM--DVKEYLKNAL--ESDLQLF    159
d1tq8a_       54 AKERAHNAGAKNVEERPIV--------------------GAPVDALVNLADEEKADLLVV     93

Query        160 I----------------------------------    160
d1tq8a_       94 -GNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT    127


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:61.20)
Query          1 --GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFW---GL-LLLRDPEKA     54
d1tq8a_        1 SLSA-YKTVVVGT-DGS-DSSMRAVDRAAQIAGADAKLIIASAYLPTAPIYEILH-----     52

Query         55 SQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKK    114
d1tq8a_       53 -------------------D-----------------------------AKERAHNAGAK     64

Query        115 EVKFYAXQLS--VEIMGFKKEELFPEVQIMDVKEYLKNAL--ESDLQLFI----------    160
d1tq8a_       65 NVEERPIVGAPV------------------DA--LVNLADEEKADLLVVGNVGLSTIAGR    104

Query        161 -----------------------    161
d1tq8a_      105 LLGSVPANVSRRAKVDVLIVHTT    127


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.51)
DALI match       ............ ...........................
Query          2 MENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCA     41
d1tq8a_        2 LSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAY     41



hit structures. 
top
41: d1otha2 Ornithine transcarbamoylase (svm: 1.482)

SCOP Superfamily: Aspartate/​ornithine carbamoyltransferase  |  SCOP Fold: ATC-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 601
Modified z-scores:
dali:0.91 daliz:0.95 gdtts:0.91 tmscore:0.90 rmsd:0.26 AHM:0.26 LBcontacta:0.89 LBcontactb:0.83 LHM:0.21
id:0.64 blosum:0.34 compass:0.58 pearson:0.84
Scaled scores:
dali:0.77 daliz:0.53 gdtts:0.67 tmscore:0.68 rmsd:0.80 AHM:0.74 LBcontacta:0.55 LBcontactb:0.69 LHM:0.30
id:-0.01 blosum:0.03 compass:0.16 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:354.30)
Query          1 GMENKKMNLLLFsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLrdpekasqedks     60
d1otha2        1 SLKGLTLSWIGD-----gNNILHSIMMSAAKFGMHLQAATP---KGYE------------     40

Query         61 lyeqafssltpreaeelplskmnlggigkkmllemmkeekapkLSDLLSGARKKE-----    115
d1otha2       41 ------------------------------------------pDASVTKLAEQYAkengt     58

Query        116 -VKFYAXqlsveimgfkkeelfpevqimdvkeYLKNALESDLQLFI--------------    160
d1otha2       59 kLLLTND-------------------------PLEAAHGGNVLITDtwismgreeekkkr     93

Query        161 ------------------------------------------------------------    161
d1otha2       94 lqafqgyqvtmktakvaasdwtflhclprkpeevddevfysprslvfpeaenrkwtimav    153

Query        161 -----------------    161
d1otha2      154 mvslltdyspqlqkpkf    170


hit structure      alignment
FAST alignment (Normalized score: 3.21 Raw score:529.00)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1otha2        1 SLKGLTLSW-IGDG-NNILHSIMM---SAAKFGMHLQAATPK------------------     37

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP-------KLSDLLSGARK    113
d1otha2       38 ------------------------------------------GYEPDASVTKLAEQYAKE     55

Query        114 K--EVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI-----------    160
d1otha2       56 NGTKLLLT----------------------NDPLEA---AHGGNVLI--TDTWISMGREE     88

Query        161 ------------------------------------------------------------    161
d1otha2       89 EKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW    148

Query        161 ----------------------    161
d1otha2      149 TIMAVMVSLLTDYSPQLQKPKF    170


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:61.21)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1otha2        1 SLKGLTLSWIG-DG----NNILHSIMMSAAKFGMHLQAATP---KGYE------------     40

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKE-----    115
d1otha2       41 -------------P-----------------------------DASVTKLAEQYAKENGT     58

Query        116 -VKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI--------------    160
d1otha2       59 KLLLTND----------------------PLEAA-H--GGNVLITDTWISMGREEEKKKR     93

Query        161 ------------------------------------------------------------    161
d1otha2       94 LQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAV    153

Query        161 -----------------    161
d1otha2      154 MVSLLTDYSPQLQKPKF    170


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.10)
DALI match                         
Query        104 LSDLLSGARKKEVKFYAX    121
d1otha2       17 LHSIMMSAAKFGMHLQAA     34



top
42: d1g5ta_ ATP:corrinoid adenosyltransferase CobA (svm: 0.702)

SCOP Superfamily: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Fold: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 423
Modified z-scores:
dali:0.88 daliz:0.91 gdtts:0.89 tmscore:0.88 rmsd:0.31 AHM:0.36 LBcontacta:0.80 LBcontactb:0.79 LHM:0.44
id:0.76 blosum:0.39 compass:0.55 pearson:0.85
Scaled scores:
dali:0.75 daliz:0.51 gdtts:0.62 tmscore:0.64 rmsd:0.77 AHM:0.69 LBcontacta:0.42 LBcontactb:0.60 LHM:0.16
id:0.05 blosum:0.07 compass:0.18 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:328.20)
Query          1 gmenkkmnlllfsgdyDKALASLIIANAAREMEIEVTIFCAFWgllllrdpekasqedks     60
d1g5ta_        1 ---ergiiivftgngkGKTTAAFGTAARAVGHGKNVGVVQFIK-----------------     40

Query         61 lyeqafssltPREAeelplskmnlggigkkmllemmkeekapklsDLLSGARKKEVKFYA    120
d1g5ta_       41 ---------gTWPN-------------------------------GERNLLEPHGVEFQV     60

Query        121 XqlsVEIMGF--kkeelfpevqimDVKEYLKNALE-------------------------    153
d1g5ta_       61 M---ATGFTWetqnreadtaacmaVWQHGKRMLADplldmvvldeltymvaydylpleev    117

Query        154 ---------sDLQLFI------------------------    160
d1g5ta_      118 isalnarpghQTVIITgrgchrdildladtvselrpvkha    157


hit structure      alignment
FAST alignment (Normalized score: 3.32 Raw score:525.50)
Query          1 GMENKKMNLLLFSGDY-------------DKALASLIIANAAREMEIEVTIFCAFWGLLL     47
d1g5ta_        1 ----------------ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQF------     38

Query         48 LRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKL---    104
d1g5ta_       39 ---------------------------------------------------------IKG     41

Query        105 ---SDLLSGARKKEVKFYAX----------------------------------------    121
d1g5ta_       42 TWPNGERNLLEPHGVEFQV-MATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVL    100

Query        122 --QLSVEIMGFKKEELFPEVQI--MDVKEYLKNALES---DLQLFI--------------    160
d1g5ta_      101 DELTYMVAY-------------DYLPLEEVISALNARPGHQTVI--ITGRGCHRDILDLA    145

Query        161 ------------    161
d1g5ta_      146 DTVSELRPVKHA    157


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.61)
Query          1 GMENKKMNLLLFS-GDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDK     59
d1g5ta_        1 -E--RGIIIVFTGN-GKGKTTAAFGTAARAVGHGKNVGVVQFI--KG-TWP---------     44

Query         60 SLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLL-SGARKKEVKF    118
d1g5ta_       45 --------------N------------------------------G--ERNLLEPHGVEF     58

Query        119 YAXQLSVEIMG-------------FKKEELFPEVQIMDVKEYLKNALE--S---------    154
d1g5ta_       59 QVMA--TGFTWETQNREADTAACM------------AVWQHGKRMLADPLLDMVVLDELT    104

Query        155 -----------------------DLQLFI------------------------    160
d1g5ta_      105 YMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA    157


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.04)
DALI match                    ************************
Query          4 NKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFC     40
d1g5ta_        1 ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQ     37



top
43: d1fcda2 Flavocytochrome c sulfide dehydrogenase,​ FCSD,​ flavin-​binding subunit (svm: 1.692)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.35  Contact: 584
Modified z-scores:
dali:0.90 daliz:0.90 gdtts:0.89 tmscore:0.89 rmsd:0.33 AHM:0.34 LBcontacta:0.83 LBcontactb:0.82 LHM:0.16
id:0.85 blosum:0.58 compass:0.40 pearson:0.77
Scaled scores:
dali:0.73 daliz:0.43 gdtts:0.59 tmscore:0.59 rmsd:0.75 AHM:0.68 LBcontacta:0.42 LBcontactb:0.60 LHM:0.44
id:0.06 blosum:0.11 compass:0.14 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:315.10)
Query          1 -----------------------------gMENKKMNLLLFS-gDYDKaLASLIIANAAR     30
d1fcda2        1 gyseeaaaklphawkageqtailrkqledmADGGTVVIAPPAapFRCP-PGPYERASQVA     59

Query         31 EME------IEVTIFCAfwGLLLlrdpekasqedkslyeqafssltpreaeelplskmnl     84
d1fcda2       60 YYLkahkpmSKVIILDS--SQTF-------------------------------------     80

Query         85 ggigkkmllemmkeekapKLSDLLSGARKKE--------VKFYAXQLsveimgfkkeelf    136
d1fcda2       81 -----------------sKQSQFSKGWERLYgfgtenamIEWHPGPD----savvkvdgg    119

Query        137 pevqiMDVKEylknaLESDLQLFI--    160
d1fcda2      120 emmveTAFGD----eFKADVINLIpp    141


hit structure      alignment
FAST alignment (Normalized score: 3.49 Raw score:524.00)
Query          1 -----------------------------GMENKKMNLLLFSG-------DYDKALASLI     24
d1fcda2        1 GYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAP---PAAPFRCPPGPYERASQ     57

Query         25 IANAARE--MEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKM     82
d1fcda2       58 VAYYLKAHKPMSKVIILD------------------------------------------     75

Query         83 NLGGIGKKMLLEMMKEEKAP------KLSDLLSGARKK---------EVKFYAXQLSVEI    127
d1fcda2       76 --------------------SSQTFSKQSQFSKGWER-LYGFGTENAMIEWHP-------    107

Query        128 MGFKKEELFPEVQI-----------------MDVKEYLKNA--LESDLQLFI----    160
d1fcda2      108 --------------GPDSAVVKVDGGEMMVETAFG------DEFKADVIN--LIPP    141


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:64.98)
Query          1 -----------------------------GMENKKMNLLLFS----GDYDKALASLIIAN     27
d1fcda2        1 GYSEEAAAKLPHAWKAGEQTAILRKQLEDMADGGTVVIAPPAAPFRCPPGPYERASQVAY     60

Query         28 AARE-M--EIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNL     84
d1fcda2       61 YL-KAHKPMSKVIILDSS--QTF-----------------------S-KQS---------     84

Query         85 GGIGKKMLLEMMKEEKAPKLSDLLS-GA-R-K--KEVKFYAXQLSV------------EI    127
d1fcda2       85 ------------------QFSKGWERLYGFGTENAMIEWHPGPDSAVVKVDGGEMMVE--    124

Query        128 MGFKKEELFPEVQIMDVKEYLKNALESDLQLFI--    160
d1fcda2      125 --------------TAFGD--EF--KADVINLIPP    141


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.53)
DALI match                                                  
Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK    103
d1fcda2       38 IAPPAAPFRCPPGPYERA-----------SQVAYYLKAHKPMS     69



top
44: d1ojta2 Dihydrolipoamide dehydrogenase (svm: 1.631)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 538
Modified z-scores:
dali:0.89 daliz:0.88 gdtts:0.86 tmscore:0.88 rmsd:0.36 AHM:0.39 LBcontacta:0.81 LBcontactb:0.83 LHM:0.22
id:0.65 blosum:0.46 compass:0.66 pearson:0.90
Scaled scores:
dali:0.72 daliz:0.41 gdtts:0.54 tmscore:0.55 rmsd:0.75 AHM:0.65 LBcontacta:0.42 LBcontactb:0.64 LHM:0.36
id:0.01 blosum:0.07 compass:0.20 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:296.80)
Query          1 ----------------------GMENKKMNLLLfsgdydkALASLIIANAAREMEIEVTI     38
d1ojta2        1 vtklpfipedpriidssgalalKEVPGKLLIIG------gGIIGLEMGTVYSTLGSRLDV     54

Query         39 FCAfwgLLLLrdpekasqedkslyeqafssltpreAEELplskmnlggigkkmllemmke     98
d1ojta2       55 VEM---MDGL-----------------------mqGADR---------------------     67

Query         99 ekapKLSDLLSGARkKEVK-FYAXqlsveimgfkkeelfpevqIMDVKE-----------    146
d1ojta2       68 ---dLVKVWQKQNE-YRFDnIMVN-------------------TKTVAVepkedgvyvtf    104

Query        147 ----ylknaLESDLQLFI---    160
d1ojta2      105 eganapkepQRYDAVLVAagr    125


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:378.20)
Query          1 GMEN--------------------------KKMNLLLFSGDYDK---ALASLIIANAARE     31
d1ojta2        1 ----VTKLPFIPEDPRIIDSSGALALKEVPGKLLI---------IGGGIIGLEMGTVYST     47

Query         32 MEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKM     91
d1ojta2       48 LGSRLDVVEMM-------------------------------------------------     58

Query         92 LLEMMKEEK-----APKLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEV-------    139
d1ojta2       59 ---------DGLMQGADRDLVKVWQKQ--------------------------NEYRFDN     83

Query        140 --QIMDVKEYLKNA------------------------LESDLQLFI-----    160
d1ojta2       84 IMVNTK--------TVAVEPKEDGVYVTFEGANAPKEPQRYDAVL--VAAGR    125


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:60.83)
Query          1 -----------------------GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVT     37
d1ojta2        1 VTKLPFIPEDPRIIDSSGALALKEV-PGKLLIIG-G-----GIIGLEMGTVYSTLGSRLD     53

Query         38 IFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEEL-PLSKMNLGGIGKKMLLEMM     96
d1ojta2       54 VVEM-M-DGLM----------------------Q--GADRD-------------------     68

Query         97 KEEKAPKLS-DLLSGARKKEV-KFYA-XQ-----------------LSVEIMGFKKEELF    136
d1ojta2       69 -------LVKVWQKQNE-YRFDNIMVNTKTVAVEPKEDGVYVTFEG--------------    106

Query        137 PEVQIMDVKEYLKNALESDLQLF-I--    160
d1ojta2      107 ---ANAP-KE--PQ--RYDAVLVAAGR    125


hit structure      alignment
HHsearch alignment (Probability: 0.15 E-value:0.01)
DALI match       **********************.  ...                                
Query         20 LASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPL     79
d1ojta2       36 IIGLEMGTVYSTLGSRLDVVEMMDGLMQ--------------------------------     63

DALI match                             
Query         80 SKMNLGGIGKKMLLEMMKEEKA    101
d1ojta2       64 ---GADRDLVKVWQKQNEYRFD     82



top
45: d1saya1 L-​alanine dehydrogenase (svm: 1.690)

SCOP Superfamily: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Fold: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 579
Modified z-scores:
dali:0.90 daliz:0.96 gdtts:0.90 tmscore:0.89 rmsd:0.22 AHM:0.23 LBcontacta:0.90 LBcontactb:0.86 LHM:0.29
id:0.92 blosum:0.83 compass:0.66 pearson:0.85
Scaled scores:
dali:0.82 daliz:0.64 gdtts:0.74 tmscore:0.75 rmsd:0.85 AHM:0.77 LBcontacta:0.60 LBcontactb:0.77 LHM:0.24
id:0.11 blosum:0.14 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:377.80)
Query          1 ----------------------GMEN------KKMNLLLfsgdydkALASLIIANAAREM     32
d1saya1        1 agrlsvqfgarflerqqggrgvLLGGvpgvkpGKVVILG------gGVVGTEAAKMAVGL     54

Query         33 EIEVTIFCAfwGLLLLRdpekasqedkslyeqafssltpreaeelplskmnlggigkkml     92
d1saya1       55 GAQVQIFDI--NVERLS-------------------------------------------     69

Query         93 lemmkeekapklsdlLSGARkkEVKFYAXqlsveimgfkkeelfpevqimDVKEYLKNAL    152
d1saya1       70 -------------ylETLFG-sRVELLYS---------------------NSAEIETAVA     94

Query        153 ESDLQLFI----------------------------------------------------    160
d1saya1       95 EADLLIGAvlvpgrrapilvpaslveqmrtgsvivdvavdqggcvetlhptshtqptyev    154

Query        161 --------------    161
d1saya1      155 fgvvhygvpnmpga    168


hit structure      alignment
FAST alignment (Normalized score: 3.98 Raw score:652.10)
Query          1 GME-------------------------------NKKMNLLLFSGDYDK---ALASLIIA     26
d1saya1        1 ---AGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVI---------LGGGVVGTEAA     48

Query         27 NAAREMEIEVTIFCAFW-GLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLG     85
d1saya1       49 KMAVGLGAQVQIFD---INVER--------------------------------------     67

Query         86 GIGKKMLLEMMKEEKAPKLSDLLS--GARKK----EVKFYAXQLSVEIMGFKKEELFPEV    139
d1saya1       68 ------------------------LSYLET-LFGSRVELLY-------------------     83

Query        140 QIMDVKEYLKNALESDLQLFI---------------------------------------    160
d1saya1       84 --SNSAEIETAVAEADLLI--GAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCV    139

Query        161 -----------------------------    161
d1saya1      140 ETLHPTSHTQPTYEVFGVVHYGVPNMPGA    168


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:63.78)
Query          1 ----------------------GME------NKKMNLLLFSGDYDKALASLIIANAAREM     32
d1saya1        1 AGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILG------GGVVGTEAAKMAVGL     54

Query         33 EIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKML     92
d1saya1       55 GAQVQIFDI--NVERLS------------------------Y------------------     70

Query         93 LEMMKEEKAPKLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNAL    152
d1saya1       71 --------------LETLFGS-RVELLYS---------------------NSAEIETAVA     94

Query        153 ESDLQLF-I---------------------------------------------------    160
d1saya1       95 EADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEV    154

Query        161 --------------    161
d1saya1      155 FGVVHYGVPNMPGA    168


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.01)
DALI match       *******************
Query         21 ASLIIANAAREMEIEVTIF     39
d1saya1       43 VGTEAAKMAVGLGAQVQIF     61



hit structures. 
top
46: d1fl2a1 Alkyl hydroperoxide reductase subunit F (AhpF),​ C-​terminal domains (svm: 1.693)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 526
Modified z-scores:
dali:0.86 daliz:0.92 gdtts:0.89 tmscore:0.89 rmsd:0.31 AHM:0.27 LBcontacta:0.85 LBcontactb:0.84 LHM:0.27
id:0.69 blosum:0.38 compass:0.59 pearson:0.87
Scaled scores:
dali:0.79 daliz:0.53 gdtts:0.66 tmscore:0.67 rmsd:0.80 AHM:0.76 LBcontacta:0.50 LBcontactb:0.70 LHM:0.24
id:0.03 blosum:0.05 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:357.50)
Query          1 gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFcafwGLLLlrdpekasqedks     60
d1fl2a1        1 ---ayDVLIVG------sGPAGAAAAIYSARKGIRTGLM----GERF-------------     34

Query         61 lyeqafssltpreAEELPLskmnlggigKKMLleMMKEE----kapKLSDLLSGARKKEV    116
d1fl2a1       35 ------------gGQILDT---------VDIE--NYISVpktegqkLAGALKVHVDEYDV     71

Query        117 KFYA--------------------XQLSveimgfkkeelfpevqimdvKEYLknaleSDL    156
d1fl2a1       72 DVIDsqsasklipaavegglhqieTASG--------------------AVLK-----ARS    106

Query        157 QLFI--------------------------------------------------------    160
d1fl2a1      107 IIVAtgaklpntnwlegavernrmgeiiidakcetnvkgvfaagdcttvpykqiiiatge    166

Query        161 ------------------    161
d1fl2a1      167 gakaslsafdylirtkta    184


hit structure      alignment
FAST alignment (Normalized score: 3.25 Raw score:557.60)
Query          1 GMENK--KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKAS     55
d1fl2a1        1 -----AYDVLI---------VGSGPAGAAAAIYSARKGIRTGLM----------------     30

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKM------------LLEMMKEEKAP-    102
d1fl2a1       31 ------------------------------------GERFGGQILDTVDIENY------I     48

Query        103 ---------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA--    151
d1fl2a1       49 SVPKTEGQKLAGALKVHVDEYDVDVI--------------------------------DS     76

Query        152 -------------------------LESDLQLFI--------------------------    160
d1fl2a1       77 QSASKLIPAAVEGGLHQIETASGAVLKARSIIV-ATGAKLPNTNWLEGAVERNRMGEIII    135

Query        161 -------------------------------------------------    161
d1fl2a1      136 DAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA    184


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:66.87)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1fl2a1        1 ---AYDVLIVGS------GPAGAAAAIYSARKGIRTGLMGE--R--FG------------     35

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKE-----EKAPKLSDLLSGARKKE    115
d1fl2a1       36 -------------GQILDT------VD-I-ENY-ISVPKTEGQ---KLAGALKVHVDEYD     70

Query        116 VKFYAXQL-----------------SVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQL    158
d1fl2a1       71 VDVIDSQSASKLIPAAVEGGLHQIE------------------TASGA-VLK--ARSIIV    109

Query        159 FI----------------------------------------------------------    160
d1fl2a1      110 ATGAKLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAK    169

Query        161 ---------------    161
d1fl2a1      170 ASLSAFDYLIRTKTA    184


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.06)
DALI match       *******************
Query         21 ASLIIANAAREMEIEVTIF     39
d1fl2a1       12 AGAAAAIYSARKGIRTGLM     30



top
47: d1gvha3 Flavohemoglobin,​ C-​terminal domain (svm: 0.683)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 655
Modified z-scores:
dali:0.88 daliz:0.87 gdtts:0.89 tmscore:0.90 rmsd:0.33 AHM:0.30 LBcontacta:0.84 LBcontactb:0.87 LHM:0.15
id:0.78 blosum:0.58 compass:0.54 pearson:0.92
Scaled scores:
dali:0.72 daliz:0.39 gdtts:0.56 tmscore:0.59 rmsd:0.78 AHM:0.73 LBcontacta:0.43 LBcontactb:0.68 LHM:0.46
id:0.03 blosum:0.10 compass:0.18 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:365.70)
Query          1 --gMENKKMNLLLFSGdydKALASLIIANAAREMEI--EVTIFCAF---wgLLLLrdpek     53
d1gvha3        1 mavADDTPVTLISAGV---GQTPMLAMLDTLAKAGHtaQVNWFHAAengdvHAFA-----     52

Query         54 asqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdLLSGARK    113
d1gvha3       53 ----------------------------------------------------dEVKELGQ     60

Query        114 KE--VKFYAXqlsVEIMG--FKKEELfpevqiMDVKEYlkNALE-sDLQLFI--------    160
d1gvha3       61 SLprFTAHTW---YRQPSeaDRAKGQfdseglMDLSKLegAFSDptMQFYLCgpvgfmqf    117

Query        161 --------------------------    161
d1gvha3      118 takqlvdlgvkqenihyecfgphkvl    143


hit structure      alignment
FAST alignment (Normalized score: 2.04 Raw score:308.30)
Query          1 --GMENKKMNLLLFSGD---YDKALASLIIANAAR-EMEIEVTIFCAFWGLLLLRDPEKA     54
d1gvha3        1 MAVADDTPVTLISA---GVGQTPMLAMLDTLAK--AGHTAQVNWFH--------------     41

Query         55 SQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK---------LS    105
d1gvha3       42 -------------------------------------------------AAENGDVHAFA     52

Query        106 DLLSGARK--KEVKFYAXQLSVEIMGFKKEELFPEVQI----------------------    141
d1gvha3       53 DEVKELGQSLPRFTAH----------------------TWYRQPSEADRAKGQFDSEGLM     90

Query        142 -------------------MDVKEYLKNALESDLQLFI----------------------    160
d1gvha3       91 DLSKLEGAFSDPTMQFYLCGPVGFMQFTAK--------QLVDLGVKQENIHYECFGPHKV    142

Query        161 -    161
d1gvha3      143 L    143


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:70.28)
Query          1 --GMENKKMNLLLFSGDYDKALASLIIANAAR-EME-IEVTIFCAFWGLLLLRDPEKASQ     56
d1gvha3        1 MAVADDTPVTLISA-GV--GQTPMLAMLDTLAKAGHTAQVNWFHA-A-EN--G-------     46

Query         57 EDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKE-    115
d1gvha3       47 -------------DV-HA-----------------------------FADEVKELGQSLP     63

Query        116 -VKFYAXQLSVEIMG---FKKEELFPEVQI---MDVK-EYLKNALE-SDLQLFI------    160
d1gvha3       64 RFTAHTW---Y-RQPSEADRAKGQ---FDSEGLMDLSKLEGAF-SDPTMQFYLCGPVGFM    115

Query        161 ----------------------------    161
d1gvha3      116 QFTAKQLVDLGVKQENIHYECFGPHKVL    143


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.28)
DALI match                                             
Query        100 KAPKLSDLLSGARKKE----VKFYAXQLSVEIMGFKKE    133
d1gvha3       17 GQTPMLAMLDTLAKAGHTAQVNWFHAAENGDVHAFADE     54



top
48: d1a9xa3 Carbamoyl phosphate synthetase (CPS),​ large subunit PreATP-​grasp domains (svm: 1.616)

SCOP Superfamily: PreATP-​grasp domain  |  SCOP Fold: PreATP-​grasp domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 666
Modified z-scores:
dali:0.91 daliz:0.91 gdtts:0.87 tmscore:0.88 rmsd:0.37 AHM:0.44 LBcontacta:0.87 LBcontactb:0.86 LHM:0.26
id:0.89 blosum:0.38 compass:0.41 pearson:0.86
Scaled scores:
dali:0.73 daliz:0.44 gdtts:0.53 tmscore:0.56 rmsd:0.74 AHM:0.63 LBcontacta:0.45 LBcontactb:0.63 LHM:0.28
id:0.08 blosum:0.08 compass:0.15 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:324.20)
Query          1 ---GMENKKMNLLLFSG-----DYDKALASLIIANAAREMEIEVTIFCAfwGLLLlrdpe     52
d1a9xa3        1 mpkRTDIKSILILGAGPivigqACEFDYSGAQACKALREEGYRVINVNS--NPAT-----     53

Query         53 kasqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdlLSGAr    112
d1a9xa3       54 ----------------------------------------------------imtDPEM-     60

Query        113 kkEVKFYAXQlsveimgfkkeelfpevqiMDVKEYLKNAL--ESDLQLFI----------    160
d1a9xa3       61 --ADATYIEP-------------------IHWEVVRKIIEkeRPDAVLPTmggqtalnca     99

Query        161 ----------------------------    161
d1a9xa3      100 lelerqgvleefgvtmigatadaidkae    127


hit structure      alignment
FAST alignment (Normalized score: 4.06 Raw score:578.30)
Query          1 --GMEN-KKMNLLLFS--------GDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLR     49
d1a9xa3        1 MPKRTDIKSILIL---GAGPIVIGQACEFDYSGAQACKALREEGYRVINVN---------     48

Query         50 DPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKL----S    105
d1a9xa3       49 -------------------------------------------------------SNPAT     53

Query        106 DLLSGARKKE-----VKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNAL--ESDLQL    158
d1a9xa3       54 IMT-------DPEMADATY-------------------IEPIHWEVVRKIIEKERPDAVL     87

Query        159 FI----------------------------------------    160
d1a9xa3       88 --PTMGGQTALNCALELERQGVLEEFGVTMIGATADAIDKAE    127


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.21)
Query          1 --GME-NKKMNLLLFS-G----DYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPE     52
d1a9xa3        1 MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVINVN----SN-P----     51

Query         53 KASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGAR    112
d1a9xa3       52 --------------------AT------------------------------I--MT-DP     58

Query        113 KKEVKFYAXQLSV--EIMGFKKEELFPEVQIMDVKEYLKNALESDLQLF-I---------    160
d1a9xa3       59 EMADATYIE--PIHW----------------EVVRKIIEKERPDAVLPTMGGQTALNCAL    100

Query        161 ---------------------------    161
d1a9xa3      101 ELERQGVLEEFGVTMIGATADAIDKAE    127


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.62)
DALI match       *******************
Query         20 LASLIIANAAREMEIEVTI     38
d1a9xa3       28 YSGAQACKALREEGYRVIN     46



top
49: d1el5a1 Sarcosine oxidase (svm: 1.694)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.43  Contact: 579
Modified z-scores:
dali:0.87 daliz:0.92 gdtts:0.88 tmscore:0.89 rmsd:0.34 AHM:0.29 LBcontacta:0.86 LBcontactb:0.87 LHM:0.32
id:0.60 blosum:0.44 compass:0.55 pearson:0.88
Scaled scores:
dali:0.77 daliz:0.50 gdtts:0.60 tmscore:0.63 rmsd:0.76 AHM:0.74 LBcontacta:0.49 LBcontactb:0.75 LHM:0.19
id:0.00 blosum:0.07 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:380.90)
Query          1 gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLRdpekasqedks     60
d1el5a1        1 -sthfDVIVVG------aGSMGMAAGYQLAKQGVKTLLVDA---FDPPH-----------     39

Query         61 lyeqafssltpreaeELPLskmnlggigKKML------------leMMKEEKA-------    101
d1el5a1       40 ------------tngSHHG--------dTRIIrhaygegreyvplaLRSQELWyeleket     79

Query        102 ------------------------------------------------------------    102
d1el5a1       80 hhkiftktgvlvfgpkgesafvaetmeaakehsltvdllegdeinkrwpgitvpenynai    139

Query        102 -----------pKLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqimDVKEyLKN    150
d1el5a1      140 fepnsgvlfsenCIRAYRELAEARGAKVLTH------trvedfdispdsvkiETAN-GSY    192

Query        151 AleSDLQLFI--------------------------------------------------    160
d1el5a1      193 T--ADKLIVSmgawnskllsklnldipdehfiidlhpehsnvviaagfsghgfkfssgvg    250

Query        161 -------------------------------    161
d1el5a1      251 evlsqlaltgktehdisifsinrpalkeslq    281


hit structure      alignment
FAST alignment (Normalized score: 3.22 Raw score:682.00)
Query          1 GMENK----KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEK     53
d1el5a1        1 -----STHFDVIV---------VGAGSMGMAAGYQLAKQGVKTLLVD-------------     33

Query         54 ASQEDKSLYEQAFSSLTPREAEELPLSKMN-------------------------LGGIG     88
d1el5a1       34 ------------------------------AFDPPHTNGSHHGDTRIIRHAYGEGREYVP     63

Query         89 KKMLLEMMKEEKAP----------------------------------------------    102
d1el5a1       64 LALRSQELWY----ELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLE    119

Query        103 --------------------------------KLSDLLSGARKKEVKFYAXQLSVEIMGF    130
d1el5a1      120 GDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVL-----------    168

Query        131 KKEELFPEVQIMDVKEYLKNA-------------------LESDLQLFI-----------    160
d1el5a1      169 ---------THTR--------VEDFDISPDSVKIETANGSYTADKLI--VSMGAWNSKLL    209

Query        161 ------------------------------------------------------------    161
d1el5a1      210 SKLNLDIPDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDISIF    269

Query        161 ------------    161
d1el5a1      270 SINRPALKESLQ    281


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:70.61)
Query          1 --GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQED     58
d1el5a1        1 ST---HFDVIVVGA------GSMGMAAGYQLAKQGVKTLLVDA---FDPPH---------     39

Query         59 KSLYEQAFSSLTPREA-EELPLSKMNLGGIGKKMLLE-----------MM-KEE--KAP-    102
d1el5a1       40 -----------TN--GS-HHGD------T--R-IIRHAYGEGREYVPLALRSQELWYELE     76

Query        103 ------K-----------------------------------------------------    103
d1el5a1       77 KETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENY    136

Query        104 ---------------L-SDLLSGARKKEVKFYAXQLS------------VEIMGFKKEEL    135
d1el5a1      137 NAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKI-----------    185

Query        136 FPEVQIMDVKEYLKNALESDLQLFI-----------------------------------    160
d1el5a1      186 -------ETANG-SY--TADKLIVSMGAWNSKLLSKLNLDIPDEHFIIDLHPEHSNVVIA    235

Query        161 ----------------------------------------------    161
d1el5a1      236 AGFSGHGFKFSSGVGEVLSQLALTGKTEHDISIFSINRPALKESLQ    281


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.25)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1el5a1       13 SMGMAAGYQLAKQGVKTLLV     32



top
50: d1krha2 Benzoate dioxygenase reductase (svm: 0.789)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.37  Contact: 618
Modified z-scores:
dali:0.89 daliz:0.88 gdtts:0.89 tmscore:0.89 rmsd:0.34 AHM:0.31 LBcontacta:0.83 LBcontactb:0.88 LHM:0.16
id:0.78 blosum:0.49 compass:0.58 pearson:0.91
Scaled scores:
dali:0.72 daliz:0.40 gdtts:0.55 tmscore:0.57 rmsd:0.77 AHM:0.73 LBcontacta:0.42 LBcontactb:0.69 LHM:0.45
id:0.03 blosum:0.09 compass:0.19 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:321.80)
Query          1 -gMENKKMNLLLFSGdydKALASLIIANAAREMEI--EVTIFCAF--wgLLLLrdpekas     55
d1krha2        1 lrDVKRPVLMLAGGT---GIAPFLSMLQVLEQKGSehPVRLVFGVtqdcDLVA-------     50

Query         56 qedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsDLLSGARKKE    115
d1krha2       51 -------------------------------------------------lEQLDALQQKL     61

Query        116 --VKFYAXqlSVEImGFKKeelfpevqimdVKEYLKNALE--sDLQLFI-----------    160
d1krha2       62 pwFEYRTV--VAHA-ESQH-----erkgyvTGHIEYDWLNggeVDVYLCgpvpmveavrs    113

Query        161 --------------------    161
d1krha2      114 wldtqgiqpanflfekfsan    133


hit structure      alignment
FAST alignment (Normalized score: 3.42 Raw score:498.10)
Query          1 GM---ENKKMNLLLFSGDYDKALASLIIANAAREM--EIEVTIFCAFWGLLLLRDPEKAS     55
d1krha2        1 --LRDVKRPVLMLAG---GTGIAPFLSMLQVLEQKGSEHPVRLVF---------------     40

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPK---------LSD    106
d1krha2       41 ------------------------------------------------GVTQDCDLVALE     52

Query        107 LLSGA-RKK-EVKFYAXQLSV-EIMGFKKEELFPEVQIMDVKE------------YLKNA    151
d1krha2       53 QLDALQQKLPWFEYRTV----VAHAES----------------QHERKGYVTGHIEYDW-     91

Query        152 LES-----DLQLFI---------------------------------    160
d1krha2       92 ---LNGGEVDVY--LCGPVPMVEAVRSWLDTQGIQPANFLFEKFSAN    133


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:67.68)
Query          1 ---GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQE     57
d1krha2        1 LRDVK--RPVLMLAGGTGIAPFLSMLQVLEQK-GSEHPVRLVFGVT--------------     43

Query         58 DKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKE-V    116
d1krha2       44 --------QD--CDLVAL----------------------------EQ-LDALQQKLPWF     64

Query        117 KFYAXQLSVEIMGFKKEELFPEVQIMD--VKEYLK-NALE-SDLQLFI------------    160
d1krha2       65 EYRTV--VA-HAESQH--E-----RKGYVTGHIEYDWLNGGEVDVYLCGPVPMVEAVRSW    114

Query        161 -------------------    161
d1krha2      115 LDTQGIQPANFLFEKFSAN    133


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.25)
DALI match       ............ . .................********
Query          3 ENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAF     42
d1krha2        3 DVKRPVLMLAGGTGIAPFLSMLQVLEQKGSEHPVRLVFGV     42



hit structures. 
top
51: d1vc1a_ Anti-​sigma factor antagonist SpoIIaa (svm: 0.741)

SCOP Superfamily: Anti-​sigma factor antagonist SpoIIaa  |  SCOP Fold: SpoIIaa-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 567
Modified z-scores:
dali:0.86 daliz:0.79 gdtts:0.85 tmscore:0.87 rmsd:0.41 AHM:0.46 LBcontacta:0.84 LBcontactb:0.82 LHM:0.20
id:0.45 blosum:0.03 compass:0.16 pearson:0.63
Scaled scores:
dali:0.66 daliz:0.32 gdtts:0.48 tmscore:0.48 rmsd:0.72 AHM:0.62 LBcontacta:0.42 LBcontactb:0.57 LHM:0.36
id:-0.04 blosum:-0.06 compass:0.06 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:269.10)
Query          1 --------gmenKKMNLLLFSG-DYDKALASLIIANAAREME--IEVTIFCAFWgllllr     49
d1vc1a_        1 mnnlkldiveqdDKAIVRVQGDiDAYNSSELKEQLRNFISTTskKKIVLDLSSV------     54

Query         50 dpekasqedkslyeqafssltpreAEELplskmnlggigkkmllemmkeekapkLSDLLS    109
d1vc1a_       55 ----------------------syMDSA--------------------------GLGTLV     66

Query        110 GARKKE------VKFYAXQLsveimgFKKE--ELFP-EVQIMdvkEYLKNalesdlqlfi    160
d1vc1a_       67 VILKDAkingkeFILSSLKE---sisRILKltHLDKiFKITD---TVEEA----------    110


hit structure      alignment
FAST alignment (Normalized score: 3.65 Raw score:483.70)
Query          1 GMEN------------KKMNLLLF-SGDYDKALASLIIANAARE-MEI-EVTIFCAFW--     43
d1vc1a_        1 ----MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDL---SS     53

Query         44 -------GLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMM     96
d1vc1a_       54 VSYMDSAGLGT-------------------------------------------------     64

Query         97 KEEKAPKLSDLLSGARKKEVKFYA-------XQLSVEIMGFKKEEL-FPEVQIMDVKEYL    148
d1vc1a_       65 -------LVVILKDAKINGKEFI-LSSLKESISRILKLTH------LDKIFKIT--DTVE    108

Query        149 KNALESDLQLFI--    160
d1vc1a_      109 ------------EA    110


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.09)
Query          1 ---------GM--ENKKMNLLLFSGDYDKALASLIIANAAREMEIE--VTIFC--AFWGL     45
d1vc1a_        1 MNNLKLDIV-EQD-DKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYM-     57

Query         46 LLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLS    105
d1vc1a_       58 D--------------------------SA--G--------------------------LG     63

Query        106 DLLSGARK-KE----VKFYA-XQLSVEIMGFKKEELFPEVQIMDVKEYLKN-ALESDLQL    158
d1vc1a_       64 TLVV-ILKDAKINGKEFILSSLKESIS-RILKLTHLDKIFKITD--TV-EEA--------    110

Query        159 FI    160
d1vc1a_      111 --    111


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.08)
DALI match       ....................     
Query        104 LSDLLSGARKKEVKFYAXQLSVEIM    128
d1vc1a_       65 LVVILKDAKINGKEFILSSLKESIS     89



top
52: d1kjqa2 Glycinamide ribonucleotide transformylase PurT,​ N-​domain (svm: 1.151)

SCOP Superfamily: PreATP-​grasp domain  |  SCOP Fold: PreATP-​grasp domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 520
Modified z-scores:
dali:0.90 daliz:0.93 gdtts:0.89 tmscore:0.87 rmsd:0.31 AHM:0.35 LBcontacta:0.90 LBcontactb:0.87 LHM:0.24
id:0.62 blosum:0.54 compass:0.56 pearson:0.82
Scaled scores:
dali:0.80 daliz:0.58 gdtts:0.68 tmscore:0.65 rmsd:0.77 AHM:0.68 LBcontacta:0.59 LBcontactb:0.76 LHM:0.30
id:0.01 blosum:0.08 compass:0.17 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:298.30)
Query          1 -GMEN------KKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLrdpek     53
d1kjqa2        1 tLLGTalrpaaTRVMLLG------sGELGKEVAIECQRLGVEVIAVDR---YADA-----     46

Query         54 asqedkslyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdllsgark    113
d1kjqa2       47 --------------------------------------------------------pamh     50

Query        114 keVKFYAXQLSveimgfkkeelfpevqimDVKEYLKNAlESDLQLFI-------------    160
d1kjqa2       51 vaHRSHVINML---------------dgdALRRVVELE-KPHYIVPEieaiatdmliqle     94

Query        161 -----------------    161
d1kjqa2       95 eeglnvvpcaratkltm    111


hit structure      alignment
FAST alignment (Normalized score: 3.87 Raw score:516.20)
Query          1 GME----------NKKMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLL     47
d1kjqa2        1 ---TLLGTALRPAATRVML---------LGSGELGKEVAIECQRLGVEVIAV--------     40

Query         48 LRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDL    107
d1kjqa2       41 ------------------------------------------------------------     41

Query        108 L-----SGARKKE--VKFYAXQLSVEIMGFKKEELFPEVQI---MDVKEYLKNAL--ESD    155
d1kjqa2       41 -DRYADAPAMH--VAHRSHV---------------------INMLDGDALRRVVELEKPH     76

Query        156 LQLFI--------------------------------    160
d1kjqa2       77 YIV--PEIEAIATDMLIQLEEEGLNVVPCARATKLTM    111


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:56.96)
Query          1 -GME------NKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEK     53
d1kjqa2        1 TLLGTALRPAATRVMLLGS------GELGKEVAIECQRLGVEVIAVDR---Y-AD-----     45

Query         54 ASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARK    113
d1kjqa2       46 --------------------A-----------------------------P--AMH-V--     51

Query        114 KEVKFYAXQLS---VEIMGFKKEELFPEVQIMDV-KEYLKNALESDLQLFI---------    160
d1kjqa2       52 -AHRSHVI-NMLDG------------------DALRRVVELE-KPHYIVPEIEAIATDML     90

Query        161 ---------------------    161
d1kjqa2       91 IQLEEEGLNVVPCARATKLTM    111


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.02)
DALI match       ******************
Query         22 SLIIANAAREMEIEVTIF     39
d1kjqa2       23 GKEVAIECQRLGVEVIAV     40



top
53: d1qlaa2 Fumarate reductase (svm: 1.690)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.38  Contact: 558
Modified z-scores:
dali:0.87 daliz:0.92 gdtts:0.65 tmscore:0.72 rmsd:0.54 AHM:0.54 LBcontacta:0.94 LBcontactb:0.91 LHM:0.43
id:0.84 blosum:0.68 compass:0.67 pearson:0.92
Scaled scores:
dali:0.77 daliz:0.50 gdtts:0.33 tmscore:0.34 rmsd:0.63 AHM:0.55 LBcontacta:0.60 LBcontactb:0.74 LHM:0.14
id:0.04 blosum:0.10 compass:0.23 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:409.20)
Query          1 -gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwgLLLLRdpekasqedk     59
d1qlaa2        1 mkvqycDSLVIG------gGLAGLRAAVATQQKGLSTIVLSL---IPVKR----------     41

Query         60 slyeqafssltprEAEE-------------------------------------lplsKM     82
d1qlaa2       42 ------------sHSAAaqggmqaslgnskmsdgdnedlhfmdtvkgsdwgcdqkvarMF     89

Query         83 NLggiGKKMLLEMMKEEKA-----------------------------------------    101
d1qlaa2       90 VN---TAPKAIRELAAWGVpwtrihkgdrmaiinaqkttiteedfrhglihsrdfggtkk    146

Query        102 ------------pKLSDLLSGARKKEVKFYAX------------------QLSVEImgfk    131
d1qlaa2      147 wrtcytadatghtMLFAVANECLKLGVSIQDRkeaialihqdgkcygavvRDLVTG----    202

Query        132 keelfpevqimdvkeyLKNAleSDLQLF--------------------------------    159
d1qlaa2      203 --------------diIAYV--AKGTLIatggygriyknttnavvcegtgtaialetgia    246

Query        160 ------------------------------------------------------------    160
d1qlaa2      247 qlgnmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmivgeyfaeh    306

Query        160 -----------------------------i    160
d1qlaa2      307 cantqvdletktlekfvkgqeaymkslves    336


hit structure      alignment
FAST alignment (Normalized score: 3.13 Raw score:726.80)
Query          1 GMENK------KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDP     51
d1qlaa2        1 -----MKVQYCDSLV---------IGGGLAGLRAAVATQQKGLSTIVL------------     34

Query         52 EKASQEDKSLYEQAFSSLTPR---EAEELPLSKMNLG-----------------------     85
d1qlaa2       35 ---------------------SLIPVKRS--------HSAAAQGGMQASLGNSKMSDGDN     65

Query         86 ----------------GIGKKMLLEMMKEEKAP---------------------------    102
d1qlaa2       66 EDLHFMDTVKGSDWGCDQKVARMFVNTAP----KAIRELAAWGVPWTRIHKGDRMAIINA    121

Query        103 --------------------------------------KLSDLLSGARKKEVKFYAXQLS    124
d1qlaa2      122 QKTTITEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQ-----    176

Query        125 VEIMGFKKEELFPEVQIMDVKEYLKNA--------------------------LESDLQL    158
d1qlaa2      177 ---------------DRKE--------AIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTL    213

Query        159 FI----------------------------------------------------------    160
d1qlaa2      214 --IATGGYGRIYKNTTNAVVCEGTGTAIALETGIAQLGNMGGIRTDYRGEAKLKGLFSAG    271

Query        161 ------------------------------------------------------------    161
d1qlaa2      272 EAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMK    331

Query        161 -----    161
d1qlaa2      332 SLVES    336


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:73.94)
Query          1 -----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKAS     55
d1qlaa2        1 MKVQY----CDSLVIG--G----GLAGLRAAVATQQKGLSTIVLSL---IPVK-------     40

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM--------------------     95
d1qlaa2       41 -----------------RSHSAAA------QG--GMQASLGNSKMSDGDNEDLHFMDTVK     75

Query         96 -----------------MKE-EKAP-----------------------------------    102
d1qlaa2       76 GSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINAQKTTITEEDFRHGL    135

Query        103 ------------------------KLSDLLSGARKKEVKFYAXQLS--------------    124
d1qlaa2      136 IHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAV    195

Query        125 ----VEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI--------------------    160
d1qlaa2      196 VRDL----------------VTGDII--AY--VAKGTLIATGGYGRIYKNTTNAVVCEGT    235

Query        161 ------------------------------------------------------------    161
d1qlaa2      236 GTAIALETGIAQLGNMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVA    295

Query        161 -----------------------------------------    161
d1qlaa2      296 GMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVES    336


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.05)
DALI match       *******************
Query         21 ASLIIANAAREMEIEVTIF     39
d1qlaa2       16 AGLRAAVATQQKGLSTIVL     34



top
54: d1m6ia2 Apoptosis-​inducing factor (AIF) (svm: 1.630)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.26  Contact: 534
Modified z-scores:
dali:0.87 daliz:0.89 gdtts:0.85 tmscore:0.84 rmsd:0.37 AHM:0.35 LBcontacta:0.83 LBcontactb:0.84 LHM:0.23
id:0.97 blosum:0.91 compass:0.83 pearson:0.93
Scaled scores:
dali:0.74 daliz:0.45 gdtts:0.57 tmscore:0.55 rmsd:0.75 AHM:0.69 LBcontacta:0.46 LBcontactb:0.68 LHM:0.34
id:0.14 blosum:0.19 compass:0.32 pearson:0.29

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:307.80)
Query          1 -------------------------------GMEN--KKMNLLLfsgdydkALASLIIAN     27
d1m6ia2        1 prslsaidragaevksrttlfrkigdfrsleKISRevKSITIIG------gGFLGSELAC     54

Query         28 AAREME----IEVTIFCafwGLLLlrdpekasqedkslyeqafssltpreAEELPlskmn     83
d1m6ia2       55 ALGRKAralgTEVIQLF---PEKG------------------------nmGKILP-----     82

Query         84 lggigkkmllemmkeekapKLSDLLSGARKKEVKFY--AXQLsveimgfkkeelfpevqi    141
d1m6ia2       83 -----------------eyLSNWTMEKVRREGVKVMpnAIVQ-----svgvssgkllikl    120

Query        142 mDVKEYlknalESDLQLF---i    160
d1m6ia2      121 kDGRKV-----ETDHIVAavgl    137


hit structure      alignment
FAST alignment (Normalized score: 3.45 Raw score:510.50)
Query          1 GME------------------------------------NKKMNLLLFSGDYDKALASLI     24
d1m6ia2        1 ---PRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITI--IGGGFLGSELACA     55

Query         25 IANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNL     84
d1m6ia2       56 LGRKARALGTEVIQLF--------------------------------------------     71

Query         85 GGIGKKMLLEMMKEEKAP-------------KLSDLLSGARKKEVKFYAXQLSVEIMGFK    131
d1m6ia2       72 ------------------PEKGNMGKILPEYLSNWTMEKVRREGVKVM------------    101

Query        132 KEELFPEVQIMDVKEYLKNA-------------------LESDLQLFI-----    160
d1m6ia2      102 --------PNAIV-------QSVGVSSGKLLIKLKDGRKVETDHIV--AAVGL    137


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:59.83)
Query          1 -------------GMENK-KMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLL     46
d1m6ia2        1 PRSLSAIDRAGAE----VKSRTTLF------RKIGDFRSLEKISREVKSITIIGGGFLGS     50

Query         47 LLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSD    106
d1m6ia2       51 ELA------------------------C------------------------------A-     55

Query        107 LLSGARKK-EVKFYAXQLSV--EI-M-G--FK--KEELFP--EVQIM-DVKEYLKNALE-    153
d1m6ia2       56 LGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIV--QS-VGVS    112

Query        154 ---S------------DLQLFI---    160
d1m6ia2      113 SGKLLIKLKDGRKVETDHIVAAVGL    137


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.11)
DALI match       *.......   .   ...............******
Query          4 NKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIF     39
d1m6ia2       35 REVKSITIIGGGFLGSELACALGRKARALGTEVIQL     70



top
55: d1q1ra1 Putidaredoxin reductase (svm: 1.634)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 502
Modified z-scores:
dali:0.84 daliz:0.86 gdtts:0.79 tmscore:0.82 rmsd:0.43 AHM:0.40 LBcontacta:0.85 LBcontactb:0.88 LHM:0.13
id:0.85 blosum:0.81 compass:0.69 pearson:0.91
Scaled scores:
dali:0.77 daliz:0.44 gdtts:0.47 tmscore:0.49 rmsd:0.74 AHM:0.70 LBcontacta:0.47 LBcontactb:0.73 LHM:0.49
id:0.05 blosum:0.15 compass:0.22 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:351.10)
Query          1 gMENKKMNLLLfsgdydkALASLIIANAARE--MEIEVTIFCAfwGLLLlrdpekasqed     58
d1q1ra1        1 -NANDNVVIVG------tGLAGVEVAFGLRAsgWEGNIRLVGD--ATVI-----------     40

Query         59 kslyeqafssltpreAEELPLSKM-NLGGIgkKMLLemmkeekapKLSDlLSGARKKEVK    117
d1q1ra1       41 ---------------PHHLPPLSKaYLAGK--ATAE-------slYLRT-PDAYAAQNIQ     75

Query        118 FYAXqlsveimgfkkeelfpevqiMDVKeyLKNAleSDLQLFI-----------------    160
d1q1ra1       76 LLGG------tqvtainrdrqqviLSDG--RALD--YDRLVLAtggrplipncelasaag    125

Query        161 ------------------------------------------------------------    161
d1q1ra1      126 lqvdngivinehmqtsdplimavgdcarfhsqlydrwvriesvpnaleqarkiaailcgk    185


hit structure      alignment
FAST alignment (Normalized score: 2.93 Raw score:504.60)
Query          1 GMENKKMNLLLFSGDYDK---ALASLIIANAARE--MEIEVTIFCAFWGLLLLRDPEKAS     55
d1q1ra1        1 -NANDNVVI---------VGTGLAGVEVAFGLRASGWEGNIRLVG---------------     35

Query         56 QEDKSLYEQAFSSLTPREAEE-----LPLSKMN-----LGGIGKKMLLEMMKEEKAPKLS    105
d1q1ra1       36 ---------------------DATVIPHHLPP-LSKAYLAGK------------------     55

Query        106 D---------LLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA-----    151
d1q1ra1       56 -ATAESLYLRTPDAYAAQNIQLL--------------------------------GGTQV     82

Query        152 -----------------LESDLQLFI----------------------------------    160
d1q1ra1       83 TAINRDRQQVILSDGRALDYDRLVL-ATGGRPLIPNCELASAAGLQVDNGIVINEHMQTS    141

Query        161 --------------------------------------------    161
d1q1ra1      142 DPLIMAVGDCARFHSQLYDRWVRIESVPNALEQARKIAAILCGK    185


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:65.07)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1q1ra1        1 -NANDNVVIVG-TG--LAGVEVAFGLRAS-GWEGNIRLVGD--ATVI-------------     40

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGI-----------GKKMLLEMMKEEKAPKLSDLLS    109
d1q1ra1       41 -------------PH-HLP---PLSKAYLAGKATAESL---------------YLRT-PD     67

Query        110 GARKKEVKFYAXQLS----------VEIMGFKKEELFPEVQIMDV-KEYLKNALESDLQL    158
d1q1ra1       68 AYAAQNIQLLGGTQVTAINRDRQQV-----------------ILSDGR--AL--DYDRLV    106

Query        159 FI----------------------------------------------------------    160
d1q1ra1      107 LATGGRPLIPNCELASAAGLQVDNGIVINEHMQTSDPLIMAVGDCARFHSQLYDRWVRIE    166

Query        161 -------------------    161
d1q1ra1      167 SVPNALEQARKIAAILCGK    185


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.12)
DALI match       ************.........
Query         20 LASLIIANAAREMEIEVTIFC     40
d1q1ra1       13 LAGVEVAFGLRASGWEGNIRL     33



hit structures. 
top
56: d1dv1a2 Biotin carboxylase (BC),​ N-​terminal domain (svm: 0.977)

SCOP Superfamily: PreATP-​grasp domain  |  SCOP Fold: PreATP-​grasp domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 493
Modified z-scores:
dali:0.86 daliz:0.92 gdtts:0.76 tmscore:0.77 rmsd:0.37 AHM:0.43 LBcontacta:0.87 LBcontactb:0.84 LHM:0.24
id:0.83 blosum:0.65 compass:0.67 pearson:0.88
Scaled scores:
dali:0.79 daliz:0.56 gdtts:0.52 tmscore:0.50 rmsd:0.71 AHM:0.60 LBcontacta:0.57 LBcontactb:0.75 LHM:0.26
id:0.07 blosum:0.10 compass:0.20 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:292.80)
Query          1 gmeNKKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAFWGLLLlrdpekasqedks     60
d1dv1a2        1 ---LDKIVIAN------rGEIALRILRACKELGIKTVAVHSSADRDL-------------     38

Query         61 lyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdllsgarkkeVKFYA    120
d1dv1a2       39 -------------------------------------------------khvllaDETVC     49

Query        121 XQLSVeimgfkkeelfpevqimDVKEYLKNAL--ESDLQLF-------------------    159
d1dv1a2       50 IGPAP-----------svksylNIPAIISAAEitGAVAIHPgygflsenanfaeqversg     98

Query        160 --------------i    160
d1dv1a2       99 fifigpkaetirlmg    113


hit structure      alignment
FAST alignment (Normalized score: 3.82 Raw score:513.20)
Query          1 GMENKKMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQE     57
d1dv1a2        1 ---LDKIVI---------ANRGEIALRILRACKELGIKTVAVHSSADR------------     36

Query         58 DKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLL-SGARKKE-    115
d1dv1a2       37 ---------------------------------------------------DLKHVL--L     43

Query        116 -VKFYAXQLSVEIMGFKKEELFPEVQI--------MDVKEYLKNAL--ESDLQLFI----    160
d1dv1a2       44 ADETVCIG-------------------PAPSVKSYLNIPAIISAAEITGAVAIH--PGYG     82

Query        161 -------------------------------    161
d1dv1a2       83 FLSENANFAEQVERSGFIFIGPKAETIRLMG    113


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:54.16)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1dv1a2        1 -L--DKIVIAN------RGEIALRILRACKELGIKTVAVHS---SADRD-----------     37

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYA    120
d1dv1a2       38 -------------L---------------------------------KHVLL--ADETVC     49

Query        121 XQLSVEI--------MGFKKEELFPEVQIMDV-KEYLKNALESDLQLF---I--------    160
d1dv1a2       50 I-GPA-PSVKSYLNI---------------PAIISAAEIT-GAVAIHPGYGFLSENANFA     91

Query        161 ----------------------    161
d1dv1a2       92 EQVERSGFIFIGPKAETIRLMG    113


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.06)
DALI match                      
Query        105 SDLLSGARKKEVKFY    119
d1dv1a2       88 ANFAEQVERSGFIFI    102



top
57: d1r0ka2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase (svm: 1.537)

SCOP Superfamily: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Fold: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 628
Modified z-scores:
dali:0.85 daliz:0.84 gdtts:0.87 tmscore:0.86 rmsd:0.33 AHM:0.28 LBcontacta:0.88 LBcontactb:0.87 LHM:0.11
id:0.75 blosum:0.68 compass:0.49 pearson:0.84
Scaled scores:
dali:0.70 daliz:0.38 gdtts:0.54 tmscore:0.55 rmsd:0.76 AHM:0.73 LBcontacta:0.48 LBcontactb:0.69 LHM:0.52
id:0.03 blosum:0.11 compass:0.17 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:326.40)
Query          1 gmENKKMNLLLfsgdYDKALASLIIANAAReMEIEV-TIFCAFwGLLLLrdpekasqedk     59
d1r0ka2        1 --QPRTVTVLG--atGSIGHSTLDLIERNL-DRYQViALTANR-NVKDL-----------     43

Query         60 slyeqafssltpreaeelplskmnlggigkkmllemmkeekapklsdllsgaRKKEVK-F    118
d1r0ka2       44 ------------------------------------------------adaaKRTNAKrA     55

Query        119 YAXQLSVeimgFKKEELFP---evQIMDVKEYLKNAL-ESDLQLF---------------    159
d1r0ka2       56 VIADPSL---yNDLKEALAgssveAAAGADALVEAAMmGADWTMAaiigcaglkatlaai    112

Query        160 -------------------------------------i    160
d1r0ka2      113 rkgktvalankedmrtpightlawpkrmetpaesldft    150


hit structure      alignment
FAST alignment (Normalized score: 3.48 Raw score:539.90)
Query          1 GMENKKMNLLLFSGDYDK----ALASLIIANAARE--MEIE-VTIFCAFWGLLLLRDPEK     53
d1r0ka2        1 --QPRTVTV---------LGATGSIGHSTLDLIERNLDRYQVIALTAN-RNVK-------     41

Query         54 ASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSG---    110
d1r0ka2       42 ---------------------------------------------------------DLA     44

Query        111 --ARKKEV-KFYAXQLSVEIMGFKKEELF--------------PEVQI-MDVKEYLKNA-    151
d1r0ka2       45 DAAKRTNAKRAVIA---------------DPSLYNDLKEALAGSSVEAAAGADALVEAAM     89

Query        152 LESDLQLFI---------------------------------------------------    160
d1r0ka2       90 MGADWTMA-AIIGCAGLKATLAAIRKGKTVALANKEDMRTPIGHTLAWPKRMETPAESLD    148

Query        161 --    161
d1r0ka2      149 FT    150


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:68.80)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1r0ka2        1 --QPRTVTVLGA-TG-SIGHSTLDLIERNLDR-YQVIALTANRNVKDLA-----------     44

Query         61 LYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGARKKEVKFYA    120
d1r0ka2       45 -------------D---------------------------------A--AKRTNAKRAV     56

Query        121 XQLSVEIMGFK-KEELFP-E-VQIM----DVKEYLKNALESDLQLFI-------------    160
d1r0ka2       57 I-AD-PSLYNDLKE-ALAGSSVEAAAGADALVEAAMM--GADWTMAAIIGCAGLKATLAA    111

Query        161 ---------------------------------------    161
d1r0ka2      112 IRKGKTVALANKEDMRTPIGHTLAWPKRMETPAESLDFT    150


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.08)
DALI match                ******........  . ........  .................... 
Query        103 KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI    160
d1r0ka2       39 NVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTM     96



top
58: d1ve9a1 D-​aminoacid oxidase,​ N-​terminal domain (svm: 1.715)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 649
Modified z-scores:
dali:0.91 daliz:0.92 gdtts:0.87 tmscore:0.89 rmsd:0.40 AHM:0.40 LBcontacta:0.91 LBcontactb:0.90 LHM:0.26
id:0.93 blosum:0.84 compass:0.52 pearson:0.91
Scaled scores:
dali:0.76 daliz:0.48 gdtts:0.53 tmscore:0.57 rmsd:0.77 AHM:0.70 LBcontacta:0.49 LBcontactb:0.71 LHM:0.30
id:0.09 blosum:0.15 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:387.60)
Query          1 gmenKKMNLLLfsgdydkALASLIIANAAREME------IEVTIFCAfwglLLLRdpeka     54
d1ve9a1        1 ----MRVVVIG------aGVIGLSTALCIHERYhsvlqpLDVKVYAD----RFTP-----     41

Query         55 sqedkslyeqafssltprEAEELPLskmnlggigKKML-----------------lEMMK     97
d1ve9a1       42 ------------------FTTTDVA--------aGLWQpytsepsnpqeanwnqqtFNYL     75

Query         98 EEK---------------------------------------------------------    100
d1ve9a1       76 LSHigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpreldmfpdyrygwfnt    135

Query        101 ------apKLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqimdVKEYLKNA-LE    153
d1ve9a1      136 slilegrkYLQWLTERLTERGVKFFLR---------------------kVESFEEVArGG    174

Query        154 SDLQLFI-----------------------------------------------------    160
d1ve9a1      175 ADVIINCtgvwagvlqpdplqvrlereqlrfgssntevihnyghggygltihwgcaleva    234

Query        161 -------------    161
d1ve9a1      235 klfgkvleernll    247


hit structure      alignment
FAST alignment (Normalized score: 3.49 Raw score:693.10)
Query          1 GMENKKMNLLLFSGDYDK---ALASLIIANAAREM-------EIEVTIFCAFWGLLLLRD     50
d1ve9a1        1 ----MRVVV---------IGAGVIGLSTALCIHE-RYHSVLQPLDVKVYA----------     36

Query         51 PEKASQEDKSLYEQAFSSLTPREAEELPLSKMNL--------------------------     84
d1ve9a1       37 ----------------------------------DRFTPFTTTDVAAGLWQPYTSEPSNP     62

Query         85 GGIGKKMLLEMMKEEKAP------------------------------------------    102
d1ve9a1       63 QEANWNQQTFNYLL----SHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLT    118

Query        103 -------------------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFP    137
d1ve9a1      119 PRELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFF------------------    160

Query        138 EVQIM-DVKEYLKNALESDLQLFI------------------------------------    160
d1ve9a1      161 -LRKVESFEEVAR--GGADVII--NCTGVWAGVLQPDPLQVRLEREQLRFGSSNTEVIHN    215

Query        161 --------------------------------    161
d1ve9a1      216 YGHGGYGLTIHWGCALEVAKLFGKVLEERNLL    247


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:45.16)
Query          1 ----------GMENKKMNLL--------------------------------LF--SGDY     16
d1ve9a1        1 MRVVVIGAGV---------IGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGL     51

Query         17 DKALASLIIANAAREMEIEV--TIFCAFWGLLLLRDPEKASQEDKSLYEQAFSSLTPREA     74
d1ve9a1       52 --WQ-PYTS--EP--SNPQEANWNQQ----TFNYLLSHIGSP------NAANM--GLTPV     92

Query         75 EE--------------------------LPLSKMNLGGIGKKML-LEMM-KEEKAPKLSD    106
d1ve9a1       93 SGYNLFREAVPDPYWKDMVLGFRKLTPR--------------ELD-MFPD-YRYGWFNTS    136

Query        107 LL------SGARKKEVKFYAXQLS-VEIMG--------------------------FKKE    133
d1ve9a1      137 -LILEGRK--------------YLQWLTERLTERGVKFFLRKVESFEEVARGGADV----    177

Query        134 ELFPEVQIMDVKEYL-------------KNALE--------------S-DLQLFI-----    160
d1ve9a1      178 ----------IINCTGVWAGVLQPDPLQ-VRLEREQLRFGSSNTEVIHN-YGHGGYGLTI    225

Query        161 ----------------------    161
d1ve9a1      226 HWGCALEVAKLFGKVLEERNLL    247


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.13)
DALI match       ****************
Query        104 LSDLLSGARKKEVKFY    119
d1ve9a1      145 LQWLTERLTERGVKFF    160



top
59: d1uana_ Hypothetical protein TT1542 (svm: 0.824)

SCOP Superfamily: LmbE-​like  |  SCOP Fold: LmbE-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 529
Modified z-scores:
dali:0.85 daliz:0.89 gdtts:0.84 tmscore:0.83 rmsd:0.41 AHM:0.35 LBcontacta:0.85 LBcontactb:0.88 LHM:0.21
id:0.60 blosum:0.36 compass:0.67 pearson:0.92
Scaled scores:
dali:0.77 daliz:0.49 gdtts:0.56 tmscore:0.57 rmsd:0.70 AHM:0.67 LBcontacta:0.49 LBcontactb:0.77 LHM:0.28
id:-0.00 blosum:0.04 compass:0.21 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:346.30)
Query          1 gmenkKMNLLLFsgdydkALASLIIANAAREMEIEVTIFCAFwgllllrDPEKasqedks     60
d1uana_        1 ---mlDLLVVAP-hpddgELGCGGTLARAKAEGLSTGILDLT--rgemgSKGT-------     47

Query         61 lyeqafssltPREAeelplskmnlggigkkmllemmkeekapklsdlLSGARKKEV-KFY    119
d1uana_       48 ---------pEERE------------------------------kevAEASRILGLdFRG     68

Query        120 AXQlSVEIMgfkkeelfpevqimDVKEYLKNAlESDLQLF--------------------    159
d1uana_       69 NLG-FPDGG-----ladvpeqrlKLAQALRRL-RPRVVFApleadrhpdhtaasrlavaa    121

Query        160 ------------------------------------------------------------    160
d1uana_      122 vhlaglrkaplegepfrverlffypgnhpfapsflvkisafidqweaavlayrsqftvgp    181

Query        160 --------------------------------------i    160
d1uana_      182 kgvearkamrrywgnylgvdyaepfvsplpvlyvpwsra    220


hit structure      alignment
FAST alignment (Normalized score: 2.32 Raw score:435.40)
Query          1 GMENK--KMNLLLFSGDYDK----ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKA     54
d1uana_        1 -----MLDLLVVAPH-----PDDGELGCGGTLARAKAEGLSTGILDL-------------     37

Query         55 SQEDKSLYEQAFS--------SLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSD    106
d1uana_       38 -------------TRGEMGSKGTPE-----------------------------------     49

Query        107 L------LSGARKKE-VKFYAXQLSVEIMGFKKEELFPEVQIM----------------D    143
d1uana_       50 -EREKEVAEASRILGLDFRGNL---------------------GFPDGGLADVPEQRLKL     87

Query        144 VKEYLKNALESDLQLFI-------------------------------------------    160
d1uana_       88 AQALRR--LRPRVVF--APLEADRHPDHTAASRLAVAAVHLAGLRKAPLEGEPFRVERLF    143

Query        161 ------------------------------------------------------------    161
d1uana_      144 FYPGNHPFAPSFLVKISAFIDQWEAAVLAYRSQFTVGPKGVEARKAMRRYWGNYLGVDYA    203

Query        161 -----------------    161
d1uana_      204 EPFVSPLPVLYVPWSRA    220


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:62.77)
Query          1 GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKASQEDKS     60
d1uana_        1 ---MLDLLVVAPHPDD-GELGCGGTLARAKAEGLSTGILDLT--RG--------------     40

Query         61 LYEQAFSSLTPRE--------AEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGAR    112
d1uana_       41 ------E-MGSKGTPEEREKE------------------------------VAEASRIL-     62

Query        113 KKEVKFYAXQLSVEIM-----------GFKKEELFPEVQIMDVKEYLKNALESDLQLFI-    160
d1uana_       63 -GLDFRGNLG-F--PDGGLADVPEQRL--------------KLAQALRRL-RPRVVFAPL    103

Query        161 ------------------------------------------------------------    161
d1uana_      104 EADRHPDHTAASRLAVAAVHLAGLRKAPLEGEPFRVERLFFYPGNHPFAPSFLVKISAFI    163

Query        161 ---------------------------------------------------------    161
d1uana_      164 DQWEAAVLAYRSQFTVGPKGVEARKAMRRYWGNYLGVDYAEPFVSPLPVLYVPWSRA    220


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.38)
DALI match       ......      . ***********************  
Query          7 MNLLLFSGDYDKA-LASLIIANAAREMEIEVTIFCAFWG     44
d1uana_        2 LDLLVVAPHPDDGELGCGGTLARAKAEGLSTGILDLTRG     40



top
60: d1i8ta1 UDP-​galactopyranose mutase,​ N-​terminal domain (svm: 1.633)

SCOP Superfamily: Nucleotide-​binding domain  |  SCOP Fold: Nucleotide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.24  Contact: 564
Modified z-scores:
dali:0.91 daliz:0.93 gdtts:0.90 tmscore:0.90 rmsd:0.36 AHM:0.35 LBcontacta:0.88 LBcontactb:0.89 LHM:0.21
id:0.70 blosum:0.35 compass:0.49 pearson:0.86
Scaled scores:
dali:0.78 daliz:0.52 gdtts:0.59 tmscore:0.60 rmsd:0.76 AHM:0.71 LBcontacta:0.48 LBcontactb:0.73 LHM:0.31
id:0.01 blosum:0.06 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:378.80)
Query          1 gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAfwGLLLlrdpekasqedks     60
d1i8ta1        1 ---myDYIIVG------sGLFGAVCANELKKLNKKVLVIEK--RNHI-------------     36

Query         61 lyeqafssltprEAEE------lPLSKMnlggigkkmLLEM--mkeEKAP----------    102
d1i8ta1       37 ---------ggnAYTEdcegiqiHKYGA--------hIFHTndkyiWDYVndlvefnrft     79

Query        103 ------------------------------------------------------------    103
d1i8ta1       80 nsplaiykdklfnlpfnmntfhqmwgvkdpqeaqniinaqkkkygdkvpenleeqaislv    139

Query        103 ------------------------------------------------------klSDLL    108
d1i8ta1      140 gedlyqalikgytekqwgrsakelpafiikripvrftfdnnyfsdryqgipvggytKLIE    199

Query        109 SGARkkEVKFYAXqlsveimgfkkeelfpevqimDVKEyLKNALESDLQLFI--------    160
d1i8ta1      200 KMLE--GVDVKLG------------------idfLKDK-DSLASKAHRIIYTgpidqyfd    238

Query        161 ------------------------------------------------------------    161
d1i8ta1      239 yrfgalndnknmelfkkyrelasredkvifggrlaeykyydmhqvisaalyqvknimstd    298


hit structure      alignment
FAST alignment (Normalized score: 2.40 Raw score:523.00)
Query          1 GMENK--KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKAS     55
d1i8ta1        1 -----MYDYII---------VGSGLFGAVCANELKKLNKKVLVIEK--------------     32

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMNLGGI----------------------------     87
d1i8ta1       33 --------------------------------RNHIGGNAYTEDCEGIQIHKYGAHIFHT     60

Query         88 ---GKKMLLEMMKEEKAP------------------------------------------    102
d1i8ta1       61 NDKYIWDYVNDL------VEFNRFTNSPLAIYKDKLFNLPFNMNTFHQMWGVKDPQEAQN    114

Query        103 ------------------------------------------------------------    103
d1i8ta1      115 IINAQKKKYGDKVPENLEEQAISLVGEDLYQALIKGYTEKQWGRSAKELPAFIIKRIPVR    174

Query        103 ----------------------KLSDLLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQ    140
d1i8ta1      175 FTFDNNYFSDRYQGIPVGGYTKLIEKMLE-----GVDVK---------------------    208

Query        141 IM-------DVKEYLKNALESDLQLFI---------------------------------    160
d1i8ta1      209 --LGIDFLKDKDSLAS---KAHRIIY-TGPIDQYFDYRFGALNDNKNMELFKKYRELASR    262

Query        161 ------------------------------------    161
d1i8ta1      263 EDKVIFGGRLAEYKYYDMHQVISAALYQVKNIMSTD    298


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:42.08)
Query          1 -----GMENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIFCAFWGLLLLRDPEKAS     55
d1i8ta1        1 MYDYI---------------IVGSG-L---------------------F-----------     12

Query         56 QEDKSLYEQAFSSLTPREAEELPLSKMN-LGGIGKKMLLEMMKEEKAPKLSDLLSGA---    111
d1i8ta1       13 ------------------GA-VCANELKKLNKKV--LV--IE--KRNHIGGNAYTEDCEG     47

Query        112 -RK-KEVKFYAXQLSVEIM-GF--K--KEELFPEVQIM------------DVKE------    146
d1i8ta1       48 IQIHKYGAHIFHTND--KYIWDYVNDL-VEF-NRFTNSPLAIYKDKLFNL---PFNMNTF    100

Query        147 ------------------------------------------------------------    147
d1i8ta1      101 HQMWGVKDPQEAQNIINAQKKKYGDKVPENLEEQAISLVGEDLYQALIKGYTEKQWGRSA    160

Query        147 --------YLKN------------------------------------------------    150
d1i8ta1      161 KELPAFIIKRIPVRFTFDNNYFSDRYQGIPVGGYTKLIEKMLEGVDVKLGIDFLKDKDSL    220

Query        151 ------------------------------------------------------ALESDL    156
d1i8ta1      221 ASKAHRIIYTGPIDQYFDYRFGALNDNKNMELFKKYRELASREDKVIFGGRLAE-----Y    275

Query        157 QLF----I---------------    160
d1i8ta1      276 KYYDMHQVISAALYQVKNIMSTD    298


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.06)
DALI match       ********************
Query         20 LASLIIANAAREMEIEVTIF     39
d1i8ta1       11 LFGAVCANELKKLNKKVLVI     30



hit structures. 
top
61: d1d5ta1 Guanine nucleotide dissociation inhibitor,​ GDI (svm: 1.630)

SCOP Superfamily: FAD/​NAD(P)-​binding domain  |  SCOP Fold: FAD/​NAD(P)-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 538
Modified z-scores:
dali:0.88 daliz:0.90 gdtts:0.84 tmscore:0.86 rmsd:0.39 AHM:0.36 LBcontacta:0.91 LBcontactb:0.88 LHM:0.29
id:0.63 blosum:0.14 compass:0.29 pearson:0.75
Scaled scores:
dali:0.78 daliz:0.49 gdtts:0.51 tmscore:0.52 rmsd:0.75 AHM:0.70 LBcontacta:0.53 LBcontactb:0.70 LHM:0.27
id:0.01 blosum:0.01 compass:0.10 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:362.60)
Query          1 --gmenkKMNLLLfsgdydkALASLIIANAAREMEIEVTIFCAFwgLLLLrdpekasqed     58
d1d5ta1        1 hhmdeeyDVIVLG------tGLTECILSGIMSVNGKKVLHMDRN--PYYG----gesssi     48

Query         59 kslYEQAFSS-----------ltpreaeELPLskmnlggigkkmLLEMmkEEKA------    101
d1d5ta1       49 tplEELYKRFqllegppetmgrgrdwnvDLIP-----------kFLMA--NGQLvkmlly     95

Query        102 ------------------------------------------------------------    102
d1d5ta1       96 tevtryldfkvvegsfvykggkiykvpstetealasnlmgmfekrrfrkflvfvanfden    155

Query        102 ------------------------------------------------------------    102
d1d5ta1      156 dpktfegvdpqntsmrdvyrkfdlgqdvidftghalalyrtddyldqpcletinriklys    215

Query        102 -------------------pKLSDLLSGARKKEVKFYAXqlsveimgfkkeelfpevqiM    142
d1d5ta1      216 eslarygkspylyplyglgeLPQGFARLSAIYGGTYMLN--------------------K    255

Query        143 DVK------------EYLKnaLESDLQLFI------------------------------    160
d1d5ta1      256 PVDdiimengkvvgvKSEGevARCKQLICDpsyvpdrvpiddgsesqvfcscsydatthf    315

Query        161 ---------------------    161
d1d5ta1      316 ettcndikdiykrmagsafdf    336


hit structure      alignment
FAST alignment (Normalized score: 2.59 Raw score:600.60)
Query          1 GMENK-------KMNLLLFSGDYDK---ALASLIIANAAREMEIEVTIFCAFWGLLLLRD     50
d1d5ta1        1 -----HHMDEEYDVIV---------LGTGLTECILSGIMSVNGKKVLHMDR---------     37

Query         51 PEKASQED-----------KSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEM----     95
d1d5ta1       38 --------NPYYGGESSSITPLEELYKR----------------------------FQLL     61

Query         96 ----------------------MKEEKAP-------------------------------    102
d1d5ta1       62 EGPPETMGRGRDWNVDLIPKFLMANGQ--LVKMLLYTEVTRYLDFKVVEGSFVYKGGKIY    119

Query        103 ------------------------------------------------------------    103
d1d5ta1      120 KVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDL    179

Query        103 --------------------------------------------------------KLSD    106
d1d5ta1      180 GQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQG    239

Query        107 LLSGARKKEVKFYAXQLSVEIMGFKKEELFPEVQIMDVKEYLKNA---------------    151
d1d5ta1      240 FARLSAIYGGTYM--------------------LNKPV-------DDIIMENGKVVGVKS    272

Query        152 ----LESDLQLFI-----------------------------------------------    160
d1d5ta1      273 EGEVARCKQLI--CDPSYVPDRVPIDDGSESQVFCSCSYDATTHFETTCNDIKDIYKRMA    330

Query        161 ------    161
d1d5ta1      331 GSAFDF    336


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:45.05)
Query          1 ---GMENKKM----------NLLLFSGDYDKALASLIIANAAREMEIE------------     35
d1d5ta1        1 HHMDEEYDVIVLGTGLTECILSGI---------MSVNGK--KV--LHMDRNPYYGGESSS     47

Query         36 ----------------------------------------VTIFCAFWGLL--LLR-DPE     52
d1d5ta1       48 ITPLEELYKRFQLLEGPPETMGRGRDWNVDLIPKFLMANG----QLVKMLLYTEVTRYL-    102

Query         53 KASQEDKS----------------------------------------------------     60
d1d5ta1      103 DFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEG    162

Query         61 ----------------------------------------------------L-YEQA--     65
d1d5ta1      163 VDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYG    222

Query         66 FS----SLTPR----------EAEELPLSKMNLGGIGKKMLLEMMKEEKAPKLSDLLSGA    111
d1d5ta1      223 KSPYLY----PLYGLGELPQG--------------------------------FARLSAI    246

Query        112 R-KKEV------------------------------K----------------------F    118
d1d5ta1      247 YGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVPIDDGSESQVFC-    305

Query        119 Y-------AXQLSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQL-FI-    160
d1d5ta1      306 SCSYDATT-HFE-----------------TTCNDIKDIYKR-M-AGSAFDF    336


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.04)
DALI match           ......        ********************
Query          2 MENKKMNLLLFSGDYDKALASLIIANAAREMEIEVTIF     39
d1d5ta1        3 MDEEYDVIVLGTG-----LTECILSGIMSVNGKKVLHM     35



top
62: d1j23a_ Putative ATP-​dependent RNA helicase Hef,​ nuclease domain (svm: 0.994)

SCOP Superfamily: Restriction endonuclease-​like  |  SCOP Fold: Restriction endonuclease-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 495
Modified z-scores:
dali:0.87 daliz:0.84 gdtts:0.85 tmscore:0.86 rmsd:0.41 AHM:0.43 LBcontacta:0.85 LBcontactb:0.88 LHM:0.27
id:0.54 blosum:0.20 compass:0.30 pearson:0.80
Scaled scores:
dali:0.69 daliz:0.37 gdtts:0.50 tmscore:0.49 rmsd:0.71 AHM:0.63 LBcontacta:0.41 LBcontactb:0.67 LHM:0.19
id:-0.01 blosum:0.03 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:285.10)
Query          1 -----------------------------------gmeNKKMNLLLFSGD-YDKA--lAS     22
d1j23a_        1 vkvvvdsrelrsevvkrlkllgvklevktldvgdyiisEDVAIERKSANDlIQSIidgGL     60

Query         23 LIIANAAREMEIEVTIFCAFWgllllrdpekasqedkslyeqafssLTPREAEelplskm     82
d1j23a_       61 FDQVKRLKEAYSRPIMIVEGS---------------------lygiRNVHPNA-------     92

Query         83 nlggigkkmllemmkeekapklSDLLSGAR-KKEVKFYAXQLsveimgfkkeelfpevqi    141
d1j23a_       93 ---------------------iRGAIAAVTvDFGVPIIFSST----------------pe    115

Query        142 MDVKEYLKNALEsdlqlfi    160
d1j23a_      116 ETAQYIFLIAKR---eqee    131


hit structure      alignment
FAST alignment (Normalized score: 3.32 Raw score:480.10)
Query          1 GME--------------------------------------NKKMNLLLFSGDYDK----     18
d1j23a_        1 ---VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKS------ANDL     51

Query         19 -----ALASLIIANAAREME--IEVTIFCAFWGLLLLRDPEKASQEDKSLYEQA----FS     67
d1j23a_       52 IQSIIDGGLFDQVKRLKE--AYSRPIMIVE------------------------GSLYGI     85

Query         68 SLTPREAEELPLSKMNLGGIGKKMLLEMMKEEKAP----KLSDLLSGA-RKKEVKFYAXQ    122
d1j23a_       86 RN---------------------------------VHPNAIRGAIAAVTVDFGVPIIFS-    111

Query        123 LSVEIMGFKKEELFPEVQIMDVKEYLKNALESDLQLFI--------    160
d1j23a_      112 -------------------STPEETAQYIFL-------IAKREQEE    131


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:59.52)
Query          1 GMENKKMNL--L-------------------LFSGDYDKALASLIIAN-AAREMEIEVTI     38
d1j23a_        1 ---VKVVVDSRELRSEVVKRLKLLGVKLEVK-----------TLDVGDY-II-SEDVAIE     44

Query         39 FCAFWGL-LLLRDPEKASQEDKSLYEQAFSSLTPREAEELPLSKMNLGGIGKKMLLEMMK     97
d1j23a_       45 RKSANDLIQS-I--------------------ID</