HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T0542d1
Query:
T0542_Ad1.pdb
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1j31a_ Hypothetical protein PH0642 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 21.97 1.110 1.00 28.1 20.3 0.71
2 d1f89a_ hypothetical protein yl85 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 20.99 1.207 1.00 26.3 18.5 0.72
3 d1uf5a_ N-​carbamoyl-​D-​aminoacid amidohydrolase Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 20.68 1.392 1.00 24.9 18.0 0.73
4 d1emsa2 NIT-​FHIT fusion protein,​ N-​terminal domain Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 20.63 1.249 1.00 25.8 18.5 0.72
5 d1ii7a_ Mre11 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.76 1.977 0.10 7.3 4.0 0.49
6 d1uf3a_ Hypothetical protein TT1561 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.51 0.891 0.94 6.8 4.4 0.49
7 d1hp1a2 5'​-​nucleotidase (syn. UDP-​sugar hydrolase),​ N-​terminal domain Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.41 1.978 0.05 6.6 3.7 0.51
8 d1ntfa_ Salivary nitrophorin DNase I-​like DNase I-​like α+β 4.08 1.258 0.11 4.5 3.5 0.51
9 d4kbpa2 Plant purple acid phosphatase,​ catalytic domain Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.04 1.981 0.01 5.9 3.2 0.48
10 d1s3la_ Putative phosphodiesterase MJ0936 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.04 1.956 0.38 6.1 4.0 0.40
11 d1vyba_ Endonuclease domain of LINE-​1 reverse transcriptase homolog DNase I-​like DNase I-​like α+β 3.99 1.432 0.08 4.3 3.9 0.45
12 d2dnja_ Deoxyribonuclease I DNase I-​like DNase I-​like α+β 3.89 1.411 0.07 4.0 3.9 0.46
13 d1utea_ Mammalian purple acid phosphatase Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 3.62 1.981 0.02 5.4 3.1 0.49
14 d1i9za_ Synaptojanin,​ IPP5C domain DNase I-​like DNase I-​like α+β 3.49 1.429 0.02 4.1 3.7 0.51
15 d1su1a_ Phosphodiesterase yfcE Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 3.44 1.390 0.28 4.6 3.5 0.38
16 d1hd7a_ DNA repair endonuclease Hap1 DNase I-​like DNase I-​like α+β 3.22 1.431 0.09 4.0 2.9 0.42
17 d1wdua_ Endonuclease domain of TRAS1 retrotransposon (ORF2) DNase I-​like DNase I-​like α+β 3.09 1.432 0.14 3.7 3.6 0.43
18 d1sr4b_ Cytolethal distending toxin subunit B DNase I-​like DNase I-​like α+β 3.05 1.430 0.01 3.6 2.9 0.48
19 d1akoa_ DNA-​repair enzyme exonuclease III DNase I-​like DNase I-​like α+β 3.04 1.431 0.07 3.4 3.5 0.45
20 d1nnwa_ Hypothetical protein PF1291 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 2.71 1.786 0.12 3.2 3.1 0.39
21 d1vjna_ Hypothetical protein TM0207 Metallo-​hydrolase/​oxidoreductase Metallo-​hydrolase/​oxidoreductase α+β 2.692 -0.180 0.03 3.0 2.8 0.37
22 d1rv9a_ Hypothetical protein NMB0706 CNF1/​YfiH-​like putative cysteine hydrolases CNF1/​YfiH-​like putative cysteine hydrolases α+β 2.210 -0.520 0.02 2.4 1.9 0.36
23 d1a4ma_ Adenosine deaminase (ADA) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.17 0.887 0.02 3.2 2.3 0.49
24 d1k87a2 Proline dehydrohenase domain of bifunctional PutA protein FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.15 0.885 0.04 3.5 2.7 0.48
25 d1ceoa_ Endoglucanase CelC (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.15 0.888 0.02 4.3 2.9 0.46
26 d1thfd_ Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 2.11 0.888 0.03 4.0 3.1 0.46
27 d1sr9a2 2-​isopropylmalate synthase LeuA,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 2.07 0.666 0.02 4.3 2.4 0.49
28 d1i60a_ Hypothetical protein IolI Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 2.03 0.887 0.22 3.5 2.0 0.44
29 d1l6sa_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 2.01 0.892 0.10 4.3 2.7 0.47
30 d1sgja_ Citrate lyase,​ beta subunit Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.97 0.888 0.04 3.7 2.8 0.46
31 d1bqca_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.97 0.885 0.05 3.1 2.4 0.49
32 d1b5ta_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.95 0.889 0.02 3.5 3.4 0.46
33 d1qtwa_ Endonuclease IV Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.95 0.888 0.05 3.1 2.4 0.44
34 d1nofa2 Glycosyl hydrolase family 5 xylanase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.94 0.888 0.04 4.0 2.7 0.44
35 d1gzga_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.93 0.895 0.06 3.8 2.8 0.46
36 d1q7za2 Cobalamin-​dependent methionine synthase MetH,​ N-​terminal domain Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 1.92 0.891 0.05 3.4 3.0 0.50
37 d1xi3a_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 1.92 0.891 0.09 3.7 3.5 0.42
38 d1lucb_ Bacterial luciferase beta chain,​ LuxB Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.86 0.887 0.16 2.9 2.8 0.46
39 d1lt8a_ Betaine-​homocysteine S-​methyltransferase Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 1.85 0.889 0.03 3.3 2.6 0.50
40 d1luca_ Bacterial luciferase alpha chain,​ LuxA Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.84 0.888 0.15 3.3 2.9 0.46
41 d1rvka1 Hypothetical protein Atu3453 Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.83 0.885 0.05 2.9 2.9 0.42
42 d7a3ha_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.83 0.885 0.03 3.2 2.4 0.48
43 d1jk7a_ Protein phosphatase-​1 (PP-​1) Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.82 1.977 0.02 2.4 1.9 0.39
44 d1edga_ Endoglucanase CelA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.81 0.888 0.04 3.4 2.0 0.43
45 d1q6oa_ 3-​keto-​L-​gulonate 6-​phosphate decarboxylase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.80 0.889 0.04 3.7 3.6 0.43
46 d1auia_ Protein phosphatase-​2B (PP-​2B,​ calcineurin A subunit) Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.80 1.979 0.01 2.1 2.0 0.39
47 d1foba_ Beta-​1,​4-​galactanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.78 0.889 0.02 4.1 2.5 0.42
48 d1j93a_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.78 0.875 0.14 2.8 2.9 0.44
49 d1tf7a1 Circadian clock protein KaiC P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.78 1.007 0.01 2.3 2.6 0.33
50 d7odca2 Eukaryotic ornithine decarboxylase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.76 0.601 0.01 3.0 2.6 0.36
51 d1ogsa2 Glucosylceramidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.75 0.886 0.01 3.3 2.4 0.41
52 d1onra_ Transaldolase Aldolase TIM beta/​alpha-​barrel α/β 1.75 0.633 0.02 3.2 2.8 0.43
53 d1kkoa1 beta-​Methylaspartase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.75 0.887 0.01 3.2 2.2 0.46
54 d1i1wa_ Xylanase A,​ catalytic core (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.74 0.887 0.02 2.9 2.1 0.44
55 d1p1xa_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.74 0.890 0.04 3.1 3.1 0.44
56 d1tx2a_ Dihydropteroate synthetase Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 1.74 0.888 0.06 3.0 3.2 0.47
57 d1ec7a1 D-​glucarate dehydratase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.74 0.886 0.01 3.4 2.7 0.42
58 d1qnra_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.74 0.885 0.03 3.4 2.1 0.48
59 d2tpsa_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 1.74 0.888 0.04 2.8 2.5 0.43
60 d1egza_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.74 0.888 0.04 3.5 2.8 0.47
61 d1us3a2 Xylanase 10c (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.73 0.887 0.03 3.7 2.4 0.41
62 d1p1ma2 Hypothetical protein TM0936,​ probable catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.73 0.884 0.01 2.2 2.2 0.45
63 d1uasa2 Melibiase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.73 0.885 0.02 2.9 2.0 0.46
64 d1exba_ Voltage-​dependent K+ channel beta subunit NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.72 0.680 0.01 3.5 1.9 0.47
65 d1bf6a_ Phosphotriesterase homology protein Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.71 0.777 0.02 2.7 1.8 0.46
66 d1ub3a_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.71 0.893 0.10 3.6 3.0 0.42
67 d1a0ca_ D-​xylose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.71 0.886 0.02 3.3 2.6 0.45
68 d1vjza_ Endoglucanase homologue TM1752 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.70 0.889 0.03 3.5 2.1 0.46
69 d1q7za1 Cobalamin-​dependent methionine synthase MetH,​ C-​terminal domain Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 1.70 0.885 0.07 2.8 1.8 0.45
70 d1gcya2 G4-​amylase (1,​4-​alpha-​D-​glucan maltotetrahydrolase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.70 0.885 0.02 3.3 2.1 0.49
71 d1gk8a1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.70 0.888 0.02 3.3 2.2 0.43
72 d1f6ya_ corrinoid/​iron-​sulfur protein methyltransferase MetR Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 1.68 0.662 0.06 2.9 2.3 0.46
73 d1ohla_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.67 0.890 0.09 3.6 2.0 0.40
74 d1o94a1 Trimethylamine dehydrogenase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.67 0.891 0.03 2.7 2.3 0.44
75 d1r30a_ Biotin synthase Radical SAM enzymes TIM beta/​alpha-​barrel α/β 1.67 0.886 0.02 2.5 3.2 0.41
76 d1m3ua_ Ketopantoate hydroxymethyltransferase PanB Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.66 0.888 0.06 2.9 2.7 0.44
77 d1d8wa_ L-​rhamnose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.66 0.886 0.01 2.7 2.0 0.50
78 d1k77a_ Hypothetical protein YgbM (EC1530) Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.66 0.887 0.06 2.1 2.1 0.43
79 d1nlfa_ Hexameric replicative helicase repA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.66 1.029 0.02 1.7 1.8 0.36
80 d1bhga3 beta-​Glucuronidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.66 0.888 0.02 2.4 2.1 0.47
81 d1v93a_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.65 0.889 0.01 2.8 3.1 0.46
82 d1muca1 Muconate-​lactonizing enzyme Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.65 0.886 0.01 2.4 2.4 0.42
83 d1u1ja2 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.65 0.896 0.04 2.4 2.1 0.44
84 d1vlia2 Spore coat polysaccharide biosynthesis protein SpsE,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 1.65 0.826 0.28 3.3 2.0 0.46
85 d1geha1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.64 0.886 0.02 2.7 2.8 0.46
86 d1vlwa_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.64 0.887 0.03 3.1 2.8 0.36
87 d1jpma1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.63 0.885 0.01 2.8 2.7 0.42
88 d1tqja_ D-​ribulose-​5-​phosphate 3-​epimerase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.63 0.795 0.03 2.9 2.8 0.44
89 d1h7wa2 Dihydropyrimidine dehydrogenase,​ domain 4 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.63 0.889 0.01 2.9 2.6 0.46
90 d1pe1a_ 3-​deoxy-​D-​manno-​octulosonate 8-​phosphate synthase (KDO8P synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.62 0.885 0.06 3.0 1.9 0.43
91 d1twda_ Copper homeostasis protein CutC CutC-​like (Pfam 03932) TIM beta/​alpha-​barrel α/β 1.62 0.890 0.12 3.5 2.1 0.43
92 d1kwga2 A4 beta-​galactosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.62 0.889 0.04 3.8 2.1 0.39
93 d1us0a_ Aldose reductase (aldehyde reductase) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.60 0.682 0.01 2.8 2.2 0.47
94 d1xyza_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.60 0.889 0.02 3.0 1.7 0.44
95 d1ezwa_ Coenzyme F420 dependent tetrahydromethanopterin reductase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.60 0.887 0.05 3.1 2.1 0.46
96 d1n7ka_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.60 0.890 0.12 3.1 2.7 0.41
97 d1vc4a_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.59 0.889 0.02 2.7 2.9 0.42
98 d1ps9a1 2,​4-​dienoyl-​CoA reductase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.59 0.888 0.02 3.2 2.4 0.42
99 d1qo2a_ Phosphoribosylformimino-​5-​aminoimidazole carboxamide ribotite isomerase HisA Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.59 0.887 0.01 2.3 2.6 0.39
100 d1o1za_ Hypothetical protein TM1621 PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.57 0.885 0.02 2.3 2.6 0.36
101 d1k6wa2 Cytosine deaminase catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.57 0.887 0.01 2.7 2.2 0.48
102 d1l6wa_ Fructose-​6-​phosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.57 0.872 0.02 3.2 2.2 0.41
103 d1m5wa_ Pyridoxine 5'​-​phosphate synthase Pyridoxine 5'​-​phosphate synthase TIM beta/​alpha-​barrel α/β 1.57 0.887 0.03 2.9 2.9 0.44
104 d2mnra1 Mandelate racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.56 0.887 0.02 2.7 3.1 0.43
105 d1bd0a2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.56 0.891 0.01 2.3 2.7 0.30
106 d1nvma2 4-​hydroxy-​2-​oxovalerate aldolase DmpG,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 1.56 0.778 0.05 2.9 2.5 0.43
107 d1tz9a_ Mannonate dehydratase UxuA Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.56 0.886 0.05 2.0 2.3 0.45
108 d1r0ma1 N-​acylamino acid racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.55 0.779 0.01 2.5 2.2 0.41
109 d1rqba2 Transcarboxylase 5S subunit,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 1.55 0.884 0.04 2.5 2.2 0.47
110 d1viza_ PcrB protein homolog YerE FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.55 0.852 0.05 2.1 2.7 0.38
111 d1jz7a5 beta-​Galactosidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.54 0.886 0.02 2.4 1.6 0.44
112 d1h1na_ Endocellulase EngI (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.54 0.885 0.05 2.9 2.1 0.46
113 d1odza_ Mannanase A,​ ManA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.53 0.887 0.01 1.9 2.0 0.51
114 d1of8a_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 1.52 0.885 0.01 2.9 1.9 0.47
115 d1oc7a_ Cellobiohydrolase II (Cel6) Cellulases 7-​stranded beta/​alpha barrel α/β 1.52 0.664 0.03 2.3 1.7 0.44
116 d1aw1a_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 1.52 0.884 0.02 2.4 1.3 0.46
117 d1qbaa3 Bacterial chitobiase (beta-​N-​acetylhexosaminidase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.51 0.887 0.02 2.6 1.9 0.51
118 d1jpdx1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.51 0.884 0.01 2.8 2.6 0.38
119 d1muma_ 2-​methylisocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.51 0.887 0.04 3.3 2.2 0.45
120 d1tvla_ Putative monooxygenase YtnJ Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.51 0.887 0.03 2.2 2.8 0.47
121 d1s95a_ Serine/​threonine protein phosphatase 5,​ PP5 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.49 1.978 0.01 1.6 1.7 0.38
122 d1p4ca_ Membrane-​associated (S)-​mandelate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.49 0.855 0.01 2.3 2.3 0.44
123 d1ta3a_ Xylanase inhibitor protein I,​ XIP-​I (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.49 0.885 0.01 2.9 2.4 0.45
124 d1eqca_ Exo-​beta-​(1,​3)-​glucanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.49 0.888 0.07 2.7 1.9 0.43
125 d1ur1a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.48 0.884 0.02 2.9 2.4 0.45
126 d1jaka1 beta-​N-​acetylhexosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.48 0.887 0.02 2.1 2.6 0.48
127 d1okkd2 GTPase domain of the signal recognition particle receptor FtsY P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.47 0.768 0.01 1.7 2.3 0.34
128 d1nsja_ N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.47 0.891 0.01 2.7 2.6 0.40
129 d1vjga_ Hypothetical protein alr1529 SGNH hydrolase Flavodoxin-​like α/β 1.47 1.031 0.02 2.2 1.2 0.33
130 d1vyra_ Pentaerythritol tetranirate reductase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.46 0.890 0.03 2.7 2.3 0.41
131 d1ct5a_ ​(​Hypothetical​(​ protein ybl036c PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.46 0.651 0.03 2.2 2.0 0.35
132 d1j6oa_ Hypothetical protein TM0667 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.46 0.693 0.01 2.2 1.3 0.43
133 d1hl2a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 1.46 0.893 0.05 3.1 2.3 0.45
134 d1u1ja1 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.46 0.892 0.03 1.4 2.3 0.44
135 d1ujpa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.45 0.890 0.03 2.4 3.1 0.43
136 d1spva_ Hypothetical protein YmbD Macro domain-​like Macro domain-​like α/β 1.45 0.928 0.09 2.0 2.3 0.30
137 d1pbga_ 6-​phospho-​beta-​D-​galactosidase,​ PGAL (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.45 0.888 0.02 3.0 2.1 0.48
138 d1q45a_ 12-​oxophytodienoate reductase (OPR,​ OYE homolog) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.44 0.889 0.02 2.8 2.2 0.41
139 d1o5ka_ Dihydrodipicolinate synthase Aldolase TIM beta/​alpha-​barrel α/β 1.44 0.895 0.11 3.4 2.0 0.43
140 d1kbla1 Pyruvate phosphate dikinase,​ C-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.44 0.886 0.02 2.2 2.0 0.41
141 d1dosa_ Fructose-​bisphosphate aldolase (FBP aldolase) Aldolase TIM beta/​alpha-​barrel α/β 1.44 0.635 0.06 2.9 2.1 0.46
142 d1t8qa_ Glycerophosphodiester phosphodiesterase GlpQ PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.44 0.887 0.02 1.7 1.9 0.44
143 d1r85a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.43 0.887 0.02 2.4 2.2 0.45
144 d1qopa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.43 0.890 0.03 2.2 2.7 0.44
145 d1geqa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.42 0.888 0.04 2.3 3.5 0.44
146 d1d3ga_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.42 0.890 0.02 2.7 1.8 0.48
147 d1oyba_ Old yellow enzyme (OYE) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.42 0.892 0.02 2.5 2.0 0.42
148 d1to3a_ Putative aldolase YihT Aldolase TIM beta/​alpha-​barrel α/β 1.41 0.888 0.05 2.1 2.2 0.43
149 d1d3va_ Arginase Arginase/​deacetylase Arginase/​deacetylase α/β 1.41 0.813 0.02 2.0 1.9 0.37
150 d1pyfa_ Putative oxidoreductase IolS NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.40 0.886 0.01 2.3 1.9 0.46
151 d1m7ja3 N-​acyl-​D-​aminoacid amidohydrolase,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.40 0.747 0.01 2.2 1.5 0.48
152 d2ebna_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.39 0.886 0.01 2.1 2.2 0.43
153 d1x7fa2 Outer surface protein,​ N-​terminal domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.38 0.885 0.02 2.2 3.0 0.43
154 d1p0ka_ Isopentenyl-​diphosphate delta-​isomerase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.38 0.889 0.01 2.0 3.0 0.45
155 d1ecea_ Endocellulase E1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.38 0.751 0.07 2.0 1.7 0.51
156 d1cr1a_ Gene 4 protein (g4p,​ DNA primase),​ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.38 1.030 0.04 2.1 1.4 0.32
157 d1rhca_ Coenzyme F420 dependent secondary alcohol dehydrogenase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.38 0.886 0.16 2.4 2.6 0.46
158 d1adoa_ Fructose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.38 0.886 0.02 2.1 2.5 0.46
159 d1izca_ Macrophomate synthase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.38 0.886 0.02 1.8 2.3 0.42
160 d1itxa1 Chitinase A1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.37 0.887 0.01 3.1 1.9 0.50
161 d1ojxa_ Archaeal fructose 1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.37 0.887 0.06 2.2 2.6 0.42
162 d1a49a2 Pyruvate kinase,​ N-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.37 0.886 0.03 2.7 2.6 0.43
163 d1mxga2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.37 0.885 0.03 2.5 2.3 0.47
164 d1w0ma_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 1.37 0.888 0.03 2.1 1.9 0.44
165 d1gvfa_ Tagatose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.37 0.887 0.12 2.0 2.6 0.42
166 d1ls1a2 GTPase domain of the signal sequence recognition protein Ffh P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.37 1.024 0.02 1.7 2.0 0.32
167 d1o7ja_ Asparaginase type II Glutaminase/​Asparaginase Glutaminase/​Asparaginase α/β 1.37 -1.169 0.93 1.8 1.8 0.31
168 d1vhca_ Hypothetical protein HI0047 Aldolase TIM beta/​alpha-​barrel α/β 1.36 0.859 0.06 2.4 2.8 0.40
169 d1f74a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 1.35 0.888 0.08 2.7 2.1 0.43
170 d1hkka1 Chitotriosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.34 0.885 0.01 2.7 1.9 0.43
171 d1edqa2 Chitinase A,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.34 0.889 0.01 2.3 2.2 0.43
172 d1n0wa_ DNA repair protein Rad51,​ catalytic domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.33 1.027 0.05 1.4 2.0 0.32
173 d1gvea_ Aflatoxin aldehyde reductase (akr7a1) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.33 0.884 0.01 2.2 1.6 0.45
174 d1vhna_ Putative flavin oxidoreducatase TM0096 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.33 0.888 0.01 2.2 1.8 0.37
175 d1fq0a_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.33 0.885 0.05 1.9 2.9 0.40
176 d1rcqa2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.32 0.888 0.01 1.4 2.3 0.38
177 d1edta_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.29 0.886 0.01 1.6 2.5 0.43
178 d1qwga_ (2r)-​phospho-​3-​sulfolactate synthase ComA (2r)-​phospho-​3-​sulfolactate synthase ComA TIM beta/​alpha-​barrel α/β 1.29 0.776 0.02 2.0 2.4 0.39
179 d1m8pa3 ATP sulfurylase C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.29 1.025 0.02 2.0 1.3 0.30
180 d1qw9a2 Alpha-​L-​arabinofuranosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.29 0.889 0.01 2.7 1.6 0.40
181 d1gg4a1 UDP-​murNac-​tripeptide D-​alanyl-​D-​alanine-​adding enzyme MurF MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.29 1.022 0.02 1.8 2.2 0.27
182 d1eswa_ Amylomaltase MalQ (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.28 0.752 0.01 2.1 1.8 0.44
183 d1r5ya_ Queosine tRNA-​guanine transglycosylase tRNA-​guanine transglycosylase TIM beta/​alpha-​barrel α/β 1.28 0.886 0.01 2.4 2.4 0.43
184 d1i4na_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.28 0.888 0.06 1.8 2.5 0.42
185 d1zfja1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 1.28 0.889 0.01 1.8 2.5 0.43
186 d5ruba1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.27 0.887 0.01 2.0 2.3 0.46
187 d1dxea_ 2-​dehydro-​3-​deoxy-​galactarate aldolase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.27 0.888 0.02 1.9 2.8 0.41
188 d1juba_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.27 0.887 0.01 1.9 2.4 0.45
189 d1uhva2 Beta-​D-​xylosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.27 0.885 0.02 2.4 2.2 0.39
190 d1tf7a2 Circadian clock protein KaiC P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.26 1.002 0.04 1.6 1.5 0.34
191 d1aq0a_ Plant beta-​glucanases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.26 0.790 0.01 2.4 1.3 0.40
192 d1g5ba_ lambda ser/​thr protein phosphatase Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.25 1.977 0.08 0.6 2.1 0.36
193 d1fyea_ Aspartyl dipeptidase PepE Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 1.25 0.617 0.04 1.7 1.7 0.33
194 d1km4a_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.25 0.885 0.02 1.7 2.9 0.36
195 d1a53a_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.25 0.891 0.03 2.2 2.5 0.42
196 d1tmla_ Cellulase E2 Cellulases 7-​stranded beta/​alpha barrel α/β 1.25 0.682 0.02 1.5 1.9 0.44
197 d1qhoa4 Cyclodextrin glycosyltransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.25 0.889 0.04 1.7 1.7 0.49
198 d1nara_ Seed storage protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.24 0.886 0.02 1.2 2.0 0.45
199 d1odfa_ Hypothetical protein Ygr205W P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.24 0.946 0.01 0.9 1.4 0.32
200 d1fc6a4 Photosystem II D1 C-​terminal processing protease ClpP/​crotonase ClpP/​crotonase α/β 1.24 1.030 0.01 1.7 1.3 0.31
201 d1ua7a2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.24 0.847 0.03 2.2 1.7 0.45
202 d1dbta_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.23 0.887 0.04 1.5 2.5 0.40
203 d1ht6a2 Plant alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.23 0.885 0.02 1.0 2.5 0.46
204 d1pvna1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 1.23 0.889 0.01 1.6 2.4 0.43
205 d1m7xa3 1,​4-​alpha-​glucan branching enzyme,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.22 0.885 0.02 1.9 2.3 0.47
206 d1kfwa1 Psychrophilic chitinase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.22 0.884 0.01 2.3 2.2 0.46
207 d1dqua_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.21 0.887 0.01 2.3 1.5 0.45
208 d1ep3a_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.21 0.887 0.03 1.6 2.4 0.46
209 d1nowa1 beta-​hexosaminidase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.21 0.887 0.02 1.8 1.9 0.48
210 d1h3ga3 Cyclomaltodextrinase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.20 0.888 0.03 1.9 1.8 0.48
211 d1uwsa_ beta-​Glycosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.20 0.888 0.02 2.4 2.0 0.47
212 d1i0da_ Phosphotriesterase (parathion hydrolase,​ PTE) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.20 0.854 0.03 1.4 1.7 0.47
213 d1uuqa_ Exomannosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.20 0.888 0.02 1.8 2.0 0.49
214 d1vkfa_ Glycerol uptake operon antiterminator-​related protein TM1436 GlpP-​like TIM beta/​alpha-​barrel α/β 1.19 0.887 0.01 1.9 2.2 0.36
215 d1eyea_ Dihydropteroate synthetase Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 1.18 0.886 0.06 1.8 2.3 0.44
216 d1hw6a_ 2,​5-​diketo-​D-​gluconic acid reductase A NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.18 0.884 0.02 1.1 1.7 0.43
217 d1e4mm_ Plant beta-​glucosidase (myrosinase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.18 0.889 0.01 2.6 1.9 0.40
218 d1s2wa_ Phosphoenolpyruvate mutase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.18 0.890 0.06 2.6 2.1 0.37
219 d1lwha2 4-​alpha-​glucanotransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.17 0.885 0.04 1.6 1.8 0.45
220 d1f61a_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.16 0.887 0.01 2.7 1.2 0.46
221 d1dqwa_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.16 0.884 0.04 1.6 1.5 0.38
222 d1jr1a1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 1.16 0.889 0.01 2.2 2.1 0.39
223 d1mt0a_ Haemolysin B ATP-​binding protein P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.16 1.029 0.08 1.4 1.6 0.32
224 d1d2ka1 Chitinase 1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.16 0.886 0.01 2.0 1.6 0.45
225 d1jnda1 Imaginal disc growth factor-​2 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.16 0.887 0.01 2.2 1.9 0.43
226 d1gcia_ Subtilisin Subtilisin-​like Subtilisin-​like α/β 1.15 0.722 0.04 1.2 1.7 0.38
227 d1j18a2 Bacterial beta-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.15 0.889 0.01 2.1 2.0 0.41
228 d1o14a_ Putative sugar kinase TM0828 Ribokinase-​like Ribokinase-​like α/β 1.15 0.827 0.01 1.6 1.8 0.40
229 d1ug6a_ Beta-​glucosidase A (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.15 0.888 0.02 1.9 2.8 0.44
230 d1on3a2 Methylmalonyl-​CoA carboxyltransferase (transcarboxylase 12S) ClpP/​crotonase ClpP/​crotonase α/β 1.14 0.610 0.09 0.7 1.7 0.33
231 d1e43a2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.13 0.886 0.03 1.5 2.2 0.45
232 d1o4ua1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.13 0.890 0.05 1.8 2.5 0.28
233 d1v3ha_ beta-​Amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.13 0.890 0.01 2.0 1.9 0.51
234 d1js1x1 Transcarbamylase-​like protein Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.13 0.744 0.01 1.6 1.8 0.25
235 d1rzma_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 1.12 0.887 0.02 2.2 2.4 0.41
236 d1goia2 Chitinase B,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.11 0.885 0.01 2.0 1.9 0.44
237 d1nqka_ Alkanesulfonate monooxygenase SsuD Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.11 0.889 0.09 1.7 1.7 0.44
238 d1u94a1 RecA protein,​ ATPase-​domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.11 1.028 0.09 1.5 1.2 0.31
239 d1gmla_ Thermosome,​ A-​domain GroEL apical domain-​like The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 1.10 0.777 0.14 0.0 2.1 0.22
240 d1eh9a3 Glycosyltrehalose trehalohydrolase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.09 0.888 0.06 1.7 1.7 0.45
241 d7taaa2 Fungal alpha-​amylases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.09 0.885 0.04 1.8 1.9 0.47
242 d1j23a_ Putative ATP-​dependent RNA helicase Hef,​ nuclease domain Restriction endonuclease-​like Restriction endonuclease-​like α/β 1.09 1.000 0.01 1.9 1.8 0.26
243 d1nqua_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 1.08 0.814 0.13 1.8 2.0 0.27
244 d1e69a_ Smc head domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.08 1.020 0.01 1.0 1.5 0.31
245 d1di6a_ MogA Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 1.08 0.815 0.04 1.5 1.9 0.28
246 d1qcza_ N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) Flavodoxin-​like α/β 1.08 0.821 0.04 1.3 1.8 0.27
247 d1r0wa_ Cystic fibrosis transmembrane conductance regulator,​ CFTR,​ nucleotide-​binding domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.07 1.029 0.07 0.8 1.8 0.31
248 d1g6ha_ MJ1267 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.07 1.032 0.08 0.9 2.0 0.34
249 d1piia1 Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.07 0.893 0.02 1.8 2.1 0.41
250 d1ji1a3 Maltogenic amylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.07 0.888 0.02 1.8 1.7 0.45
251 d1vhua_ Hypothetical protein AF1521 Macro domain-​like Macro domain-​like α/β 1.05 0.803 0.03 1.2 1.6 0.26
252 d1m7ga_ Adenosine-​5'​phosphosulfate kinase (APS kinase) P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.05 1.018 0.03 2.1 1.4 0.30
253 d1ccwb_ Glutamate mutase,​ large subunit Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 1.05 0.885 0.02 2.2 1.9 0.47
254 d1kbia1 Flavocytochrome b2,​ C-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.05 0.846 0.02 1.4 2.1 0.45
255 d1ejba_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 1.04 0.819 0.05 1.7 1.9 0.25
256 d1ji2a3 Maltogenic amylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.04 0.890 0.03 1.3 2.0 0.46
257 d1b74a1 Glutamate racemase Aspartate/​glutamate racemase ATC-​like α/β 1.04 1.407 0.03 1.6 2.5 0.21
258 d1oywa2 RecQ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.03 1.025 0.01 1.0 1.7 0.32
259 d1sgwa_ Putative ABC transporter PF0895 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.03 1.030 0.03 1.2 1.6 0.26
260 d1n55a_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 1.03 0.674 0.04 1.3 2.0 0.39
261 d1q3qa2 Thermosome,​ A-​domain GroEL apical domain-​like The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 1.03 1.221 0.05 0.9 2.3 0.21
262 d1f2t.1 Rad50 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.03 1.022 0.02 1.7 0.8 0.31
263 d1piia2 N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.02 0.886 0.02 1.7 1.9 0.37
264 d1bf2a3 Isoamylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.02 0.887 0.03 1.5 1.7 0.47
265 d1th8b_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 1.01 0.841 0.02 1.8 1.3 0.23
266 d1cbua_ Adenosylcobinamide kinase/​adenosylcobinamide phosphate guanylyltransferase CobU P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.01 1.033 0.07 1.5 1.6 0.28
267 d1w0ja3 Central domain of alpha subunit of F1 ATP synthase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.01 1.030 0.01 1.2 1.4 0.35
268 d1ey3a_ Enoyl-​CoA hydratase (crotonase) ClpP/​crotonase ClpP/​crotonase α/β 1.00 0.715 0.01 0.9 1.5 0.33
269 d1ijba_ von Willebrand factor A1 domain,​ vWA1 vWA-​like vWA-​like α/β 1.00 1.030 0.02 1.2 1.9 0.33
270 d1l7vc_ ABC transporter involved in vitamin B12 uptake,​ BtuD P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.00 1.031 0.07 0.4 1.7 0.33
271 d1r7aa2 Sucrose phosphorylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.99 0.887 0.01 1.3 1.3 0.46
272 d1uaaa1 DEXX box DNA helicase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.99 1.023 0.01 0.7 1.3 0.34
273 d1hx0a2 Animal alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.98 0.886 0.04 0.8 1.6 0.45
274 d1w3ia_ 2-​keto-​3-​deoxy gluconate aldolase Eda Aldolase TIM beta/​alpha-​barrel α/β 0.98 0.890 0.09 1.5 1.4 0.44
275 d1nmoa_ Hypothetical protein YbgI NIF3 (NGG1p interacting factor 3)-​like NIF3 (NGG1p interacting factor 3)-​like α/β 0.97 0.758 0.09 1.7 1.5 0.23
276 d1a5ta2 delta prime subunit of DNA polymerase III,​ N-​domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.96 1.031 0.01 1.3 1.0 0.30
277 d1jkea_ D-​Tyr tRNAtyr deacylase,​ DTD DTD-​like (Pfam 02580) DTD-​like (Pfam 02580) α/β 0.94 0.638 0.01 0.8 2.0 0.25
278 d1uoka2 Oligo-​1,​6,​ glucosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.93 0.887 0.03 1.2 1.6 0.49
279 d1zina1 Adenylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.93 0.688 0.01 1.4 1.2 0.29
280 d1kbza_ dTDP-​6-​deoxy-​L-​lyxo-​4-​hexulose reductase (RmlD) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.92 0.622 0.01 1.3 1.7 0.36
281 d1vl0a_ DTDP-​4-​dehydrorhamnose reductase RfbD NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.91 1.120 0.01 1.0 1.8 0.35
282 d1g8ma2 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC Cytidine deaminase-​like α/β 0.91 0.857 0.11 1.3 1.0 0.28
283 d1g5ta_ ATP:corrinoid adenosyltransferase CobA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.89 1.033 0.04 0.8 1.6 0.27
284 d1duvg1 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.89 0.813 0.01 1.5 2.2 0.22
285 d1g5aa2 Amylosucrase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.89 0.884 0.02 1.2 1.7 0.47
286 d1gqna_ Type I 3-​dehydroquinate dehydratase Aldolase TIM beta/​alpha-​barrel α/β 0.89 0.889 0.05 2.5 2.8 0.41
287 d1mv8a3 GDP-​mannose 6-​dehydrogenase,​ GDP-​binding domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 0.89 0.812 0.02 0.8 1.2 0.26
288 d1ewqa2 DNA repair protein MutS,​ the C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.88 1.023 0.01 1.1 1.2 0.30
289 d1cnva_ Seed storage protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.87 0.670 0.01 1.0 1.3 0.45
290 d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 0.86 0.815 0.02 1.5 1.7 0.25
291 d1mv5a_ Multidrug resistance ABC transporter LmrA,​ C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.86 1.024 0.10 0.9 1.2 0.24
292 d1uz5a3 MoeA,​ central domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.85 0.818 0.04 1.5 1.7 0.25
293 d1r7ra3 Membrane fusion ATPase VCP/​p97 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.85 1.028 0.01 1.4 1.7 0.27
294 d1nrza_ Sorbose permease subunit IIb ,​ EIIb-​sor PTS IIb component PTS IIb component α/β 0.85 0.684 0.03 0.8 1.7 0.30
295 d1qpoa1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain TIM beta/​alpha-​barrel α/β 0.84 0.850 0.04 1.3 1.9 0.29
296 d1hdoa_ Biliverdin IX beta reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.84 0.733 0.01 0.8 1.8 0.32
297 d1doza_ Ferrochelatase Chelatase Chelatase-​like α/β 0.84 0.656 0.03 0.8 0.5 0.32
298 d1ihua1 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.84 1.023 0.01 1.3 0.9 0.36
299 d1t64a_ Histone deacetylase 8,​ HDAC8 Arginase/​deacetylase Arginase/​deacetylase α/β 0.83 1.019 0.01 0.7 1.2 0.39
300 d1iv8a2 Maltooligosyl trehalose synthase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.83 0.749 0.02 2.2 1.3 0.42
301 d1eucb1 Succinyl-​CoA synthetase,​ beta-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.80 0.818 0.01 1.8 1.4 0.25
302 d1q0ua_ Probable DEAD box RNA helicase YqfR P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.80 0.617 0.01 0.5 1.2 0.31
303 d1eo1a_ Hypothetical protein MTH1175 Nitrogenase accessory factor-​like Ribonuclease H-​like motif α/β 0.80 0.755 0.02 0.7 1.5 0.21
304 d1eoka_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.80 0.838 0.01 0.5 1.4 0.45
305 d1k92a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 0.80 0.814 0.01 1.0 1.5 0.29
306 d1knqa_ Gluconate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.78 1.026 0.01 1.0 1.2 0.28
307 d1tjya_ AI-​2 receptor LsrB Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.77 0.814 0.06 1.1 1.1 0.32
308 d1fnna2 CDC6,​ N-​domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.77 1.029 0.01 1.2 0.8 0.30
309 d1pvoa3 Transcription termination factor Rho,​ ATPase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.77 1.032 0.01 1.0 0.9 0.35
310 d1jwqa_ N-​acetylmuramoyl-​L-​alanine amidase CwlV Zn-​dependent exopeptidases Phosphorylase/​hydrolase-​like α/β 0.75 0.812 0.01 1.4 0.8 0.25
311 d1ly1a_ Polynucleotide kinase,​ kinase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.75 1.019 0.01 1.2 1.0 0.24
312 d1n25a_ Papillomavirus large T antigen helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.74 0.934 0.01 0.8 0.8 0.29
313 d1p9ra_ Extracellular secretion NTPase EpsE P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.72 1.022 0.03 0.7 0.9 0.33
314 d1oxxk2 Glucose transport protein GlcV,​ N-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.71 1.028 0.12 1.1 1.5 0.27
315 d1t1ra2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.71 0.639 0.01 0.8 2.5 0.26
316 d1nata_ Sporulation response regulator Spo0F CheY-​like Flavodoxin-​like α/β 0.69 0.746 0.01 1.3 2.2 0.24
317 d1puia_ Probable GTPase EngB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.67 0.896 0.01 1.6 1.6 0.30
318 d1b0ua_ ATP-​binding subunit of the histidine permease P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.65 1.026 0.11 0.2 1.7 0.32
319 d8abpa_ L-​arabinose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.65 0.817 0.03 1.4 1.1 0.29
320 d1gjwa2 Maltosyltransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.64 0.887 0.02 1.2 1.8 0.45
321 d1ny5a2 Transcriptional activator sigm54 (NtrC1),​ C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.64 1.029 0.02 0.4 1.3 0.26
322 d1jyea_ Lac-​repressor (lacR) core (C-​terminal domain) Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.63 0.819 0.01 1.8 1.6 0.28
323 d1gqia1 alpha-​D-​glucuronidase catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.62 0.665 0.01 1.5 1.4 0.44
324 d1gcaa_ Galactose/​glucose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.62 0.811 0.03 1.2 1.5 0.29
325 d1t57a_ Hypothetical protein MTH1675 PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 0.60 1.212 0.01 0.7 1.3 0.28
326 d1ru8a_ Putative N-​type ATP pyrophosphatase PF0828 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 0.60 0.813 0.01 1.2 1.2 0.27
327 d1nn5a_ Thymidylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.57 0.879 0.01 0.9 1.1 0.30
328 d1oi7a2 Succinyl-​CoA synthetase,​ alpha-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.57 1.541 0.01 0.8 0.9 0.28
329 d1qdea_ Initiation factor 4a P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.57 1.020 0.01 0.8 1.3 0.30
330 d1sxje2 Replication factor C5 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.56 1.030 0.01 1.1 1.4 0.30
331 d1um8a_ ClpX P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.56 1.021 0.01 1.4 0.9 0.26
332 d1a9xa3 Carbamoyl phosphate synthetase (CPS),​ large subunit PreATP-​grasp domains PreATP-​grasp domain PreATP-​grasp domain α/β 0.53 0.816 0.02 0.5 1.1 0.23
333 d1jfla2 Aspartate racemase Aspartate/​glutamate racemase ATC-​like α/β 0.53 0.802 0.06 1.0 1.3 0.20
334 d1rrma_ Lactaldehyde reductase FucO Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 0.52 0.817 0.03 0.9 0.9 0.32
335 d1t3ea3 Gephyrin,​ domain 5 Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.52 0.818 0.05 0.8 1.5 0.26
336 d1in4a2 Holliday junction helicase RuvB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.49 1.023 0.01 1.2 1.0 0.20
337 d1s8na_ Probable two-​component system transcriptional regulator Rv1626 CheY-​like Flavodoxin-​like α/β 0.48 1.044 0.01 1.1 0.8 0.24
338 d1drka_ D-​ribose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.46 0.817 0.02 1.3 0.8 0.27
339 d1j7xa_ Interphotoreceptor retinoid-​binding protein IRBP ClpP/​crotonase ClpP/​crotonase α/β 0.40 0.858 0.01 0.9 0.5 0.28
340 d1pfka_ ATP-​dependent phosphofructokinase Phosphofructokinase Phosphofructokinase α/β 0.36 0.815 0.07 0.6 1.0 0.27
341 d1gsoa2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.34 0.811 0.04 0.6 1.5 0.20
342 d1a1va1 HCV helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.32 0.791 0.01 0.0 1.4 0.25
343 d1e8ca1 UDP-​N-​acetylmuramyl tripeptide synthetase MurE MurE/​MurF N-​terminal domain MurF and HprK N-​domain-​like α/β 0.31 0.774 0.05 0.3 1.3 0.19
344 d1kq3a_ Glycerol dehydrogenase Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 0.29 0.623 0.02 0.2 1.1 0.28
345 d1gm5a4 RecG helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.27 0.885 0.03 0.1 0.7 0.28
346 d1b0aa2 Tetrahydrofolate dehydrogenase/​cyclohydrolase Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 0.22 0.621 0.03 0.6 1.1 0.18
347 d1dv1a2 Biotin carboxylase (BC),​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.21 0.608 0.06 0.3 1.5 0.21
348 d1vl6a2 Malate oxidoreductase (malic enzyme) Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 0.16 0.821 0.02 0.5 1.2 0.19
349 d1rq8a_ Hypothetical protein SAV1595 YhbY-​like IF3-​like α+β 0.10 1.036 0.03 0.1 1.5 0.16
350 d1iiba_ Enzyme IIB-​cellobiose PTS system,​ Lactose/​Cellobiose specific IIB subunit (Pfam 02302) Phosphotyrosine protein phosphatases I-​like α/β 0.06 0.814 0.02 0.4 1.1 0.20
SCOP domains with score worse than the threshold
351 d1knwa2 Diaminopimelate decarboxylase LysA PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.98 0.565 0.01 3.2 2.3 0.42
352 d1t8ha_ Hypothetical protein YlmD CNF1/​YfiH-​like putative cysteine hydrolases CNF1/​YfiH-​like putative cysteine hydrolases α+β 1.96 -0.307 0.02 2.4 1.7 0.38
353 d1xfja_ Hypothetical protein CC0490 CNF1/​YfiH-​like putative cysteine hydrolases CNF1/​YfiH-​like putative cysteine hydrolases α+β 1.91 -0.455 0.02 2.7 2.1 0.37
354 d1o12a2 N-​acetylglucosamine-​6-​phosphate deacetylase,​ NagA,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.90 0.579 0.01 2.7 2.0 0.43
355 d1r3sa_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.86 0.559 0.12 3.4 2.1 0.44
356 d1nfpa_ Non-​fluorescent flavoprotein (luxF,​ FP390) Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.81 -0.784 0.02 2.4 2.5 0.34
357 d1lqaa_ Tas protein NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.80 0.556 0.01 3.5 2.0 0.44
358 d1h65a_ Chloroplast protein translocon GTPase Toc34 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.80 0.414 0.01 2.1 1.8 0.39
359 d1ueha_ Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase α/β 1.78 -0.996 0.03 2.2 2.7 0.30
360 d1hk8a_ Class III anaerobic ribonucleotide reductase NRDD subunit PFL-​like glycyl radical enzymes PFL-​like glycyl radical enzymes α/β 1.77 -0.436 0.01 3.0 1.5 0.45


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1j31a_ Hypothetical protein PH0642 (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.81  Contact: 3462
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.24 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.09
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.65 gdtts:0.73 tmscore:0.87 rmsd:0.87 AHM:0.75 LBcontacta:0.62 LBcontactb:0.74 LHM:0.63
id:0.15 blosum:0.23 compass:0.59 pearson:0.59

hit structure      alignment
DALI alignment (Z-score: 28.1 Raw score:2714.30)
Query          1 slQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED--LALR     58
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESreEVFD     58

Query         59 ssFVEA--sRTALRELAARLAeegFGELPVLVGYLDRSEsaqpkygqpaGAPRNAAAVLH    116
d1j31a_       59 --VAQQipeGETTTFLMELAR---ELGLYIVAGTAEKSG----------NYLYNSAVVVG    103

Query        117 RGRVALTFAKHHLPnygvFDEFRYFVPGD-TMPIVRLHGVDIALAICEDLWQDgGRVPAA    175
d1j31a_      104 PRGYIGKYRKIHLF----YREKVFFEPGDlGFKVFDIGFAKVGVMICFDWFFP-ESARTL    158

Query        176 RSAGAGLLLSVNASPYErdkddTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVV    235
d1j31a_      159 ALKGAEIIAHPANLVMP-----YAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIA    213

Query        236 DRDGEVVARAPQFSEGCVVLDLDLPaaeaepptgvvddglridrlviseeplpayeaela    295
d1j31a_      214 SPKAEVLSIASETEEEIGVVEIDLN------------------larnkrlndmndifkdr    255

Query        296 ggyadrl    302
d1j31a_      256 reeyyfr    262


hit structure      alignment
FAST alignment (Normalized score: 20.28 Raw score:5705.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV--EDLALR     58
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEV--     56

Query         59 SSFV---------EASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA-GAP    108
d1j31a_       57 ----FDVAQQIPEGETTTFLMELARE------LGLYIVAGTAEKS-----------GNYL     95

Query        109 RNAAAVLHR--GRVALTFAKHHLPNYGV-FDEFRYFVPGD-TMPIVRLHGVDIALAICED    164
d1j31a_       96 YNSAVVV--GPRGYIGKYRKIHL-----FYREKVFFEPGDLGFKVFDIGFAKVGVMICFD    148

Query        165 LWQDGGRVPAARSAGAGLLLSVNASPYERDKD-DTRLELVRKRAQEAGCTTAYLAMIGGQ    223
d1j31a_      149 WFFP-ESARTLALKGAEIIAHPANLV------MPYAPRAMPIRALENRVYTITADRVGEE    201

Query        224 DELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVIS    283
d1j31a_      202 RGLKFIGKSLIASPKAEVLSIASETEEEIGVVEID-------------------------    236

Query        284 EEPLPAYEAELAGGYADRL--------------------------    302
d1j31a_      237 -------------------LNLARNKRLNDMNDIFKDRREEYYFR    262


hit structure      alignment
TMalign alignment (TM-score: 0.71 Raw score:215.21)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEVFD     58

Query         61 FVEAS-RTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGR    119
d1j31a_       59 VAQQIPEGETTTFLMELAR-EL-GLYIVAGTAEKSG----------NYLYNSAVVVGPRG    106

Query        120 VALTFAKHHLPNYGVFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQDGGRVPAARSA    178
d1j31a_      107 YIGKYRKIHLF----YREKVFFEPGDLGFKVFDIGFAKVGVMICFDWFFPE-SARTLALK    161

Query        179 GAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRD    238
d1j31a_      162 GAEIIAHPANLVMP-----YAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIASPK    216

Query        239 GEVVARAPQFSEGCVVLDLDLP-AAE--------------AEPPTGVVD-----DGLRID    278
d1j31a_      217 AEVLSIASETEEEIGVVEIDLNLARNKRLNDMNDIFKDRR--------EEYYFR------    262

Query        279 RLVISEEPLPAYEAELAGGYADRL    302
d1j31a_      263 ------------------------    263


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ***************************************************....  ***
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVE     63
d1j31a_        2 VKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEVFDVAQ     61

DALI match       *      ...........      *************          *************
Query         64 A-----SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG    118
d1j31a_       62 QIPEGETTTFLMELAREL------GLYIVAGTAEKSG----------NYLYNSAVVVGPR    105

DALI match       ************    ***********. **********************. *******
Query        119 RVALTFAKHHLPNYGVFDEFRYFVPGDT-MPIVRLHGVDIALAICEDLWQDGGRVPAARS    177
d1j31a_      106 GYIGKYRKIHLF----YREKVFFEPGDLGFKVFDIGFAKVGVMICFDWFFPE-SARTLAL    160

DALI match       *************       ****************************************
Query        178 AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDR    237
d1j31a_      161 KGAEIIAHPANLV-----MPYAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIASP    215

DALI match       ***********************                    
Query        238 DGEVVARAPQFSEGCVVLDLDLPAAEAEPP--TGVVDDGLRID    278
d1j31a_      216 KAEVLSIASETEEEIGVVEIDLNLARNKRLNDMNDIFKDRREE    258



top
2: d1f89a_ hypothetical protein yl85 (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.83  Contact: 3294
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.25 AHM:0.28 LBcontacta:1.00 LBcontactb:1.00 LHM:0.07
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.64 gdtts:0.72 tmscore:0.87 rmsd:0.87 AHM:0.79 LBcontacta:0.60 LBcontactb:0.71 LHM:0.68
id:0.15 blosum:0.23 compass:0.56 pearson:0.51

hit structure      alignment
DALI alignment (Z-score: 26.3 Raw score:2649.90)
Query          1 ------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQG--AHLVAFPEMALTGYpV     52
d1f89a_        1 saskilSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQpdTKLVVLPECFNSPY-S     59

Query         53 EDLALRssFVEASR----TALRELAARLAeeGFGELPVLV-GYLDRSESaqpkygqpAGA    107
d1f89a_       60 TDQFRK--YSEVINpkepSTSVQFLSNLA--NKFKIILVGgTIPELDPK--------TDK    107

Query        108 PRNAAAVLH-RGRVALTFAKHHLpnygvfDEFRYFVPGDTMPIVRLHGVDIALAICEDLW    166
d1f89a_      108 IYNTSIIFNeDGKLIDKHRKVHL-----fHESETLSPGEKSTTIDTKYGKFGVGICYDMR    162

Query        167 QDgGRVPAARSAGAGLLLSVNASPYErdkDDTRLELVRKRAQEAGCTTAYLAMIGGQ-DE    225
d1f89a_      163 FP-ELAMLSARKGAFAMIYPSAFNTV-tgPLHWHLLARSRAVDNQVYVMLCSPARNLqSS    220

Query        226 LVFDGDSIVVDRDGEVVARAPqFSEGCVVLDLDLPaaeaepptgvvddglridrlvisee    285
d1f89a_      221 YHAYGHSIVVDPRGKIVAEAG-EGEEIIYAELDPE-------------------------    254

Query        286 plpayeaelaggyadrl    302
d1f89a_      255 viesfrqavpltkqrrf    271


hit structure      alignment
FAST alignment (Normalized score: 18.48 Raw score:5287.00)
Query          1 ------SLQLRLALNQIDST--VGDIAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGY     50
d1f89a_        1 SASKILSQKIKVALVQLS--GSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPY     58

Query         51 PVEDLALRSSFV------------EASRTALRELAARLAEEGFGELPVL-VGYLDRSESA     97
d1f89a_       59 -STDQF------RKYSEVINPKEPSTSVQFLSNLANK------FKIILVGGTIPELDP--    103

Query         98 QPKYGQP-AGAPRNAAAV-LHRGRVALTFAKHHLPNYGVF--DEFRYFVPGDTMPIVRLH    153
d1f89a_      104 -------KTDKIYNTSIIFNEDGKLIDKHRKVH-------LFHESETLSPGEKSTTIDTK    149

Query        154 GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----DTRLELVRKRAQ    208
d1f89a_      150 YGKFGVGICYDMRFP-ELAMLSARKGAFAMIYPSAFN------TVTGPLHWHLLARSRAV    202

Query        209 EAGCTTAYLAMIGGQ-----DELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE    263
d1f89a_      203 DNQVYVMLCSP----ARNLQSSYHAYGHSIVVDPRGKIVAEA-GEGEEIIYAELD-----    252

Query        264 AEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-------------------    302
d1f89a_      253 ---------------------------------------PEVIESFRQAVPLTKQRRF    271


hit structure      alignment
TMalign alignment (TM-score: 0.72 Raw score:216.57)
Query          1 S------LQLRLALNQIDSTVGDIAGNAEAILRWTRHSAE-Q-GAHLVAFPEMALTGYPV     52
d1f89a_        1 SASKILSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYS-     59

Query         53 EDLALRSSFVEASR----TALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPAGA    107
d1f89a_       60 TDQFRK--YSEVINPKEPSTSVQFLSNLAN-KF-KIILVGGTIPELDPK--------TDK    107

Query        108 PRNAAAVLH-RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLW    166
d1f89a_      108 IYNTSIIFNEDGKLIDKHRKVHL-----FHESETLSPGEKSTTIDTKYGKFGVGICYDMR    162

Query        167 QDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDE    225
d1f89a_      163 FPE-LAMLSARKGAFAMIYPSAFNTVTG-PLHWHLLARSRAVDNQVYVMLCSPARNLQSS    220

Query        226 LVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDL--PA--------------AEAEPPTG    269
d1f89a_      221 YHAYGHSIVVDPRGKIVAEAG-EGEEIIYAELDPEVIESFRQAVPLTKQRRF--------    271

Query        270 VVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1f89a_      272 ---------------------------------    272


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ***********************************  .**************........
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ--GAHLVAFPEMALTGYPVEDLALR     58
d1f89a_        7 SQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYSTDQFRKY     66

DALI match         ...        ..........      ******.......         *********
Query         59 SSFVE-----ASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAA    113
d1f89a_       67 SEVINPKEPSTSVQFLSNLANKF------KIILVGGTIPELD-------PKTDKIYNTSI    113

DALI match       *** *************      *********************************. **
Query        114 VLH-RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRV    172
d1f89a_      114 IFNEDGKLIDKHRKVHL-----FHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPE-LA    167

DALI match       ********************  .. ************************* .********
Query        173 PAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDELVFDGD    231
d1f89a_      168 MLSARKGAFAMIYPSAFNTVTGPL-HWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGH    226

DALI match       ***************. ************                
Query        232 SIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLR    276
d1f89a_      227 SIVVDPRGKIVAEAGE-GEEIIYAELDPEVIESFRQAVPLTKQRR    270



top
3: d1uf5a_ N-​carbamoyl-​D-​aminoacid amidohydrolase (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.68  Contact: 3444
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.33 LBcontacta:1.00 LBcontactb:1.00 LHM:0.08
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.59 gdtts:0.63 tmscore:0.82 rmsd:0.85 AHM:0.73 LBcontacta:0.57 LBcontactb:0.71 LHM:0.63
id:0.15 blosum:0.24 compass:0.59 pearson:0.48

hit structure      alignment
DALI alignment (Z-score: 24.9 Raw score:2592.30)
Query          1 SLQLRLALNQIDSTV--GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALtGYPVE-----     53
d1uf5a_        1 TRQMILAVGQQGPIAraETREQVVVRLLDMLTKAASRGANFIVFPELAL-TTFFPrwhft     59

Query         54 --dLALRssFVEASRT-ALRELAARLAeegFGELPVLVGYLDRSESAqpkygqPAGAPRN    110
d1uf5a_       60 deaELDS-fYETEMPGpVVRPLFEKAA---ELGIGFNLGYAELVVEG------GVKRRFN    109

Query        111 AAAVLH-RGRVALTFAKHHLPNY--------gVFDEFRYFVPGD-TMPIVRLHGVDIALA    160
d1uf5a_      110 TSILVDkSGKIVGKYRKIHLPGHkeyeayrpfQHLEKRYFEPGDlGFPVYDVDAAKMGMF    169

Query        161 ICEDLWQDgGRVPAARSAGAGLLLSVNASPYE------RDKD--DTRLELVRKRAQEAGC    212
d1uf5a_      170 IANDRRWP-EAWRVMGLRGAEIICGGYNTPTHnppvpqHDHLtsFHHLLSMQAGSYQNGA    228

Query        213 TTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPaaeaepptgvvd    272
d1uf5a_      229 WSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLD------------    276

Query        273 dglridrlviseeplpayeaelaggyadrl    302
d1uf5a_      277 ---rcrelrehifnfkqhrqpqhygliael    303


hit structure      alignment
FAST alignment (Normalized score: 18.04 Raw score:5458.00)
Query          1 SLQLRLALNQ-IDSTVG-DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL-     57
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTT--------F     52

Query         58 -----------RSSFVEAS------RTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d1uf5a_       53 FPRWHFTDEAELDSF----YETEMPGPVVRPLFEKAAE---LGIGFNLGYAELV------     99

Query        101 YGQP----AGAPRNAAAV-LHRGRVALTFAKHHLPNYG------------VFDEFRYFVP    143
d1uf5a_      100 ----VEGGVKRRFNTSILVDKSGKIVGKYRKIHL----PGHKEYEAYRPFQHLEKRYFEP    151

Query        144 GD-TMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD------    196
d1uf5a_      152 GDLGFPVYDVDAAKMGMFIANDRRWP-EAWRVMGLRGAEIICGGYNTP------THNPPV    204

Query        197 --------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQF    248
d1uf5a_      205 PQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTL    264

Query        249 SEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL------    302
d1uf5a_      265 EDEVITAAVD--------------------------------------------LDRCRE    280

Query        303 -----------------------    303
d1uf5a_      281 LREHIFNFKQHRQPQHYGLIAEL    303


hit structure      alignment
TMalign alignment (TM-score: 0.73 Raw score:221.60)
Query          1 SLQLRLALNQID-STVGD-IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV-E-DLA     56
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTD     60

Query         57 LR-SSFVEASRTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQPAGAPRNAAAV    114
d1uf5a_       61 EAELDSFY-ETEMPGPVVRPLFEKAAELGIGFNLGYAELVVEG------GVKRRFNTSIL    113

Query        115 LH-RGRVALTFAKHHLPNYG--------VFDEFRYFVPGDT-MPIVRLHGVDIALAICED    164
d1uf5a_      114 VDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFIAND    173

Query        165 LWQDGGRVPAARSAGAGLLLSVNASPYE-------RDKD-DTRLELVRKRAQEAGCTTAY    216
d1uf5a_      174 RRWPE-AWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWSAA    232

Query        217 LAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE-------------    263
d1uf5a_      233 AGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQHR    292

Query        264 -------AEPPTGVVDDG-LRIDRLVISEEPLPAYEAELAGGYADRL    302
d1uf5a_      293 QPQHYGL--------IAEL----------------------------    303


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **************  .********************************......     
Query          1 SLQLRLALNQIDST--VGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTD     60

DALI match                      ............      **************       ******
Query         59 SSFVEA---------SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPR    109
d1uf5a_       61 EAELDSFYETEMPGPVVRPLFEKAAEL------GIGFNLGYAELVVE------GGVKRRF    108

DALI match       ******* ****************            *********. *************
Query        110 NAAAVLH-RGRVALTFAKHHLPNYGVFD--------EFRYFVPGDT-MPIVRLHGVDIAL    159
d1uf5a_      109 NTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGM    168

DALI match       *********. **********************              *************
Query        160 AICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDT--------RLELVRKRAQEAG    211
d1uf5a_      169 FIANDRRWPE-AWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNG    227

DALI match       *************************************************           
Query        212 CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPT-GV    270
d1uf5a_      228 AWSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFN    287

DALI match               
Query        271 VDDGLRID    278
d1uf5a_      288 FKQHRQPQ    295



top
4: d1emsa2 NIT-​FHIT fusion protein,​ N-​terminal domain (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.79  Contact: 3351
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.08
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.61 gdtts:0.66 tmscore:0.85 rmsd:0.86 AHM:0.77 LBcontacta:0.58 LBcontactb:0.71 LHM:0.69
id:0.17 blosum:0.23 compass:0.57 pearson:0.52

hit structure      alignment
DALI alignment (Z-score: 25.8 Raw score:2597.80)
Query          1 --SLQLRLALNQIDSTvGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGyPVED-LAL     57
d1emsa2        1 maTGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFI-GLNKnEQI     58

Query         58 RssFVEASR-TALRELAARLAeegFGELPVLV-GYLDRSEsaqpkygqPAGA-PRNAAAV    114
d1emsa2       59 D--LAMATDcEYMEKYRELAR---KHNIWLSLgGLHHKDP--------SDAAhPWNTHLI    105

Query        115 LH-RGRVALTFAKHHLPNY-----gvFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQ    167
d1emsa2      106 IDsDGVTRAEYNKLHLFDLeipgkvrLMESEFSKAGtEMIPPVDTPIGRLGLSICYDVRF    165

Query        168 DGgRVPAARSAGAGLLLSVNASPYErdkdDTRLELVRKRAQEAGCTTAYLAMIGG-QDEL    226
d1emsa2      166 PE-LSLWNRKRGAQLLSFPSAFTLN-tglAHWETLLRARAIENQCYVVAAAQTGAhNPKR    223

Query        227 VFDGDSIVVDRDGEVVARAPQfSEGCVVLDLDLPaaeaepptgvvddglridrlviseep    286
d1emsa2      224 QSYGHSMVVDPWGAVVAQCSE-RVDMCFAEIDLS--------------------------    256

Query        287 lpayeaelaggyadrl    302
d1emsa2      257 -yvdtlremqpvfshr    271


hit structure      alignment
FAST alignment (Normalized score: 18.48 Raw score:5286.00)
Query          1 --SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL-     57
d1emsa2        1 MATGRHFIAVCQMTS-DNDLEKNFQAAKNMIERAGEKKCEMVFLPECFD----------F     49

Query         58 -------RSSFVEASR-TALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPA---    105
d1emsa2       50 IGLNKNEQIDLAMATDCEYMEKYRELARK---HNIWLSLGGLHHKDP----------SDA     96

Query        106 GAPRNAAAVL-HRGRVALTFAKHHLPNYGV---------FDEFRYFVPGDTM-PIVRLHG    154
d1emsa2       97 AHPWNTHLIIDSDGVTRAEYNKLHLF----DLEIPGKVRLMESEFSKAGTEMIPPVDT--    150

Query        155 --VDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----DTRLELVRKRA    207
d1emsa2      151 PIGRLGLSICYDVRFP-ELSLWNRKRGAQLLSFPSAFT------LNTGLAHWETLLRARA    203

Query        208 QEAGCTTAYLAMIGG-QDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEP    266
d1emsa2      204 IENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGAVVAQCS-ERVDMCFAEID--------    254

Query        267 PTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-----------------    302
d1emsa2      255 ------------------------------------LSYVDTLREMQPVFSHR    271


hit structure      alignment
TMalign alignment (TM-score: 0.72 Raw score:216.66)
Query          1 --SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1emsa2        1 MATGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFI-GLNKNEQI     58

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPAG-APRNAAAVLH    116
d1emsa2       59 -DLAMATDCEYMEKYRELAR-KH-NIWLSLGGLHHKDPS--------DAAHPWNTHLIID    107

Query        117 -RGRVALTFAKHHLPNY-----GVFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQDG    169
d1emsa2      108 SDGVTRAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPE    167

Query        170 GRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQ-DELVF    228
d1emsa2      168 L-SLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGAHNPKRQS    225

Query        229 DGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE------------AEPPTGVVDDGLR    276
d1emsa2      226 YGHSMVVDPWGAVVAQCS-ERVDMCFAEIDLSYVDTLREMQPVFSHR-------------    271

Query        277 IDRLVISEEPLPAYEAELAGGYADRL    302
d1emsa2      272 --------------------------    272


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ************** **********************************.....****. 
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1emsa2        3 TGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLA     61

DALI match       ......  ..........      ******.......       .....********* *
Query         61 FVEASR--TALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH-R    117
d1emsa2       62 MATDCEYMEKYRELARKH------NIWLSLGGLHHKDP------SDAAHPWNTHLIIDSD    109

DALI match       ************          **********... ********************** *
Query        118 GRVALTFAKHHL-----PNYGVFDEFRYFVPGDTM-PIVRLHGVDIALAICEDLWQDGGR    171
d1emsa2      110 GVTRAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPE-L    168

DALI match       *********************    ************************** ********
Query        172 VPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDELVFDG    230
d1emsa2      169 SLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYG    227

DALI match       ***************** ************               
Query        231 DSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGL    275
d1emsa2      228 HSMVVDPWGAVVAQCSE-RVDMCFAEIDLSYVDTLREMQPVFSHR    271



top
5: d1ii7a_ Mre11 (svm: 1.977)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.42  Contact: 1497
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.43 AHM:0.41 LBcontacta:0.99 LBcontactb:0.99 LHM:0.17
id:0.97 blosum:0.03 compass:0.22 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.35 gdtts:0.42 tmscore:0.59 rmsd:0.74 AHM:0.66 LBcontacta:0.38 LBcontactb:0.55 LHM:0.38
id:0.03 blosum:0.06 compass:0.15 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 7.3 Raw score:827.30)
Query          1 slqLRLALNQIDSTVGD-------IAGNAEAILRWTRHSAEQGAHLVAFPEMAlTGYPVe     53
d1ii7a_        1 ---MKFAHLADIHLGYEqfhkpqrEEEFAEAFKNALEIAVQENVDFILIAGDL-FHSSR-     55

Query         54 dlalrssFVEASRTALRELAARLAeegFGELPVLvgyldrsesaqpkygqpagAPRNAAa    113
d1ii7a_       56 -------PSPGTLKKAIALLQIPK---EHSIPVF---------aiegnhdrtqRGPSVLn     96

Query        114 vlhrgRVALTfakhhlpnygvfdefryfvPGDT-----------------MPIVRLHGVD    156
d1ii7a_       97 lledfGLVYV-----------------igMRKEkveneyltserlgngeyLVKGVYKDLE    139

Query        157 IALAICE----dlwQDGGRVPAARsagaGLLLSV---naspyERDKDDTRleLVRKRAqE    209
d1ii7a_      140 IHGMKYMssawfeaNKEILKRLFRptdnAILMLHqgvrevseARGEDYFE--IGLGDL-P    196

Query        210 AGC-TTAYLAmiggqdelvFDGDsivvdrDGEVVARA-----------------------    245
d1ii7a_      197 EGYlYYALGH--------iHKRY---etsYSGSPVVYpgslerwdfgdyevryewdgikf    245

Query        246 ---pqFSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpayeaeLAGG-----    297
d1ii7a_      246 kerygVNKGFYIVEDF-----------------------------------KPRFveikv    270

Query        298 ----------------------------------------------------------ya    299
d1ii7a_      271 rpfidvkikgseeeirkaikrliplipknayvrlnigwrkpfdlteikellnveylkidt    330

Query        300 drl    302
d1ii7a_      331 wri    333


hit structure      alignment
FAST alignment (Normalized score: 3.97 Raw score:1260.00)
Query          1 SLQLRLALNQIDSTVG--------------DIAGNAEAILRWTRHSAEQGAHLVAFPEMA     46
d1ii7a_        1 ---MKFAHL-------ADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDL     50

Query         47 LTGYPVEDLALRSSF------VEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d1ii7a_       51 ---------------FHSSRPSPGTLKKAIALLQIPKE---HSIPVFA------------     80

Query        101 YGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG----------------    144
d1ii7a_       81 --------------------------------------------IEGNHDRTQRGPSVLN     96

Query        145 -------------------------------DTMPIVRLHGVDIALAICEDLW-------    166
d1ii7a_       97 LLEDFGLVYVIGMRKEKVENEYLTSERLGNGEYLVKGVYKDLEIHGMK-----YMSSAWF    151

Query        167 --QDGGRVPAARSAGA------GLLLSVNASPYERDKDDT--------------RLELVR    204
d1ii7a_      152 EANKEILKRL------FRPTDNAILMLHQGV---------REVSEARGEDYFEIGLGD--    194

Query        205 KRAQEA----GCTTAYLAMIGGQDELVFD---GDSIVVDRDGEVVARAPQ----------    247
d1ii7a_      195 ------LPEGYLYYAL-------------GHIHKRYET------------SYSGSPVVYP    223

Query        248 ---------------------------FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRL    280
d1ii7a_      224 GSLERWDFGDYEVRYEWDGIKFKERYGVNKGFYIV-------------------------    258

Query        281 VISEEPLPAYEAELAGGYADRL--------------------------------------    302
d1ii7a_      259 ----------------------EDFKPRFVEIKVRPFIDVKIKGSEEEIRKAIKRLIPLI    296

Query        303 -------------------------------------    303
d1ii7a_      297 PKNAYVRLNIGWRKPFDLTEIKELLNVEYLKIDTWRI    333


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:148.88)
Query          1 SLQLRLALNQIDSTVGD-------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1ii7a_        1 ---MKFAHLADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDL-FH--S-     53

Query         54 DLALRSSFVEASRTALRELAARLAEEGFGELPVLVGY---LDRSESAQPKYGQPAGAPRN    110
d1ii7a_       54 --S---RPSPGTLKKAIALLQIPK--EH-SIPVFAIEGNHDRT------------QRGPS     93

Query        111 AAAVLHRGRVALTFAKH---------------HLPNYGVFDEFRYFVPGDTMPIVRLHGV    155
d1ii7a_       94 VLNLLEDFGLVYVIGMRKEKVENEYLTSERLG---------------NGEYLVKGVYKDL    138

Query        156 DIALAICEDL--W--QDGGRVPAARSAGAGLLLSVNASP--YERDKDDT-R-LELVRKRA    207
d1ii7a_      139 EIHGMKYMSSAWFEANKEILKRLFRP-TDNAILMLHQGVREVSEARGEDYFE-IGLGDLP    196

Query        208 QEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ--------F-----------    248
d1ii7a_      197 E--GYLYYALGHI-------HKRYETSY---SGSPVVYPGSLERWDFGDYEVRYEWDGIK    244

Query        249 ------S-EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA--    299
d1ii7a_      245 FKERYGVNKGFYIVEDF------------------------------------KPRFVEI    268

Query        300 ------------------------------------------------------------    300
d1ii7a_      269 KVRPFIDVKIKGSEEEIRKAIKRLIPLIPKNAYVRLNIGWRKPFDLTEIKELLNVEYLKI    328

Query        300 -----DRL    302
d1ii7a_      329 DTWRI---    333


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.03)
DALI match       **************************                *****************.
Query         19 AGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAE     78
d1ii7a_       23 EEFAEAFKNALEIAVQENVDFILIAG---------DLFHSSRPSPGTLKKAIALLQIPKE     73

DALI match         . .....  
Query         79 EGFGELPVLVG     89
d1ii7a_       74 HSI-PVFAIEG     83



hit structures. 
top
6: d1uf3a_ Hypothetical protein TT1561 (hh: 0.935)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.51  Contact: 1505
Modified z-scores:
dali:1.00 daliz:0.98 gdtts:0.99 tmscore:0.99 rmsd:0.37 AHM:0.37 LBcontacta:0.98 LBcontactb:0.97 LHM:0.18
id:0.97 blosum:0.17 compass:0.63 pearson:0.99
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.49 tmscore:0.64 rmsd:0.76 AHM:0.68 LBcontacta:0.36 LBcontactb:0.50 LHM:0.42
id:0.02 blosum:0.08 compass:0.06 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 6.8 Raw score:779.20)
Query          1 --sLQLRLALNQIDSTvgdiagNAEAILRWTRHSAEQGAHLVAFPEMAltGYPVedlalr     58
d1uf3a_        1 mrrTVRYILATSNPMG------DLEALEKFVKLAPDTGADAIALIGNL--MPKA------     46

Query         59 ssFVEASRTALRELAARLaeegfgELPVLV---gyLDRSesaqpkygqpagaPRNA--aa    113
d1uf3a_       47 --AKSRDYAAFFRILSEA------HLPTAYvpgpqDAPI-------------WEYLreaa     85

Query        114 vlHRGRV-ALTFakhhlpnygvfdefryfvpgdtMPIVRLH-GVDIALAICED-------    164
d1uf3a_       86 nvELVHPeMRNV---------------------hETFTFWRgPYLVAGVGGEIadegepe    124

Query        165 -----lWQDGGRVPAARSAG----aGLLLSVN-aspyerdkDDTRlELVRKRAQEAGCTT    214
d1uf3a_      125 ehealrYPAWVAEYRLKALWelkdyPKIFLFHtmpyhkglnEQGS-HEVAHLIKTHNPLL    183

Query        215 AYLAMiggqdelvFDGDsivvdrDGEVVARA--pqfSEGCVVLDLdlpaaeaepptgvvd    272
d1uf3a_      184 VLVAG--------KGQK---hemLGASWVVVpgdlsEGEYSLLDL---------------    217

Query        273 dglridrlviseeplpayeAELAGGyadrl    302
d1uf3a_      218 -------------------RARKLEtgnvr    228


hit structure      alignment
FAST alignment (Normalized score: 4.44 Raw score:1165.00)
Query          1 SLQ-----LRLALNQIDS--TVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1uf3a_        1 ---MRRTVRYILAT----SNPMGD-LEALEKFVKLA---PDTGADAIALIG---------     40

Query         54 DLA------LRSSFVEASRTALRELAARLAEEGF-GELPVLVGYLDRSESAQPKYGQPAG    106
d1uf3a_       41 ---NLMPKAAKSRDYAAFFRILS-----------EAHLPTAY------------------     68

Query        107 APRNAAAVLHRGRV-------------------------ALTFAKHHLPNYGVFDEFRYF    141
d1uf3a_       69 --------------VPGPQDAPIWEYLREAANVELVHPEMRNV-----------------     97

Query        142 VPGDT-MPIVRL-HGVDIALAICEDLWQDG----------------------GRVPAARS    177
d1uf3a_       98 -----HETFTFWRGPYLVAGVGG-------EIADEGEPEEHEALRYPAWVAEYRLKALWE    145

Query        178 -AGAGLLLSVNASPYERDKDDTR-------------LELVRKRAQEAGCTTAYLAMIGGQ    223
d1uf3a_      146 LKDY-PKIFLF------------HTMPYHKGLNEQGSHEVAHLIKTHNP-LLVLVA----    187

Query        224 DELVFD-GDSIVVDRDGEV------VARAPQF----SEGCVVLDLDLPAAEAEPPTGVVD    272
d1uf3a_      188 ------GKGQKHE------MLGASWVVVP---GDLSEGEYSLLD----------------    216

Query        273 DGLRIDRLVISEEPLPAYEAELAGGYADRL------------    302
d1uf3a_      217 ------------------------------LRARKLETGNVR    228


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:146.84)
Query          1 ---SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1uf3a_        1 MRR-TVRYILATSNPMG------DLEALEKFVKLAPDTGADAIALIGNL-MP--K--AA-     47

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVGY---LDRSESAQPKYGQPAGAPRNA-AA    113
d1uf3a_       48 ---KS-RDYAAFFRILS-E----AH-LPTAYVPGPQDAP-------------IWEYLREA     84

Query        114 V-LHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICED--------    164
d1uf3a_       85 ANVELVHPEMRNVH-------------------ETFTFWRGPYLVAGVGGEIADEGEPEE    125

Query        165 -----LWQD--GGRVPAARSAG-AGLLLSVNAS-----PYERDKDDTRLELVRKRAQEAG    211
d1uf3a_      126 HEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKG-----LNEQGSHEVAHLIKTHN    180

Query        212 CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ-FSEGCVVLDLDLPAAEAEPPTGV    270
d1uf3a_      181 PLLVLVA----------GKGQKHEMLGASWVVVPGDLSEGEYSLLDLR------------    218

Query        271 VDDGLRIDRLVISEEPLPAYEAELAGGY----ADRL    302
d1uf3a_      219 ---------------------A-RKLETGNVR----    228


hit structure      alignment
HHsearch alignment (Probability: 0.29 E-value:0.00)
DALI match             **********************
Query         15 VGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1uf3a_       11 TSNPMGDLEALEKFVKLAPDTGADAIAL     38



top
7: d1hp1a2 5'​-​nucleotidase (syn. UDP-​sugar hydrolase),​ N-​terminal domain (svm: 1.978)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.38  Contact: 1528
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.41 AHM:0.44 LBcontacta:0.99 LBcontactb:0.98 LHM:0.18
id:0.72 blosum:0.02 compass:0.07 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.35 gdtts:0.47 tmscore:0.63 rmsd:0.77 AHM:0.67 LBcontacta:0.37 LBcontactb:0.54 LHM:0.42
id:-0.02 blosum:0.04 compass:0.17 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:827.10)
Query          1 ----SLQLRLALNQidSTVGDIA------GNAEAILRWTRHSAEQG----aHLVAFPEMa     46
d1hp1a2        1 yeqdKTYKITVLHT-nDHHGHFWrneygeYGLAAQKTLVDGIRKEVaaeggSVLLLSGG-     58

Query         47 ltGYPVedlalRSSFVEASRTALRELAarlaeegfgelpVLVGyldrsesaqpkygqPAG    106
d1hp1a2       59 --DINTgvpesDLQDAEPDFRGMNLVG------------YDAM-----aignhefdnPLT     99

Query        107 APRnaaavlhrgrVALTFAKHHLPNYgvfdefryfvPGDTMPIVRLHGVDIALAICE---    163
d1hp1a2      100 VLR-----qqekwAKFPLLSANIYQK-----stgerLFKPWALFKRQDLKIAVIGLTtdd    149

Query        164 ----------------dLWQD-GGRVPAAR-SAGAGLLLSVNASPYE---RDKD-----d    197
d1hp1a2      150 takignpeyftdiefrkPADEaKLVIQELQqTEKPDIIIAATHMGHYdngEHGSnapgdv    209

Query        198 tRLELVRKRAqeagcTTAYLAMiggqdelVFDGD------------------sivvdrdg    239
d1hp1a2      210 eMARALPAGS-----LAMIVGG------hSQDPVcmaaenkkqvdyvpgtpckpdqqngi    258

Query        240 evvarapqfsEGCVVLDLDLPAaeaepptgvvddglridrlviseeplpayeaeLAGG--    297
d1hp1a2      259 wivqahewgkYVGRADFEFRNG----------------------------emkmVNYQli    290

Query        298 ---------------------------------yadrl    302
d1hp1a2      291 pvnlkkkrvlytpeiaenqqmisllspfqnkgkaqlev    328


hit structure      alignment
FAST alignment (Normalized score: 3.65 Raw score:1149.00)
Query          1 ---SLQLRLALNQIDSTVG----------------DIAGNAEAILRWTRHSAEQGAHLVA     41
d1hp1a2        1 YEQDKTYKITVLH------TNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEG-GSVL     53

Query         42 FPEMALTGYPVEDLAL-----------------RSSFVEASRTALRELAARLAEEGFGEL     84
d1hp1a2       54 L---------------LSGGDINTGVPESDLQDAEPDFRGMNL-----------------     81

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTF--------------------    124
d1hp1a2       82 ----------------------------------------VGYDAMAIGNHEFDNPLTVL    101

Query        125 -----------AKHHLPNYGVFDEFRYFVPGD----------TMPIVRLHGVDIALAICE    163
d1hp1a2      102 RQQEKWAKFPLLSANIY---------------QKSTGERLFKPWALFKRQDLKIAVIG--    144

Query        164 DLWQDG----------------------------GRVPAAR-SAGAGLLLSVNASPYERD    194
d1hp1a2      145 ------LTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHY--    196

Query        195 KDD----------TRLELVRKRAQEAGCT------TAYLAMIGGQDELVFDGDSIVVDRD    238
d1hp1a2      197 ---DNGEHGSNAPGDVEMARA--------LPAGSLAMIVG--------------------    225

Query        239 GEVVARAPQF-------------------------------------------SEGCVVL    255
d1hp1a2      226 ----------GHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADF    275

Query        256 DLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-------------    302
d1hp1a2      276 EF---------------------------------------------RNGEMKMVNYQLI    290

Query        303 --------------------------------------    303
d1hp1a2      291 PVNLKKKRVLYTPEIAENQQMISLLSPFQNKGKAQLEV    328


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:154.75)
Query          1 --S-LQLRLALNQIDSTVGDIAG------NAEAILRWT-RHSAEQ--G-AHLVAFPEMAL     47
d1hp1a2        1 YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGD-     59

Query         48 TGYPVEDL-ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLD-----RSESAQPKY    101
d1hp1a2       60 IN--TGVPE-SDLQDAEPDFRGMNLVG------------YDAMAIGNHEFD---------     95

Query        102 GQPAGAPRNAAA-VLHRGRVALTFAKHHLP------NYGVFDEFRYFVPGDTMPIVRLHG    154
d1hp1a2       96 -NPLTVLRQQEKW-----AK-FPLLSANIYQKSTGE-----------RLFKPWALFKRQD    137

Query        155 VDIALAICE-------------------DLWQD-GGRVPAARS-AGAGLLLSVNASPYER    193
d1hp1a2      138 LKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD    197

Query        194 DKDD-----TRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGD-----------------    231
d1hp1a2      198 NGEHGSNAPGDVEMARALPA--GSLAMIVGG---H--SQDPVCMAAENKKQVDYVPGTPC    250

Query        232 -SIVVDRDGEVVARAPQF---SE-GCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEP    286
d1hp1a2      251 KPDQQ---NGI-WIVQAHEWGKYVGRADFEFRNGE-------------------------    281

Query        287 LPAYEAELAGGYA---------------------------------------DRL    302
d1hp1a2      282 -----MKMVNYQLIPVNLKKKRVLYTPEIAENQQMISLLSPFQNKGKAQLEV---    328


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.04)
DALI match                             
Query         22 AEAILRWTRHSAE-QGAHLVAF     42
d1hp1a2      168 ADEAKLVIQELQQTEKPDIIIA    189



top
8: d1ntfa_ Salivary nitrophorin (svm: 1.258)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.33  Contact: 1234
Modified z-scores:
dali:1.00 daliz:0.98 gdtts:0.99 tmscore:1.00 rmsd:0.44 AHM:0.44 LBcontacta:0.98 LBcontactb:0.98 LHM:0.17
id:0.85 blosum:0.05 compass:0.14 pearson:0.98
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.48 tmscore:0.61 rmsd:0.76 AHM:0.69 LBcontacta:0.36 LBcontactb:0.56 LHM:0.48
id:0.00 blosum:0.05 compass:0.18 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:626.40)
Query          1 -SLQLRLALNQIDStVGDIagNAEAILRWTRHsaEQGAHLVAFPEMaltGYPVedlalRS     59
d1ntfa_        1 pPAQLSVHTVSWNS-GHER--APTNLEELLGLnsGETPDVIAVAVQ---GFGF----qTD     50

Query         60 SFveASRTALRELAARLAEeGFGELPvlvgyldrsesaqpkygqpagaprnAAAV-----    114
d1ntfa_       51 KP--QQGPACVKNFQSLLT-SKGYTK----------------lkntitetmGLTVyclek     91

Query        115 -lhrgrvaltFAKHHLPNYGvfdefryfvpgdtmPIVRlHGVDialaicedlwqdggrvp    173
d1ntfa_       92 hldqntlkneTIIVTVDDQK--------ksggivTSFT-IYNK-----------------    125

Query        174 aarsagaGLLLSVNA---spyerDKDDTRlelvrKRAQE--AGCTTAYLAM---------    219
d1ntfa_      126 -------RFSFTTSRmsdedvtsTNTKYAydtrlDYSKKddPSDFLFWIGDlnvrvetna    178

Query        220 -----------------------------------------iGGQD-----------ELV    227
d1ntfa_      179 thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkpTYKFkpntdeydlsaTPS    238

Query        228 FDGDSIVVDRD----------gevvarapqfSEGCVVLDLDLpaaeaepptgvvddglri    277
d1ntfa_      239 WTDRALYKSGTgktiqplsynsltnykqtehRPVLAKFRVTL------------------    280

Query        278 drlviseeplpayeaelaggyadrl    302
d1ntfa_      281 -------------------------    281


hit structure      alignment
FAST alignment (Normalized score: 3.53 Raw score:1025.00)
Query          1 S--LQLRLALNQIDSTVGDIAGN--AEAILRWTRHSA-----EQGAHLVAFPEMALTGY-     50
d1ntfa_        1 -PPAQLSVHTVSWN-SGHE----RAPTNLEEL-----LGLNSGETPDVIAV--------A     41

Query         51 -PVEDLAL--RSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGA    107
d1ntfa_       42 VQGFGFQ-TDKPQQGPACVKNFQS---LLTSKG---------------------------     70

Query        108 P----------RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG-------------    144
d1ntfa_       71 -YTKLKNTITETMGLTVY-----------------------------CLEKHLDQNTLKN    100

Query        145 --------------DTMPIVRLHGVDIALAICEDLWQDGGRVPAARSA------------    178
d1ntfa_      101 ETIIVTVDDQKKSGGIVTSFTIYNKRFSFTT-----------------SRMSDEDVTSTN    143

Query        179 ----------------GAGLLLSVNASPYERDK----------------------DDTRL    200
d1ntfa_      144 TKYAYDTRLDYSKKDDPSDFLFWIGDLNVR---VETNATHAKSLVDQNNIDGLMAFDQLK    200

Query        201 ELVRKRAQEAGCTTAYLAMIGGQDELVF--------------------------------    228
d1ntfa_      201 K---------------------------AKEQKLFDGWTEPQVTFKPTYKFKPNTDEYDL    233

Query        229 ------DGDSIVVDRDGEVVARAPQ----------------------FSEGCVVLDLDLP    260
d1ntfa_      234 SATPSWTDRALYK------------SGTGKTIQPLSYNSLTNYKQTEHRPVLAKFRV---    278

Query        261 AAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--    302
d1ntfa_      279 ------------------------------------------TL    280


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:152.70)
Query          1 -SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1ntfa_        1 PPAQLSVHTVS-WNSGHERAP--TNLEELLGLNSGETPDVIAVAVQ----G-F--GFQTD     50

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG-    118
d1ntfa_       51 KP--QQGPACVKNFQSLLT-SKGYTKLKN-T-IT--------------ETMGLTVYCLEK     91

Query        119 ------RVA-LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICED-------    164
d1ntfa_       92 HLDQNT--LKNETIIVTV--------DDQKKSGGIVTSFTIYNKRFSFTTSRMSDEDVTS    141

Query        165 -----LWQDGGRVPAARSAGAGLLLSVNASPYERD-------------------KDDTRL    200
d1ntfa_      142 TNTKYAYD-TRLDYSKKDDPSDFLFWIGDLNVRVETNATHAKSLVDQNNIDGLMAFDQLK    200

Query        201 ELV--RKRAQEAGCTTAY-LA---MIGGQD--------EL-VFD-GDSIVVDR-DGEVVA    243
d1ntfa_      201 KAKEQKLFDG----WTEPQ-VTFKPTYKFKPNTDEYDLSATPSWTDRALYKSGTGKTIQP    255

Query        244 -RAPQFS--------EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAEL    294
d1ntfa_      256 LSYNSLTNYKQTEHRPVLAKFRVTL-----------------------------------    280

Query        295 AGGYADRL    302
d1ntfa_      281 --------    281


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.01)
DALI match       ***********.....  ..........   ********  ....
Query          3 QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA--FPEM     45
d1ntfa_        4 QLSVHTVSWNSGHERAPTNLEELLGLNS---GETPDVIAVAVQGF     45



top
9: d4kbpa2 Plant purple acid phosphatase,​ catalytic domain (svm: 1.981)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.43  Contact: 1440
Modified z-scores:
dali:1.00 daliz:0.97 gdtts:0.99 tmscore:1.00 rmsd:0.49 AHM:0.48 LBcontacta:1.00 LBcontactb:0.98 LHM:0.17
id:0.97 blosum:0.10 compass:0.17 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.40 tmscore:0.55 rmsd:0.72 AHM:0.65 LBcontacta:0.40 LBcontactb:0.53 LHM:0.41
id:0.03 blosum:0.08 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 5.9 Raw score:776.30)
Query          1 ----SLQLRLALNQIdstvgdiagNAEA-iLRWTRHSAEQ--GAHLVAFPEMALTgypve     53
d4kbpa2        1 qtglDVPYTFGLIGD--------lGQSFdsNTTLSHYELSpkKGQTVLFVGDLSY-----     47

Query         54 dlalRSSFvEASRTALRELAARLaeegFGELPVLVG---yLDRSESAQpkygqPAGAPRn    110
d4kbpa2       48 adryPNHD-NVRWDTWGRFTERS----VAYQPWIWTagnhEIEFAPEI-----NETEPF-     96

Query        111 aaavlhrgrVALT-------FAKHhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICE    163
d4kbpa2       97 ---kpfsyrYHVPyeasqstSPFW--------------------YSIKRASAHIIVLSSY    133

Query        164 -----dlwQDGGRvPAARSAGA-----GLLLSVNAS------PYERdkddtrleLVRKRA    207
d4kbpa2      134 saygrgtpQYTWL-KKELRKVKrsetpWLIVLMHSPlynsynHHFM-egeamrtKFEAWF    191

Query        208 QEAGCTTAYLAMIggqdelvFDGD-----------------sivvdrDGEV---------    241
d4kbpa2      192 VKYKVDVVFAGHV-------HAYErservsniaykitdglctpvkdqSAPVyitigdagn    244

Query        242 --------------varaPQFSEGCVVLDLDLPaaeaepptgvvddglridrlviseepl    287
d4kbpa2      245 ygvidsnmiqpqpeysafREASFGHGMFDIKNR---------------------------    277

Query        288 payeaeLAGG-----------------------yadrl    302
d4kbpa2      278 ---thaHFSWnrnqdgvaveadsvwffnrhwypvddst    312


hit structure      alignment
FAST alignment (Normalized score: 3.22 Raw score:989.20)
Query          1 ----SLQLRLALNQIDSTVGD-----IAGNAEAILRWTRHS-AEQGAHLVAFPEMALTGY     50
d4kbpa2        1 QTGLDVPYTFGLI--------GDLGQSFDSNTTLSHYE---LSPKKGQTVLFVG------     43

Query         51 PVEDLA----------LRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d4kbpa2       44 ------DLSYADRYPNHDNVRWDTWGRFTERSV--------AYQPWIW------------     77

Query        101 YGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD---------------    145
d4kbpa2       78 ---------------------------------------------TAGNHEIEFAPEINE     92

Query        146 -----------------------TMPIVRLHGVDIALAICEDLWQD------GGRVPAAR    176
d4kbpa2       93 TEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSY-----SAYGRGTPQYTWLK    147

Query        177 SAG---------AGLLLSVNASPYERDKD---------------DTRLELVRKRAQEAGC    212
d4kbpa2      148 K--ELRKVKRSETPWLIVLM---------HSPLYNSYNHHFMEGEAMRTKFEAWFVKYKV    196

Query        213 TTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAP--------------------------    246
d4kbpa2      197 -DVVFA----------------------------GHVHAYERSERVSNIAYKITDGLCTP    227

Query        247 ------------------------------------QFSEGCVVLDLDLPAAEAEPPTGV    270
d4kbpa2      228 VKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYSAFREASFGHGMFDI-------------    274

Query        271 VDDGLRIDRLVISEEPLPAYEAELAGGYADRL----------------------------    302
d4kbpa2      275 --------------------------------KNRTHAHFSWNRNQDGVAVEADSVWFFN    302

Query        303 ----------    303
d4kbpa2      303 RHWYPVDDST    312


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:146.33)
Query          1 ---SL-QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d4kbpa2        1 QTGLDVPYTFGLIGD-LG---QSFDSNTTLSHYELS-PKKGQTVLFVGDLSYA--DRYP-     52

Query         57 LRSSFVEASRTALRELAARLAEEGFGELPVLV-GY-LDRS-----ESAQPKYGQPAGAPR    109
d4kbpa2       53 -N-HD-NVRWDTWGRFTERSV---AY-QPWIWTAGNHEIEFAPEI---------NETEPF     96

Query        110 NAAA-VLHRGRVALTF-----AKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICE    163
d4kbpa2       97 KPFSY-----RYHVPYEASQS------------------TSPFWYSIKRASAHIIVLSSY    133

Query        164 DLWQDG---G-RVPAARSAGA-----GLLLSVNAS--P-YERDKD-DTR-LEL--VRKRA    207
d4kbpa2      134 SAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFME-GEA-MRTKFEAWF    191

Query        208 QEAGCTTAYLAMIGGQDELVFDGDSIVVD-----------------RDGEVVA-------    243
d4kbpa2      192 VKYKVDVVFAGHVH-------AYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGN    244

Query        244 ----------------RAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPL    287
d4kbpa2      245 YGVIDSNMIQPQPEYSAFREASFGHGMFDIKNR---------------------------    277

Query        288 PAYEAELAG-------------GYA-------------DRL    302
d4kbpa2      278 ---THAHFSWNRNQDGVAVEADSVWFFNRHWYPVDDST---    312


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.85)
DALI match                                           
Query        182 LLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYL    217
d4kbpa2      128 IVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIV    163



top
10: d1s3la_ Putative phosphodiesterase MJ0936 (svm: 1.956)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.60  Contact: 1087
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.97 tmscore:0.98 rmsd:0.40 AHM:0.41 LBcontacta:0.98 LBcontactb:0.97 LHM:0.23
id:0.85 blosum:0.43 compass:0.80 pearson:0.99
Scaled scores:
dali:0.70 daliz:0.41 gdtts:0.50 tmscore:0.59 rmsd:0.76 AHM:0.66 LBcontacta:0.45 LBcontactb:0.62 LHM:0.37
id:0.02 blosum:0.11 compass:0.36 pearson:0.31

hit structure      alignment
DALI alignment (Z-score: 6.1 Raw score:664.70)
Query          1 slqLRLALNqidstvgdiagNAEAILRWTRHSAEQGAHLVAFPEMALTgypvedlalrss     60
d1s3la_        1 ---MKIGIM------sdthdHLPNIRKAIEIFNDENVETVIHCGDFVS------------     39

Query         61 fveasrtalRELAARLaeEGFGeLPVLV---gYLDRsesaqpkygqpagaprnaaavlhR    117
d1s3la_       40 ---------LFVIKEF--ENLN-ANIIAtygnNDGE-------------rcklkewlkdI     74

Query        118 GRVALTFAkhhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICEDLwqdgGRVPAAR-    176
d1s3la_       75 NEENIIDD---------------------fISVEIDDLKFFITHGHHQ----SVLEMAIk    109

Query        177 SAGAGLLLSVNASpyerdkddtrlelvrkRAQEaGCTTAYLAM-IGGQdelvfdgdsivv    235
d1s3la_      110 SGLYDVVIYGHTH------------ervfEEVD-DVLVINPGEcCGYL------------    144

Query        236 drdgevvarapQFSEGCVVLDLDLpaaeaepptgvvddglridrlviseeplpayeaela    295
d1s3la_      145 -----------TGIPTIGILDTEK-----------------------------------k    158

Query        296 ggyadrl    302
d1s3la_      159 eyreivl    165


hit structure      alignment
FAST alignment (Normalized score: 4.01 Raw score:894.50)
Query          1 SLQL-RLALNQIDSTVGDIAG-----NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED     54
d1s3la_        1 ----MKIGIM-----------SDTHDHLPNIRKAIEIFNDENVETVI-------------     32

Query         55 LALRSSFVEASRT------------------------------ALRELAARLAEEGFGEL     84
d1s3la_       33 -------------HCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKD------     73

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG    144
d1s3la_       74 ------------------------------------------------------------     74

Query        145 D--------TMPIVRLHGVDIALAICEDLWQDGGRVPAARSA-GAGLLLSVNASPYERDK    195
d1s3la_       74 -INEENIIDDFISVEIDDLKFFITH---GHHQ-SVLEMAIKSGLYDVVIYGH--------    120

Query        196 DDTRLELVRKRAQE---------AGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAP    246
d1s3la_      121 --------------THERVFEEVDDVLVINP-----------------------------    137

Query        247 -------QFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA    299
d1s3la_      138 GECCGYLTGIPTIGILD-------------------------------------------    154

Query        300 DRL-----------    302
d1s3la_      155 ---TEKKEYREIVL    165


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:119.85)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1s3la_        1 ---MKIGIMSDTHD-----HL-PNIRKAIEIFNDENVETVIHCGDFVS------------     39

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGY--LDRSE-SAQPKYGQPAGAPRNAAA-VLH    116
d1s3la_       40 ----L--FV-IKE-FE--NLN-ANIIATYGNNDGERCK---------------LKEW-LK     72

Query        117 -RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAA    175
d1s3la_       73 DINEENIIDD---------------------FISVEIDDLKFFITHGHH-QS--VLEMAI    108

Query        176 RSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAM-IGGQDELVFDGDSIV    234
d1s3la_      109 KSGLYDVVIYGHTH---------ER-VFE--EVD-DVLVINPGECCGY-----LT-----    145

Query        235 VDRDGEVVARAPQFSEGCVVLDL-DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAE    293
d1s3la_      146 -------------GIPTIGILDTEKK----------------------------------    158

Query        294 LAGGYA-DRL    302
d1s3la_      159 EYREIVL---    165


hit structure      alignment
HHsearch alignment (Probability: 0.38 E-value:0.00)
DALI match       ******           **********************
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1s3la_        1 MKIGIMS------DTHDHLPNIRKAIEIFNDENVETVIH     33



hit structures. 
top
11: d1vyba_ Endonuclease domain of LINE-​1 reverse transcriptase homolog (svm: 1.432)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.48  Contact: 1273
Modified z-scores:
dali:0.99 daliz:0.95 gdtts:0.99 tmscore:1.00 rmsd:0.44 AHM:0.47 LBcontacta:0.97 LBcontactb:0.96 LHM:0.15
id:0.98 blosum:0.48 compass:0.11 pearson:0.99
Scaled scores:
dali:0.64 daliz:0.27 gdtts:0.43 tmscore:0.57 rmsd:0.73 AHM:0.64 LBcontacta:0.31 LBcontactb:0.43 LHM:0.47
id:0.04 blosum:0.12 compass:0.22 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:614.60)
Query          1 --sLQLRLALNQIDStvgDIAGNAEAILRWTRHSAeqgAHLVAFPEMaltgypvedlalr     58
d1vyba_        1 gsnSHITILTLNING--lNSAIKRHRLASWIKSQD---PSVCCIQET-------------     42

Query         59 ssfveaSRTALRELAarlaeEGFGElpvlvgYLDRsesaqpkygqpagaprNAAAVL---    115
d1vyba_       43 ----hlTCRDTHRLK----iKGWRK---iyqANGK-------------qkkAGVAILvsd     78

Query        116 ---hrgrvaLTFAkhhlpnygvfdefryfvpgdtmPIVRLH--GVDIAL-AICE------    163
d1vyba_       79 ktdfkptkiKRDK-----------------eghyiMVKGSIqqEELTILnIYAPntgapr    121

Query        164 DLWQdggRVPAARSAGA-GLLLSVN------aspYERDKDDT-rlELVRKRAQEAGC---    212
d1vyba_      122 FIKQ---VLSDLQRDLDsHTLIMGDfntplstldRSTRQKVNkdtQELNSALHQADLidi    178

Query        213 ----ttaylamIGGQD--ELVFDgDSIVVDRDGE----vVARA---pqfSEGCVVLDLDl    259
d1vyba_      179 yrtlhpksteyTFFSAphHTYSK-IDHIVGSKALlskckRTEIitnylsDHSAIKLELR-    236

Query        260 paaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1vyba_      237 -------------------------------------------    237


hit structure      alignment
FAST alignment (Normalized score: 3.92 Raw score:1048.00)
Query          1 S---LQLRLALNQIDSTVGD----IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1vyba_        1 -GSNSHITILTLNI------NGLNSAIKRHRLASWIKS---QDPSVCCIQ----------     40

Query         54 DLALRSSFVEA----SRTALRELAARLAEEGFGE------LPVLVGYLDRSESAQPKYGQ    103
d1vyba_       41 -----------ETHLTCRDTHR------------LKIKGWRKIYQAN-------------     64

Query        104 PAGA---PRNAAAVLHRGRV---------ALTFAKHHLPNYGVFDEFRYFVPGD------    145
d1vyba_       65 ----GKQKKAGVAIL-----VSDKTDFKPTKIK---------------------RDKEGH     94

Query        146 -TMPIVRLHGVDIALAICEDLWQDG--------------GRVPAARSAG--AGLLLSVNA    188
d1vyba_       95 YIMVKGSIQQEELTIL---------NIYAPNTGAPRFIKQVLSDLQR--DLDSHTLIMGD    143

Query        189 SPY---------ERDKDDTR----LELVRKRAQEAGCTTAYLAM--------------IG    221
d1vyba_      144 F--NTPLSTLDRSTRQK---VNKDTQELNSALHQADL-------IDIYRTLHPKSTEYTF    191

Query        222 GQDELVFDG--------DSIVVDRDGEV----------VARAPQFS------EGCVVLDL    257
d1vyba_      192 FS-------APHHTYSKIDHIVG-----SKALLSKCKRTEII----TNYLSDHSAIKLE-    234

Query        258 DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--    302
d1vyba_      235 ---------------------------------------------LR    236


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:135.12)
Query          1 ---SLQLRLALNQIDSTVGDIA-GNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d1vyba_        1 GSN-SHITILTL-NING--LNSAIKRHRLASWIKSQD---PSVCCIQ-E-TH--------     43

Query         57 LRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH    116
d1vyba_       44 ----LTC--RD-THRLK--I--KGWR--KIYQ-ANGK-------------QKKAGVAILV     76

Query        117 RG-----RVA--LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH--GVDIALAI-C----    162
d1vyba_       77 SDKTDFK--PTKIKRDK---------------EGH-YIMVKGSIQQEELTILNIYAPNTG    118

Query        163 E--DLWQDGGRVPAARSAGAGLLLSVNASPY-----E-RDKDDT-RLELVRKRAQEAGCT    213
d1vyba_      119 APRFIKQVLSDLQRDL--DSHTLIMGDFNTPLSTLDRSTRQKVNKDTQELNSALHQADLI    176

Query        214 TAY---------LAMIGGQDELVFDGDSIVVDRDG-E--V-VARAPQ---FSEGCVVLDL    257
d1vyba_      177 DIYRTLHPKSTE-YTFFSAPHHTYSKIDHIVGSKALLSKCKRTEIITNYLSDHSAIKLEL    235

Query        258 DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1vyba_      236 R--------------------------------------------    236


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.02)
DALI match       *********** .     .............   *********
Query          3 QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEM     45
d1vyba_        5 HITILTLNINGLN-----SAIKRHRLASWIKSQDPSVCCIQET     42



top
12: d2dnja_ Deoxyribonuclease I (svm: 1.411)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.20  Contact: 850
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.37 AHM:0.37 LBcontacta:0.96 LBcontactb:0.97 LHM:0.23
id:0.99 blosum:0.70 compass:0.48 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.38 gdtts:0.49 tmscore:0.60 rmsd:0.78 AHM:0.73 LBcontacta:0.34 LBcontactb:0.57 LHM:0.40
id:0.08 blosum:0.13 compass:0.22 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:601.80)
Query          1 slqLRLALNQIDS-tvGDIAG--NAEAILRWTRHsaeqgAHLVAFPEMaltgypvedlal     57
d2dnja_        1 ---LKIAAFNIRTfgeTKMSNatLASYIVRIVRR-----YDIVLIQEV------------     40

Query         58 rssfveaSRTALRELAARLAEEGFGELPvlvgyldrsesaqpkygqpagaprnaaavlhr    117
d2dnja_       41 ----rdsHLVAVGKLLDYLNQDDPNTYH--------------------------------     64

Query        118 grvALTFAKHhlpnygVFDEfryfvpgdtmpivrLHGVDialaiceDLWQD--------g    169
d2dnja_       65 ---YVVSEPL-----gRNSY--kerylflfrpnkVSVLD-----tyQYDDDsfsrepavv    109

Query        170 grvpaarsagAGLLLSVNaSPYErdkdDTRLELVRKRAQEAG------CTTAYLA--mig    221
d2dnja_      110 kfsshstkvkEFAIVALH-SAPS--daVAEINSLYDVYLDVQqkwhlnDVMLMGDfnadc    166

Query        222 gqdelvfdgdsivvdrdgEVVAR---aPQFS-----------------------------    249
d2dnja_      167 syvtssqwssirlrtsstFQWLIpdsaDTTAtstncaydrivvagsllqssvvpgsaapf    226

Query        250 ------------------EGCVVLDLDlpaaeaepptgvvddglridrlviseeplpaye    291
d2dnja_      227 dfqaayglsnemalaisdHYPVEVTLT---------------------------------    253

Query        292 aelaggyadrl    302
d2dnja_      254 -----------    254


hit structure      alignment
FAST alignment (Normalized score: 3.85 Raw score:1064.00)
Query          1 SLQLRLALNQIDSTVGD---------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYP     51
d2dnja_        1 ---LKIAAFNI------RTFGETKMSNATLASYIVRIVR-----RYDIVLIQ--------     38

Query         52 VEDLALRSSFVEAS------RTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQP    104
d2dnja_       39 --------------EVRDSHLVAVGKLLDYLN-QDDPNTYHYVV----------------     67

Query        105 AG-------APRNAAAVLHRGRVALTFAK------------HHLPNYGVFDEFRYFVPGD    145
d2dnja_       68 --SEPLGRNSYKERYLFL-----------FRPNKVSVLDTYQYDDDSF------------    102

Query        146 T-----MPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA-------GLLLSVNASPYER    193
d2dnja_      103 -SREPAVVKFS-----------------------------SHSTKVKEFAIVALHSA---    129

Query        194 DKD--------DTRLELVRKRAQEAG-CTTAYLAMIGGQDELVF----------------    228
d2dnja_      130 ---PSDAVAEINSLYDVYLDVQQKWHLNDVMLM-----------GDFNADCSYVTSSQWS    175

Query        229 ----------------------------DGDSIVVDRDGEVVARAPQFS-----------    249
d2dnja_      176 SIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVA--------------GSLLQSSVVPG    221

Query        250 -----------------------EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEP    286
d2dnja_      222 SAAPFDFQAAYGLSNEMALAISDHYPVEVTL-----------------------------    252

Query        287 LPAYEAELAGGYADRL-    302
d2dnja_      253 ----------------T    253


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:140.16)
Query          1 SLQLRLALNQIDSTVG-DIA-G--NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d2dnja_        1 ----LKIAAFNIRTFGETKMSNATLASYIVRIVR-RY----DIVLI-QE-VR--------     41

Query         57 LRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH    116
d2dnja_       42 ----DSH--LVAVGKLLDYLNQDDPNTYHYVV-SEPLG--------RN--SYKERYLFLF     84

Query        117 RG----RVA-LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH----GVDIALAICE----    163
d2dnja_       85 RPNKVS--VLDTYQYDDDSF-----S---R-EP-AVVKFSSHSTKVKEFAIVALHSAPSD    132

Query        164 ---DLWQDGGRVPAARS-A-GAGLLLSVNASPYER--DKDDTR-LELVRKRAQEAGCTTA    215
d2dnja_      133 AVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSS-IRLRTSSTF---QWL    188

Query        216 YL---AMIGGQDELVFDGDSIVVDRD--GE-V-VA-RAP-Q----------------FSE    250
d2dnja_      189 IPDSADTTATS--TNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHY    246

Query        251 GCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d2dnja_      247 PVEVTL-----------------------------------T----------    253


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.01)
DALI match       **********  ................     ********
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPE     44
d2dnja_        1 LKIAAFNIRTF-GETKMSNATLASYIVRIVRR-YDIVLIQE     39



top
13: d1utea_ Mammalian purple acid phosphatase (svm: 1.981)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.32  Contact: 1423
Modified z-scores:
dali:1.00 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.46 AHM:0.45 LBcontacta:0.98 LBcontactb:0.98 LHM:0.17
id:1.00 blosum:0.45 compass:0.27 pearson:0.99
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.39 tmscore:0.54 rmsd:0.72 AHM:0.66 LBcontacta:0.35 LBcontactb:0.54 LHM:0.46
id:0.07 blosum:0.12 compass:0.21 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 5.4 Raw score:690.50)
Query          1 -SLQLRLALNQ---idstvgDIAGNAEAILRWTRHSAE-QGAHLVAFPEMALTgypvedl     55
d1utea_        1 pTPILRFVAVGdwggvpnapFHTAREMANAKAIATTVKtLGADFILSLGDNFY-------     53

Query         56 alrssFVEA---srTALRE-LAARLAEEGFGELPVLV----gyLDRSesaqpkygqpaga    107
d1utea_       54 -----FTGVhdakdKRFQEtFEDVFSDPSLRNVPWHVlagnhdHLGN------------v     96

Query        108 prnaaavlhrgrVALTFAKhhlpnygvfdefryfvpgdtmPIVRLH------GVDIALAI    161
d1utea_       97 saqiayskiskrWNFPSPY---------------------YRLRFKiprsnvSVAIFMLD    135

Query        162 CE-------------------dlwQDGG--RVPAARSAG---aGLLLSVN--aSPYErdk    195
d1utea_      136 TVtlcgnsddfvsqqperprnlalARTQlaWIKKQLAAAkedyVLVAGHYpvwSIAEhgp    195

Query        196 ddtrlELVRKRAQEAGCTTAYLAMiggqdelvFDGDsivvdrDGEV--------------    241
d1utea_      196 thclvKQLLPLLTTHKVTAYLCGH--------DHNLqylqdeNGLGfvlsgagnfmdpsk    247

Query        242 --------varaPQFS-----EGCVVLDLDlpaaeaepptgvvddglridrlviseeplp    288
d1utea_      248 khlrkvpngylrFHFGaenslGGFAYVEIT------------------------------    277

Query        289 ayeAELAG-------------gyadrl    302
d1utea_      278 --pKEMSVtyieasgkslfktklprra    302


hit structure      alignment
FAST alignment (Normalized score: 3.13 Raw score:944.80)
Query          1 S--LQLRLALNQIDSTVGD------------IAGNAEAILRWTRHSAEQGAHLVAFPEMA     46
d1utea_        1 -PTPILRFVAV--------GDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLG-D     50

Query         47 LTGYPVEDLALR--------SSFVEASRTALRELAARLAE--EGFGELPVLVGYLDRSES     96
d1utea_       51 NFY---------FTGVHDAKDKRFQ---ETFEDVF-----SDPSLRNVPWHV--------     85

Query         97 AQPKYGQPAGAPRNAAAVLHRGRV-----------------------ALTFAKHHLPNYG    133
d1utea_       86 ------------------------LAGNHDHLGNVSAQIAYSKISKRWNFP---------    112

Query        134 VFDEFRYFVPG--DTMPIVRLH------GVDIALAICEDLWQD-----------------    168
d1utea_      113 -----------SPYYRLRFK--IPRSNVSVAIFMLDTVT----LCGNSDDFVSQQPERPR    155

Query        169 -----GGRVPAARS----AGAGLLLSVNASPYERDKD-------------DTRLELVRKR    206
d1utea_      156 NLALARTQLAWIKKQLAAAKEDYVLVAG---------HYPVWSIAEHGPTHCLVKQLLPL    206

Query        207 AQEAGCTTAYLAMIGGQDELVFD---GDSIVVDRDGEVVARAPQFS--------------    249
d1utea_      207 LTTHKV-TAYLC-----------GHDHNLQYL--------------QDENGLGFVLSGAG    240

Query        250 ----------------------------EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLV    281
d1utea_      241 NFMDPSKKHLRKVPNGYLRFHFGAENSLGGFAYVE-------------------------    275

Query        282 ISEEPLPAYEAELAGGYADRL---------------------------    302
d1utea_      276 ---------------------ITPKEMSVTYIEASGKSLFKTKLPRRA    302


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:149.19)
Query          1 -SLQLRLALNQIDSTVGD-IAGN--AEAILRWTRHSA-EQGAHLVAFPEMALTGYPVEDL     55
d1utea_        1 PTPILRFVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDN-FYF-T--G     56

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYL-----DRSESAQPKYGQPAGAPRN    110
d1utea_       57 V-HD-AKDKRFQETFEDVFSD--PSLRNVPWHVLAGNHDHL--------------GNVSA     98

Query        111 AAAVLH-RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH-----GVDIALAICED    164
d1utea_       99 QIAYSKI-SKRWNFPSPY-------------------YRLRFKIPRSNVSVAIFMLDTVT    138

Query        165 LW-------------------QD--GGRVPAAR-SAGA-GLLLSVNAS----PYERDKDD    197
d1utea_      139 LCGNSDDFVSQQPERPRNLALARTQLAWIKKQLAAAKEDYVLVAGHYPVWSIAEHG--PT    196

Query        198 TRLEL-VRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVA-------------    243
d1utea_      197 HCLVKQLLPLLTTHKVTAYLCGH--------DHNLQYLQDENGLGFVLSGAGNFMDPSKK    248

Query        244 ----------RAPQFS----EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPA    289
d1utea_      249 HLRKVPNGYLRFHFGAENSLGGFAYVEITP-----------------------------K    279

Query        290 YEAELAG--------GYA------DRL    302
d1utea_      280 -EMSVTYIEASGKSLFKTKLPRRA---    302


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.27)
DALI match       .............*********
Query         22 AEAILRWTRHSAEQGAHLVAFP     43
d1utea_       27 MANAKAIATTVKTLGADFILSL     48



top
14: d1i9za_ Synaptojanin,​ IPP5C domain (svm: 1.429)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.22  Contact: 1128
Modified z-scores:
dali:0.99 daliz:0.94 gdtts:0.99 tmscore:1.00 rmsd:0.42 AHM:0.41 LBcontacta:0.98 LBcontactb:0.97 LHM:0.21
id:0.96 blosum:0.04 compass:0.03 pearson:0.97
Scaled scores:
dali:0.65 daliz:0.27 gdtts:0.44 tmscore:0.59 rmsd:0.78 AHM:0.70 LBcontacta:0.35 LBcontactb:0.50 LHM:0.39
id:0.03 blosum:0.06 compass:0.14 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:571.10)
Query          1 ---------------------SLQLRLALNQidstVGDIAgnAEAILRWTRHsaEQGAHL     39
d1i9za_        1 ydpiheyvnhelrkrenefseHKNVKIFVAS-ynlNGCSA--TTKLENWLFPenTPLADI     57

Query         40 VA-FPEMaltgyPVEDlalrssfVEASRTALRELAARLAEEG-----fGELPvlvgyldr     93
d1i9za_       58 YVvGFQE---ivQLTS------aDPAKRREWESCVKRLLNGKctsgpgYVQL--------    100

Query         94 sesaqpkygqpagapRNAAAVLH-------rgrvaltfakHHLPnygvfdefryFVPGdt    146
d1i9za_      101 ----------rsgqlVGTALMIFckesclpsiknvegtvkKTGL----------GNKG-a    139

Query        147 mPIVRLH--GVDIALAICE---------dlWQDGGRVPAA----rSAGA---GLLLSVNA    188
d1i9za_      140 vAIRFDYedTGLCFITSHLaagytnyderdHDYRTIASGLrfrrgRSIFnhdYVVWFGDF    199

Query        189 SPYERD------------------KDDTRLELV--rKRAQeagcttaylamiggqdelvf    228
d1i9za_      200 NYRISLtyeevvpciaqgklsylfEYDQLNKQMltgKVFP--------------------    239

Query        229 dgdsivvdrDGEVvARAPQFS---------------------------------------    249
d1i9za_      240 ---------FFSE-LPITFPPtykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqs    289

Query        250 ---------egCVVLDLDlpaaeaepptgvvddglridrlviseePLPA-----------    289
d1i9za_      290 vplyysdhrpiYATYEAN---------------------------IVKVdrekkkilfee    322

Query        290 -yeaelaggyadrl    302
d1i9za_      323 lynqrkqevrdasq    336


hit structure      alignment
FAST alignment (Normalized score: 3.66 Raw score:1167.00)
Query          1 ---------------------SLQLRLALNQIDSTVGDIAGNA--EAILRWTRHSAEQ--     35
d1i9za_        1 YDPIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCS-----ATTKLENWL------FP     49

Query         36 ----GAHLVAFPEMALTGYPVEDLA----------LRSSFVEASRTALRELAARLAEEGF     81
d1i9za_       50 ENTPLADIYVV--------------GFQEIVQLTSADPAKRREWESCVKRLLNGK-----     90

Query         82 GELPVLVGYLDRSESAQPKYGQPAGAP----------------RNAAAVLHRGRV-----    120
d1i9za_       91 ---------------------------CTSGPGYVQLRSGQLVGTALMIF-----CKESC    118

Query        121 ------ALTFAKHHLPNYGVFDEFRYFVPGD------TMPIVRLHGVDIALAICEDLWQD    168
d1i9za_      119 LPSIKNVEGT--VKKTG--------------LGNKGAVAIRFDYEDTGLCFI--------    154

Query        169 G-------------------GRVPAARS----------AGAGLLLSVNASPYERDK----    195
d1i9za_      155 -TSHLAAGYTNYDERDHDYRTIAS----GLRFRRGRSIFNHDYVVWFGDFNYR---ISLT    206

Query        196 ------------------DDTRLELVRKRAQEAGCTTAYLAMIGGQDELVF---------    228
d1i9za_      207 YEEVVPCIAQGKLSYLFEYDQLNKQML------------------------TGKVFPFFS    242

Query        229 ------------------------------DGDSIVVDRDGEVVARAPQ-----------    247
d1i9za_      243 ELPITFPPTYKFDIGTDIYDTSDKHRVPAWTDRILY-------------RGELVPHSYQS    289

Query        248 -------FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1i9za_      290 VPLYYSDHRPIYATYEANI-----------------------------------------    308

Query        301 RL----------------------------    302
d1i9za_      309 --VKVDREKKKILFEELYNQRKQEVRDASQ    336


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:153.58)
Query          1 ---------------------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHL     39
d1i9za_        1 YDPIHEYVNHELRKRENEFSEHKNVKIFVASY-NLNGCSAT-TKL-ENWLFPENTPLADI     57

Query         40 VAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGF--GELPVLVGYLDRSESA     97
d1i9za_       58 YVVGFQE-IV--QLT--SAD--PAKRREWESCVKRLLNGKCTSGPGYVQLRSG-QL----    105

Query         98 QPKYGQPAGAPRNAAAVLHRG-----RVA--LTFAKHHLPNYGVFDEFRYFVPGDTMPIV    150
d1i9za_      106 ----------VGTALMIFCKESCLPS--IKNVEGTVKKTGL----GNK--G-AV--AIRF    144

Query        151 RLHGVDIALAIC-E------------DLWQ-DGGRV----PAARSAGAGLLLSVNASPYE    192
d1i9za_      145 DYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRGRSIFN--HDYVVWFGDFNYR    202

Query        193 RD--------------------K-D-DTRLELVRKRAQEAGCTTAY-L-A-MIGGQ----    223
d1i9za_      203 ISLTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPF----FSELPITFPPTYKFDIGT    258

Query        224 ---D---E-L-VFDGDSIVVDRDGEVVARAPQ-------FSEGCVVLDLDLPAAEAE---    265
d1i9za_      259 DIYDTSDKHRVPAWTDRILYRGE-LVPHSYQSVPLYYSDHRPIYATYEA-NIVKVDREKK    316

Query        266 --------------------PPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1i9za_      317 KILFEELYNQRKQEVRDASQ-------------------------------------    336


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.10)
DALI match       **********   ......  .........   ********  ....
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA--FPEM     45
d1i9za_       22 HKNVKIFVASYNLNGCSATTKLENWLFPEN---TPLADIYVVGFQEI     65



top
15: d1su1a_ Phosphodiesterase yfcE (svm: 1.390)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.55  Contact: 1115
Modified z-scores:
dali:0.99 daliz:0.95 gdtts:0.96 tmscore:0.98 rmsd:0.50 AHM:0.50 LBcontacta:0.98 LBcontactb:0.97 LHM:0.22
id:1.00 blosum:0.83 compass:0.70 pearson:0.99
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.42 tmscore:0.52 rmsd:0.71 AHM:0.63 LBcontacta:0.42 LBcontactb:0.59 LHM:0.37
id:0.11 blosum:0.16 compass:0.28 pearson:0.29

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:545.60)
Query          1 slQLRLALNqidstvgdiagNAEAILRWTRHSAEQGAHLVAFPEMALTGyPVEDLalrss     60
d1su1a_        1 --MMKLMFA------sdihgSLPATERVLELFAQSGAQWLVILGDVLNH-GPRNA-----     46

Query         61 fveasrtALRELAARLAeeGFGELPVL-vGYLDrsesaqpkygqpagaprnaaavlhrGR    119
d1su1a_       47 --lpegyAPAKVVERLN--EVAHKVIAvrGNCD------------------sevdqmlLH     84

Query        120 VALTFAkhhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICE--DLWQdggrVPAARs    177
d1su1a_       85 FPITAP---------------------wQQVLLEKQRLFLTHGHlfGPEN----LPALN-    118

Query        178 agaGLLLSVNASpyerdkddtrlelvrKRAQeaGCTTAYLAM---IGGQdelvfdgdsiv    234
d1su1a_      119 -qnDVLVYGHTH-----------lpvaEQRG--EIFHFNPGSvsiPKGG-----------    153

Query        235 vdrdgevvarapqFSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpayeael    294
d1su1a_      154 -------------NPASYGMLDND----------------------------vlsvialn    172

Query        295 aGGYA----drl    302
d1su1a_      173 dQSIIaqvainp    184


hit structure      alignment
FAST alignment (Normalized score: 3.51 Raw score:827.10)
Query          1 SLQLRLALNQIDSTVGD-----IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL     55
d1su1a_        1 --MMKLMFA--------SDIHGSLPATERVLELFAQ---SGAQWLVILGDVLNH------     41

Query         56 ALRSS----------FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA    105
d1su1a_       42 -----GPRNALPEGYAPAKVVERLN---------EVAH-KVIA-----------------     69

Query        106 GAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD--------------------    145
d1su1a_       70 ----------------------------------------VRGNCDSEVDQMLLHFPITA     89

Query        146 TMPIVRLHGVDIALAICEDLWQD----GGRVPAARSAGA-----GLLLSVNASPYERDKD    196
d1su1a_       90 PWQQVLLEKQRLFLTHGH-----LFGPENLP--------ALNQNDVLVY-----------    125

Query        197 DTRLELVRKRAQE-----------AGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARA    245
d1su1a_      126 -------------GHTHLPVAEQRGEIFHFNPG---------------------------    145

Query        246 PQ--------FSEGCVVL-----------------DLDLPAAEAEPPTGVVDDGLRIDRL    280
d1su1a_      146 --SVSIPKGGNPASYGMLDNDVLSVIALNDQSIIAQVAIN--------------------    183

Query        281 VISEEPLPAYEAELAGGYADRL-    302
d1su1a_      184 ----------------------P    184


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:115.29)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL-----     55
d1su1a_        1 --MMKLMFASDIH----G--SLPATERVLELFAQSGAQWLVILGDVLNHG-PRNALPEGY     51

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLV-GYLDRS-ESAQPKYGQPAGAPRNAAA    113
d1su1a_       52 --------AP--AK-VV-ERLNE--VAHKVIAVRGNCDSEV----------------D-Q     80

Query        114 -VLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHG-VDIALAICE-DLWQDGG    170
d1su1a_       81 M-L--LHFPITAP----------------------WQQVLLEKQRLFLTHGHLFGPEN-L    114

Query        171 RVPAARS-AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFD    229
d1su1a_      115 -PA--LNQ--NDVLVYGHTHLP-------VA--EQRG-EI---FHFNPGSVSI----PKG    152

Query        230 GDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPA    289
d1su1a_      153 -----------------GNPASYGMLDND-------------------------------    164

Query        290 YEAELAG-------GYAD------RL    302
d1su1a_      165 ----VLSVIALNDQSIIAQVAINP--    184


hit structure      alignment
HHsearch alignment (Probability: 0.28 E-value:0.00)
DALI match       ******           **********************
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1su1a_        2 MKLMFAS------DIHGSLPATERVLELFAQSGAQWLVI     34



hit structures. 
top
16: d1hd7a_ DNA repair endonuclease Hap1 (svm: 1.431)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.28  Contact: 1213
Modified z-scores:
dali:0.99 daliz:0.95 gdtts:0.98 tmscore:0.99 rmsd:0.45 AHM:0.48 LBcontacta:0.99 LBcontactb:0.96 LHM:0.22
id:0.97 blosum:0.34 compass:0.31 pearson:0.99
Scaled scores:
dali:0.65 daliz:0.29 gdtts:0.44 tmscore:0.57 rmsd:0.73 AHM:0.63 LBcontacta:0.36 LBcontactb:0.47 LHM:0.37
id:0.04 blosum:0.11 compass:0.25 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:557.10)
Query          1 ---------------slQLRLALNQIdstvgdiAGNA-EAILRWTRHSAeqgAHLVAFPE     44
d1hd7a_        1 lyedppdqktspsgkpaTLKICSWNV----dglRAWIkKKGLDWVKEEA---PDILCLQE     53

Query         45 MaltgypvedlalrssfveasrtalrelaarlaeegFGELPvlvgYLDRsesaqpkygqp    104
d1hd7a_       54 T-------------------------------kcseGLSHQ--ywSAPY-----------     69

Query        105 agaprNAAAVLH--rgrvALTFakhhlpnygvfdefryfVPGD---tmPIVRLHGVDIAL    159
d1hd7a_       70 -----SGVGLLSrqcplkVSYG--------------igdEEHDqegrvIVAEFDSFVLVT    110

Query        160 AICE-----------dlwQDGGRVPAARSAG---aGLLLSV------nasPYER--DKDD    197
d1hd7a_      111 AYVPnagrglvrleyrqrWDEAFRKFLKGLAsrkpLVLCGDlnvaheeidLRNPkgNKKN    170

Query        198 TR-----LELVRKRAQEAGCT---------taylaMIGG-----QDELVFDGDSIVVDRD    238
d1hd7a_      171 AGftpqeRQGFGELLQAVPLAdsfrhlypntpyayTFWTymmnaRSKNVGWRLDYFLLSH    230

Query        239 --------gevvarapqfSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpay    290
d1hd7a_      231 sllpalcdskirskalgsDHCPITLYLA--------------------------------    258

Query        291 eaelaggyadrl    302
d1hd7a_      259 -----------l    259


hit structure      alignment
FAST alignment (Normalized score: 2.95 Raw score:824.40)
Query          1 SL-----------------QLRLALNQIDSTVG-DIAGNAEAIL-RWTRHSAEQGAHLVA     41
d1hd7a_        1 --LYEDPPDQKTSPSGKPATLKICSWNV-----DGLRAWIK---KKGLDWVKEEAPDILC     50

Query         42 FPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGE---------LPVLVGYLD     92
d1hd7a_       51 L-----------------------------------------QETKCSEGLSHQYWS---     66

Query         93 RSESAQPKYGQPAGAP--RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIV    150
d1hd7a_       67 ----------------APYSGVGLL-----------------------------------     75

Query        151 RLHGVDIALAICEDLWQDGGRVPAARSAG----------------------------AGL    182
d1hd7a_       76 -----------------------------SRQCPLKVSYGIGDEEHDQEGRVIVAEFDSF    106

Query        183 LLSVNASPYERDKD---------------DTRLELVRKRAQEAGCTTAYLA---------    218
d1hd7a_      107 VLVTAYVPN-----AGRGLVRLEYRQRWDEAFRKFLKGLAS--RKPLVLC-GDLNVAHEE    158

Query        219 -----------------------------------------------MIGGQDELVFDG-    230
d1hd7a_      159 IDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTY-------M    211

Query        231 -----------DSIVVDRDGEVVARAPQF--------------------SEGCVVLDLDL    259
d1hd7a_      212 MNARSKNVGWRLDYFLL------------SHSLLPALCDSKIRSKALGSDHCPITLYLA-    258

Query        260 PAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-    302
d1hd7a_      259 -------------------------------------------L    259


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:128.21)
Query          1 ----------S---L-Q-LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEM     45
d1hd7a_        1 LYEDPPDQKTSPSGKPATLKICSWNVDG----L-RAWIKK-KGLDWVKEEAPDILCLQ-E     53

Query         46 ALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA    105
d1hd7a_       54 TKC----------------SE-------------GLS--HQYWSAPY-------------     69

Query        106 GAPRNAAAVLHR-GRV-ALTFAKHHLPNYGVFDEFRYFVPG-DTMPIVRLHGVDIALAIC    162
d1hd7a_       70 ----SGVGLLSRQ-CPLKVSYGIGDEE-------H--DQEGR-VIVAEFD-SFVLVTAYV    113

Query        163 E-------------DLWQD-GGRVPAARSAGAGLLLSVNASP-----Y----ERDK---D    196
d1hd7a_      114 PNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGF    173

Query        197 DT-RLELVRKRAQEAGCTTAY-----------LAMIGGQ--------DELVFDGDSIVVD    236
d1hd7a_      174 TPQERQGFGELLQAVPLADSFRHLYPNTPYAY-TFWTYMMNARSKNV----GWRLDYFLL    228

Query        237 RD--GE----VVARAP----QFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEP    286
d1hd7a_      229 SHSL-LPALCDSKIRSKALG-SDHCPITLYLA---------------------------L    259

Query        287 LPAYEAELAGGYADRL    302
d1hd7a_      260 ----------------    260


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.02)
DALI match         *********         .............   *********
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEM     45
d1hd7a_       16 PATLKICSWNVDGL------RAWIKKKGLDWVKEEAPDILCLQET     54



top
17: d1wdua_ Endonuclease domain of TRAS1 retrotransposon (ORF2) (svm: 1.432)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.28  Contact: 819
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.97 tmscore:0.98 rmsd:0.40 AHM:0.38 LBcontacta:0.96 LBcontactb:0.95 LHM:0.22
id:0.97 blosum:0.51 compass:0.43 pearson:0.92
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.46 tmscore:0.56 rmsd:0.76 AHM:0.71 LBcontacta:0.38 LBcontactb:0.55 LHM:0.34
id:0.05 blosum:0.10 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:507.00)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeQGAHLVAFPeMALTgypvedlalrss     60
d1wdua_        1 ----------------------------------PPYRVLQAN-LQRK------------     13

Query         61 fveasRTALRELAARLAEEGFgeLPVLV-GYLD------------RSESaqpkygqpaga    107
d1wdua_       14 -----KLATAELAIEAATRKA--AIALIqEPYVkgfrgvrvfqstAQGD-----------     55

Query        108 pRNAAAVLHRgrvaltfakhhlpnygvfdefryfvpgDTMP-----IVRLH----GVDIA    158
d1wdua_       56 gTVKAAIAVF------------------dhdldviqyPQLTtnnivVVGIRtrawEITLV     97

Query        159 LAICE-dlWQDG--GRVPAARSAG---aGLLLSVN---aspyerdKDDTRLELVRKRAQE    209
d1wdua_       98 SYYFEpdkPIESylEQIKRVERKMgpkrLIFGGDAnakstwwgskEDDARGDQLMGTLGE    157

Query        210 AGCT---taylaMIGGqdeLVFDGDSIvvdrdgevvarapqfsegcvvldLDLPaaeaep    266
d1wdua_      158 LGLHilnegdvpTFDT---RYQSRVDV-------------------tfctEDML--dlid    193

Query        267 ptgvvddglridrlviseepLPAYeaelaggyadrl    302
d1wdua_      194 gwrvdedlvssdhngmvfniRLQK------------    217


hit structure      alignment
FAST alignment (Normalized score: 3.62 Raw score:927.20)
Query          1 SLQLRLALNQIDSTVGD--IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1wdua_        1 -PPYRVLQANL------QRKKLATAELAIEAA---TRKAAIAL-IQEP------------     37

Query         59 SSFVEASRTALRELAARLAEE---GFGELPVLVGYLDRSESAQPKYGQPAGAPRN-----    110
d1wdua_       38 ---------------------YVKGFRGVRVFQ----------------------STAQG     54

Query        111 ----AAAVLHRGRV-------ALTFAKHHLPNYGVFDEFRYFVPGD--------TMPIVR    151
d1wdua_       55 DGTVKAAIA-----VFDHDLDVIQY---------------------PQLTTNNIVVVGIR     88

Query        152 LHGVDIALAICEDLWQDG------------------GRVPAARSAG--AGLLLSVNASPY    191
d1wdua_       89 TRAWEITLV---------SYYFEPDKPIESYLEQIKRVERK-----MGPKRLIFGGDA--    132

Query        192 ERDKD------------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDG---------    230
d1wdua_      133 -----NAKSTWWGSKEDDARGDQLMGTLGELGLHI----------------LNEGDVPTF    171

Query        231 -------DSIVVDRDGEVVARAPQF--------------------SEGCVVLDLDLPAAE    263
d1wdua_      172 DTRYQSRVDVTFC------------TEDMLDLIDGWRVDEDLVSSDHNGMVFN-------    212

Query        264 AEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-----    302
d1wdua_      213 ---------------------------------------IRLQK    217


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:128.75)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1wdua_        1 --PPYRVLQAN-LQR-KK-LATAELAIEAATRK---AAIALI-QE-PY------------     38

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH--R-    117
d1wdua_       39 ----V-----KGFR--G----V--RVFQS-TAQ------------GDGTVKAAIAVFDHD     68

Query        118 ---GRVAL-T--FAKHHLPNYGVFDEFRYFVPGDTMPIVRLH----GVDIALAICE--DL    165
d1wdua_       69 LDV---IQYPQLTTNN-------------------IVVVGIRTRAWEITLVSYYFEPDKP    106

Query        166 WQD-GGRVPAARSAGA--GLLLSVNASPYE----RDKDDT-RLELVRKRAQEAGCTTAY-    216
d1wdua_      107 IESYLEQIKRVERKMGPKRLIFGGDANAKSTWWG-SKEDDARGDQLMGTLGELGLHILNE    165

Query        217 ---LAMIGGQDELVFDGDSIVVDRD--GE---VV-ARAPQ-----FSEGCVVLDLDLPAA    262
d1wdua_      166 GDV-PTFDT---RYQSRVDVTFCTEDM-LDLI-DGWRVDEDLVSSDHNGMVFNIR-----    214

Query        263 EAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1wdua_      215 ---------------------------LQK----------    217


hit structure      alignment
HHsearch alignment (Probability: 0.14 E-value:0.00)
DALI match                                         
Query         17 DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGY     50
d1wdua_        9 NLQRKKLATAELAIEAATRKAAIALIQEPYVKGF     42



top
18: d1sr4b_ Cytolethal distending toxin subunit B (svm: 1.430)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.23  Contact: 852
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.38 AHM:0.39 LBcontacta:0.91 LBcontactb:0.92 LHM:0.26
id:0.94 blosum:0.59 compass:0.55 pearson:0.95
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.51 tmscore:0.60 rmsd:0.77 AHM:0.69 LBcontacta:0.34 LBcontactb:0.54 LHM:0.32
id:0.05 blosum:0.12 compass:0.12 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:532.50)
Query          1 -slQLRLALNQIDSTVGdiaGNAEAILRWTRHSAE--QGAHLVAFPeMALTgypvedlal     57
d1sr4b_        1 nlsDFKVATWNLQGSSA---VNESKWNINVRQLLSgeQGADILMVQ-EAGS---------     47

Query         58 rssfveasrtalreLAAR-----------------lAEEG----fGELPVLVGY-LDRSe     95
d1sr4b_       48 -------------lPSSAvrtsrviqhggtpieeytWNLGtrsrpNMVYIYYSRlDVGA-     93

Query         96 saqpkygqpagaprnaaavlhrgrvaltfakhhlpnygvfdefryfvpgdtMPIVrlhgv    155
d1sr4b_       94 --------------------------------------nrvnlaivsrrqaDEAF-----    110

Query        156 dialaiceDLWQD---ggrvpaarsaGAGLLLSVNaSPYErdkdDTRLELVRKRAQEAG-    211
d1sr4b_      111 -------iVHSDSsvlqsrpavgiriGTDVFFTVHaLATG---gSDAVSLIRNIFTTFNs    160

Query        212 -------CTTAYLA-miggqdelvfdgdsivvdrDGEVVAR-aPQFS-------------    249
d1sr4b_      161 pperrvySWMVVGDfnrapanlevalrqepavseNTIIIAPtePTHRsgnildyailhda    220

Query        250 ----------------------------EGCVVLDLdlpaaeaepptgvvddglridrlv    281
d1sr4b_      221 hlprreqarerigaslmlnqlrsqitsdHFPVSFVR------------------------    256

Query        282 iseeplpayeaelaggyadrl    302
d1sr4b_      257 -------------------dr    258


hit structure      alignment
FAST alignment (Normalized score: 2.92 Raw score:814.50)
Query          1 SL---QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ-----GAHLVAFPEMALTGYPV     52
d1sr4b_        1 --NLSDFKVATWNLQGSSA---VNESKWNINVRQL---LSGEQGADILM-----------     41

Query         53 EDLALRSSFVEASRTALRELAARLAEEGF-------------------------------     81
d1sr4b_       42 -----------------------------VQEAGSLPSSAVRTSRVIQHGGTPIEEYTWN     72

Query         82 -------GELPVLVGYLDRSESAQPKYGQPAGAP-------RNAAAVLHRGRVALTFAKH    127
d1sr4b_       73 LGTRSRPNMVYIYYS-------------------RLDVGANRVNLAIV------------    101

Query        128 HLPNYGVFDEFRYFVPGDTMPIVRLHGVD-----IALAICEDLWQDGGRVPAARSAG---    179
d1sr4b_      102 -----------------------------SRRQADEAF-------------------IVH    113

Query        180 ----------------AGLLLSVNASPYERDKD----DTRLELVRKRAQE-------AGC    212
d1sr4b_      114 SDSSVLQSRPAVGIRIGTDVFFTVHAL------ATGGSDAVSLIRNIFTTFNSPPERRVY    167

Query        213 TTAYLAMIGGQDELVF---------------------------------------DGDSI    233
d1sr4b_      168 SWMVV-----------GDFNRAPANLEVALRQEPAVSENTIIIAPTEPTHRSGNILDYAI    216

Query        234 VVDRDGEVVARAPQFS-----------------------------EGCVVLDLDLPAAEA    264
d1sr4b_      217 LHD-------------AHLPRREQARERIGASLMLNQLRSQITSDHFPVSF---------    254

Query        265 EPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL----    302
d1sr4b_      255 --------------------------------------VRDR    258


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:144.11)
Query          1 SLQLRLALNQIDSTVG--DIAGNAE-AILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1sr4b_        1 -NLSDFKVATWNLQGSSAVNESKWNINVRQLLSG--EQGA-DILMVQE-AG---------     46

Query         58 RSSFVEASRTALRE---------------LAARLAE--EGFGELPVLVGYLDRSESAQPK    100
d1sr4b_       47 -------SLPSSAVRTSRVIQHGGTPIEEYTWNLGTRSRPNM-VYI-Y-YSRLD------     90

Query        101 YGQPAGA-P-RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIA    158
d1sr4b_       91 -----VGANRVNLAIVSRR-QADEAFIVHSDSSV---LQS--R-PA-V-GIRIG--TDVF    134

Query        159 LAICE------DLWQD-GGRVPAAR-S--AGAGLLLSVNASPYERDKDDTRLELVRKRAQ    208
d1sr4b_      135 FTVHALATGGSDAVSLIRNIFTTFNSPPERRVYSWMVVGDFNRA---PANLEVALRQEPA    191

Query        209 EAGCTTAYLA--MIGGQDELVFDGDSIVV-D--R---DGE-VV-ARAP-----------Q    247
d1sr4b_      192 VSENTIIIAPTEPTHR---SGNILDYAILHDAHLPRREQARERIGASLMLNQLRSQITS-    247

Query        248 FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1sr4b_      248 DHFPVSFVR--------------------------------------DR------    258


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.38)
DALI match                  
Query        157 IALAICEDLWQ    167
d1sr4b_      125 VGIRIGTDVFF    135



top
19: d1akoa_ DNA-​repair enzyme exonuclease III (svm: 1.431)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.21  Contact: 815
Modified z-scores:
dali:0.98 daliz:0.95 gdtts:0.98 tmscore:0.98 rmsd:0.37 AHM:0.35 LBcontacta:0.97 LBcontactb:0.97 LHM:0.22
id:0.84 blosum:0.26 compass:0.47 pearson:0.98
Scaled scores:
dali:0.69 daliz:0.35 gdtts:0.49 tmscore:0.61 rmsd:0.78 AHM:0.71 LBcontacta:0.40 LBcontactb:0.62 LHM:0.39
id:0.01 blosum:0.08 compass:0.27 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:490.50)
Query          1 slqLRLALnqidstvgdiAGNAEAILRWTRHSAeqgAHLVAFpEMALtgypvedlalrss     60
d1akoa_        1 ---MKFVS----fninglRARPHQLEAIVEKHQ---PDVIGL-QETK-------------     36

Query         61 fVEASRtaLRELAARLAeegfgelpvlvgYLDRsesaqpkygqpagaPRNAAAVLHrgrv    120
d1akoa_       37 vHDDMF--PLEEVAKLG-------ynvfyHGQK--------------GHYGVALLT----     69

Query        121 altfakhhlpnygvfdefryfVPGD-tmPIVRLH----GVDIALAICE-----------d    164
d1akoa_       70 ------ketpiavrrgfpgddEEAQrriIMAEIPsllgNVTVINGYFPqgesrdhpikfp    123

Query        165 lWQDG--GRVPAARSAG----aGLLLSVN-----aspYERDK--------------ddtr    199
d1akoa_      124 aKAQFyqNLQNYLETELkrdnpVLIMGDMnisptdldIGIGEenrkrwlrtgkcsflpee    183

Query        200 lELVRKRAQEagcttaylamiggqdelvfdgdsivvdrDGEVVAR-------aPQFS---    249
d1akoa_      184 rEWMDRLMSW----------------------------GLVDTFRhanpqtadRFSWfdy    215

Query        250 -------------------------------------------egcVVLDLDlpaaeaep    266
d1akoa_      216 rskgfddnrglridlllasqplaeccvetgidyeirsmekpsdhapVWATFR--------    267

Query        267 ptgvvddglridrlviseeplpayeaelaggyadrl    302
d1akoa_      268 -----------------------------------r    268


hit structure      alignment
FAST alignment (Normalized score: 3.53 Raw score:1004.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1akoa_        1 ---MKFVSFNI----NGLRARPHQLEAIVEK---HQPDVIGLQ-----------------     33

Query         61 FVEA----SRTALRE-LAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAP---RNAA    112
d1akoa_       34 ----ETKVHDDM---FPLEEVAKLG---YNVFYHG------------------QKGHYGV     65

Query        113 AVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTM-------------------------    147
d1akoa_       66 ALL--------------------------------TKETPIAVRRGFPGDDEEAQRRIIM     93

Query        148 PIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----------    196
d1akoa_       94 AEIPSLLG-------------------------NVTVINGYFPQGE---SRDHPIKFPAK    125

Query        197 DTRLELVRKRAQE---AGCTTAYLA-----------------------------------    218
d1akoa_      126 AQFYQNLQNYLETELKRDNPVLIM-GDMNISPTDLDIGIGEENRKRWLRTGKCSFLPEER    184

Query        219 --------------------------MIGGQDELVFDG-----------DSIVVDRDGEV    241
d1akoa_      185 EWMDRLMSWGLVDTFRHANPQTADRFSWFDYR------SKGFDDNRGLRIDLLLA-----    233

Query        242 VARAPQF------------------------SEGCVVLDLDLPAAEAEPPTGVVDDGLRI    277
d1akoa_      234 -------SQPLAECCVETGIDYEIRSMEKPSDHAPVWAT---------------------    265

Query        278 DRLVISEEPLPAYEAELAGGYADRL---    302
d1akoa_      266 -------------------------FRR    268


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:136.17)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAE-QGAHLVAFPEMALTGYPVEDLALRS     59
d1akoa_        1 ---MKFVSFNING-------LRAR-PHQLEAIVEKHQPDVIGLQ--ETK-----------     36

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLD-RSESAQPKYGQPAGAPRNAAAVLHR-    117
d1akoa_       37 ----VHDDMF--PLEEVAK--LG-YNVFYHGQKG----------------HYGVALLTKE     71

Query        118 GRV-ALTFAKHHLPNYGVFDEFRYFVPG--DTMPIVRLHG--VDIALAI-C---------    162
d1akoa_       72 -TPIAVRRGFPGD--------D--EEAQRR-IIMAEIPSLLGNVTVINGYFPQGESRDHP    119

Query        163 -----E--DLWQDGGRVPAARSAGAGLLLSVNASP---------------------YERD    194
d1akoa_      120 IKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSF    179

Query        195 KDDTRLELVRKRAQEAGCTTAY-----------LAMIGGQ--------DELVFDGDSIVV    235
d1akoa_      180 LPEER-EWMDRLMSW-GLVDTFRHANPQTADRF-SWFDYRSKGFDDNR----GLRIDLLL    232

Query        236 DRD--GE-V-VARA-P--------QFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVI    282
d1akoa_      233 ASQPLAECCVETGIDYEIRSMEKP-SDHAPVWATFR------------------------    267

Query        283 SEEPLPAYEAELAGGYADRL    302
d1akoa_      268 ------R-------------    268


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.01)
DALI match               ...............   ******..
Query         11 IDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPE     44
d1akoa_        1 MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQE     34



top
20: d1nnwa_ Hypothetical protein PF1291 (svm: 1.786)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.29  Contact: 895
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.94 tmscore:0.96 rmsd:0.41 AHM:0.41 LBcontacta:0.97 LBcontactb:0.96 LHM:0.23
id:0.93 blosum:0.62 compass:0.52 pearson:0.98
Scaled scores:
dali:0.69 daliz:0.33 gdtts:0.42 tmscore:0.52 rmsd:0.74 AHM:0.68 LBcontacta:0.43 LBcontactb:0.61 LHM:0.35
id:0.04 blosum:0.13 compass:0.25 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:465.20)
Query          1 slqlRLALNqidstvgdIAGNAEAILRWTRHSAE--QGAHLVAFPEMaltgypvedlalr     58
d1nnwa_        1 ---vYVAVL---aniagNLPALTAALSRIEEMREegYEIEKYYILGN------------i     42

Query         59 ssFVEAsRTALRELAARLAeegfGELPVLVgyldrsesaqpkygqpagaprnaaavlhrg    118
d1nnwa_       43 vgLFPY-PKEVIEVIKDLT----KKENVKI------------------------------     67

Query        119 rvalTFAK---------hhlpnygvfdeFRYF----------------------vpgdtm    147
d1nnwa_       68 ----IRGKydqiiamsdphatdpgyidkLELPghvkkalkftweklghegreylrdlpiy    123

Query        148 PIVRLHGVDIALAIC-------EDLW------qdggrvPAARsaGAGLLLSVNASpyerd    194
d1nnwa_      124 LVDKIGGNEVFGVYGspinpfdGEVLaeqptsyyeaimRPVK--DYEMLIVASPM-----    176

Query        195 kddtrlelvrkRAQEaGCTTAYLAM---iGGQDelvfdgdsivvdrdgevvarapqfseg    251
d1nnwa_      177 -------ypvdAMTR-YGRVVCPGSvgfpPGKE-----------------------hkat    205

Query        252 CVVLDLDLpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1nnwa_      206 FALVDVDT-----lkpkfieveydkkiieeriraeglpeeiikilyhggrp    251


hit structure      alignment
FAST alignment (Normalized score: 3.14 Raw score:865.00)
Query          1 SLQL-RLALNQIDSTVGD-----IAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGYPV     52
d1nnwa_        1 ----VYVAVL--------ANIAGNLPALTAALSRIEEMREEGYEIEKYYILG--------     40

Query         53 EDLALRSS-------FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA    105
d1nnwa_       41 --------NIVGLFPYPKEVIEVIKDLTK--------KENVKI-----------------     67

Query        106 GAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD--------------------    145
d1nnwa_       68 ----------------------------------------IRGKYDQIIAMSDPHATDPG     87

Query        146 ----------------------------------TMPIVRLHGVDIALAICEDLWQDG--    169
d1nnwa_       88 YIDKLELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGV---------YG    138

Query        170 --------------------GRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQE    209
d1nnwa_      139 SPINPFDGEVLAEQPTSYYEAIMRPV--KDYEMLIV------------------------    172

Query        210 A------------GCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ----------    247
d1nnwa_      173 -ASPMYPVDAMTRYGRVVCP------------------------------GSVGFPPGKE    201

Query        248 FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-----    302
d1nnwa_      202 HKATFALVDV---------------------------------------------DTLKP    216

Query        303 -----------------------------------    303
d1nnwa_      217 KFIEVEYDKKIIEERIRAEGLPEEIIKILYHGGRP    251


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:118.71)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGYPVEDLALR     58
d1nnwa_        1 ---VYVAVLAN-I-AG-NLPALTAALSRIEEMREEGYEIEKYYILGNIVG---L--F---     46

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLVGY-LD--RSESAQ----PKYGQPAGA----    107
d1nnwa_       47 --P--YP-KEVIEVIKDLT---KKENVKIIRGKYDQIIAMSDPHATD-----PGYIDKLE     93

Query        108 --------PR-N----------AAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMP    148
d1nnwa_       94 LPGHVKKALKFTWEKLGHEGRE--------YLRDLPI----------------------Y    123

Query        149 IVRLH-GVDIALAICEDLWQDGGRVPAARSAGAGLLLS-VNASPYERDKDDTRLELVRKR    206
d1nnwa_      124 LVDKIGGNEVFGVYG-SP-I--NP-------------FD-GEVLA-----EQPTSYYEAI    160

Query        207 AQEAG-CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAP-----QF--SE-GCVVLDL    257
d1nnwa_      161 MRPVKDYEMLIVASP-------M-YPVDAMT-RYGRVVCPGSVGFPPGKEHKATFALVDV    211

Query        258 DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGY-------------------    298
d1nnwa_      212 ----------------------------------DTLKPKFIEVEYDKKIIEERIRAEGL    237

Query        299 --------------ADRL    302
d1nnwa_      238 PEEIIKILYHGGRP----    251


hit structure      alignment
HHsearch alignment (Probability: 0.12 E-value:0.01)
DALI match        *****        .................      *******
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ-----GAHLVAF     42
d1nnwa_        1 VYVAVL------ANIAGNLPALTAALSRIEEMREEGYEIEKYYI     38



hit structures. 
top
21: d1vjna_ Hypothetical protein TM0207 (cs: 2.692)

SCOP Superfamily: Metallo-​hydrolase/​oxidoreductase  |  SCOP Fold: Metallo-​hydrolase/​oxidoreductase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.49  Contact: 824
Modified z-scores:
dali:0.97 daliz:0.92 gdtts:0.94 tmscore:0.96 rmsd:0.42 AHM:0.42 LBcontacta:0.93 LBcontactb:0.95 LHM:0.21
id:0.80 blosum:0.11 compass:0.26 pearson:0.92
Scaled scores:
dali:0.68 daliz:0.32 gdtts:0.42 tmscore:0.52 rmsd:0.76 AHM:0.69 LBcontacta:0.36 LBcontactb:0.57 LHM:0.37
id:0.01 blosum:0.06 compass:0.17 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:464.90)
Query          1 slQLRLALNQI-------dstvgdiagnAEAILrwtrhsaeqgahlvafpemaltgypve     53
d1vjna_        1 --HMKITWFGHacfalemegktivtdpfDPIPN--------------------------v     32

Query         54 dlalrssfveaSRTAlrELAArlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaa    113
d1vjna_       33 tadvvteshqhNAHH--LVKG---------------------------------------     51

Query        114 vlhrGRVALTFA------------kHHLPnygvfdefryFVPGdTMPIVRLHGVDIALAI    161
d1vjna_       52 ----NFRVIDRPgaytvngvkikgvETFH----------DGKN-IVFVFEGEGIKVCHLG     96

Query        162 CEdlWQDGGRVPAARsaGAGLLLSVNASPyerdkddtRLELVRKRAQEAGC-TTAYLAMI    220
d1vjna_       97 DLghVLTPAQVEEIG--EIDVLLVPVGGT-----ytiGPKEAKEVADLLNAkVIIPMHYK    149

Query        221 GGQdeLVFDGDSIVvdrdgEVVArapqfsegcVVLDL-DLPAaeaepptgvvddglridr    279
d1vjna_      150 TKYlkFNLLPVDDFlklfdSYER-------vgNILELfEKPK------------------    184

Query        280 lviseeplpayeaelaggyadrl    302
d1vjna_      185 -------------erkvvvmevq    194


hit structure      alignment
FAST alignment (Normalized score: 2.77 Raw score:669.20)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1vjna_        1 --HMKITW----------------------------------------------------      6

Query         61 FVEASRTALRELAARLAEEGFGE----------------------------LPVLVGYLD     92
d1vjna_        7 -----------------------FGHACFALEMEGKTIVTDPFDPIPNVTADVVTE----     39

Query         93 RSESAQPKYGQPAGAPRNAAAVLHRGRV-----------------------------ALT    123
d1vjna_       40 ----------------------------SHQHNAHHLVKGNFRVIDRPGAYTVNGVKIKG     71

Query        124 FAKHHLPNYGVFDEFRYFVPG-------DTMPIVRLHGVDIALAICEDLWQ--DGGRVPA    174
d1vjna_       72 V--------------------ETFHDGKNIVFVFEGEGIKVCHLG--DLGHVLTPAQVEE    109

Query        175 ARS-AGAGLLLSVNASPYERDKDDT-----RLELVRKRAQEAG-CTTAYLAMIGGQDE--    225
d1vjna_      110 ---IGEIDVLLVPVG----------GTYTIGPKEAKEVADLLNAKVIIP---------MH    147

Query        226 -------LVFDGDSIVVDRDGEVVARAPQFSEGC----------------VVLDLDLPAA    262
d1vjna_      148 YKTKYLKFNLL-----------------------PVDDFLKLFDSYERVGNILEL-----    179

Query        263 EAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL---------------    302
d1vjna_      180 ----------------------------------------FEKPKERKVVVMEVQ    194


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:110.43)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSA----EQGAHLVAFPEMALT-GYPVEDL     55
d1vjna_        1 --HMKITWFGHA------------C--FA--LEMEGK----TIVTD---PFDP-------     28

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLD--RSESAQPKYGQPAGAPRNAA-    112
d1vjna_       29 ----------------I---P--NVTAD-VVTESHQHNA-------------------HH     47

Query        113 -AVLHRGRVALTFA------------KHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIAL    159
d1vjna_       48 L--VKGNFRVIDRPGAYTVNGVKIKGVETF-------HD--GKNI--VFVFEGEGIKVCH     94

Query        160 AICEDLWQDGGRVPAARSAGAGLLLSVNASPYE-RDKDDTRLELVRKRAQEAGCT-TAYL    217
d1vjna_       95 LGDLGHVLTPAQVEEIG--EIDVLLVPVGGTYTI-----GP-KEAKEVADLLNAKVIIPM    146

Query        218 AM-I-GGQDELVFDGDSIVV--DRDGEVVARAPQFSEGCVVLDL-DLPA---AEAEPPTG    269
d1vjna_      147 HYKTKYLK--FNLLPVDDFLKL---FDSYERV------GNILELFEKPKERK--------    187

Query        270 VVDDGLRIDRLVISEEPLPAYEAELAGGYA--DRL    302
d1vjna_      188 -------------------------VVVMEVQ---    194


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.23)
DALI match       . ..................  ...........  ************             
Query        144 GDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELV    203
d1vjna_       77 DGKNIVFVFEGEGIKVCHLGDLGHVLTPAQVEEIGEIDVLLVPVGGTYTIGPKEAKEVAD    136

DALI match           
Query        204 RKRA    207
d1vjna_      137 LLNA    140



top
22: d1rv9a_ Hypothetical protein NMB0706 (cs: 2.210)

SCOP Superfamily: CNF1/​YfiH-​like putative cysteine hydrolases  |  SCOP Fold: CNF1/​YfiH-​like putative cysteine hydrolases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.24  Contact: 437
Modified z-scores:
dali:0.92 daliz:0.90 gdtts:0.95 tmscore:0.95 rmsd:0.35 AHM:0.36 LBcontacta:0.87 LBcontactb:0.79 LHM:0.41
id:0.95 blosum:0.39 compass:0.23 pearson:0.91
Scaled scores:
dali:0.68 daliz:0.37 gdtts:0.50 tmscore:0.56 rmsd:0.79 AHM:0.72 LBcontacta:0.31 LBcontactb:0.37 LHM:0.20
id:0.06 blosum:0.08 compass:0.16 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:441.80)
Query          1 ----------SLQLRLALNQI---------------dsTVGDIAGNAEAILRWTRHSAeq     35
d1rv9a_        1 knfltadwpaPANVKTLITTRnggvsqgayqslnlgthVGDNPEAVRRNREIVQQQVG--     58

Query         36 gahlvafpemaltgypvedlalrssfveasrtalrelaarlaeegfgeLPVLVGYldrse     95
d1rv9a_       59 ------------------------------------------------LPVAYLN-----     65

Query         96 saqpkygqpagaprnaaavlhrgRVALTFAKhhlpnygvfdefryfvpgdtmPIVRLH--    153
d1rv9a_       66 ----------qihstvvvnaaeaLGGTPDAD--------------------aSVDDTGkv     95

Query        154 ------------------GVDIALAICE--DLWQdgGRVPAARSAG-------aglllsv    186
d1rv9a_       96 acavmtadclpvlfcdraGTAVAAAHAGwrGLAG--GVLQNTIAAMkvppvemmaylgpa    153

Query        187 naspYERD--------------------------KDDTRLELVRKRAQEAGCttaylami    220
d1rv9a_      154 isadAFEVgqdvfdafctpmpeaatafegigsgkFLADLYALARLILKREGV--------    205

Query        221 ggqdelvfdgdsivvdRDGEVVARAPQ--FSEGcvvldldlpaaeaepptgvvddglrid    278
d1rv9a_      206 ----------------GGVYGGTHCTVleRDTF---------------------------    222

Query        279 rlviseeplpayeaelaggyadrl    302
d1rv9a_      223 ----fsyrrdgatgrmasliwldg    242


hit structure      alignment
FAST alignment (Normalized score: 1.91 Raw score:515.60)
Query          1 SLQ-----------LRLALNQIDST--------------------VGDIAGNAEAILRWT     29
d1rv9a_        1 ---KNFLTADWPAPANVKTLIT---TRNGGVSQGAYQSLNLGTHVGDNPEAVRRNREIVQ     54

Query         30 RHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGE--LPVL     87
d1rv9a_       55 QQ----------------------------------------------------VGLPVA     62

Query         88 VGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD--    145
d1rv9a_       63 Y---------------------------------LNQI--------------------HS     69

Query        146 ----------------TMPIVRLHG------------------------VDIALAI--CE    163
d1rv9a_       70 TVVVNAAEALGGTPDADASVD----DTGKVACAVMTADCLPVLFCDRAGTAVAAAHAGWR    125

Query        164 DLWQDG-GRVPAARSAGA--------GLLLSVNASPYERDKDD-----------------    197
d1rv9a_      126 GLA---GGVLQNTIA---AMKVPPVEMMAYL-GPAIS------ADAFEVGQDVFDAFCTP    172

Query        198 ------------------TRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDG    239
d1rv9a_      173 MPEAATAFEGIGSGKFLADLYALARLILKREG----------------------------    204

Query        240 EVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA    299
d1rv9a_      205 ------------------------------------------------------------    205

Query        300 DRL--------------------------------------    302
d1rv9a_      205 ---VGGVYGGTHCTVLERDTFFSYRRDGATGRMASLIWLDG    242


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:109.04)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWT-RHS-AEQGAH--LVAFPEMA-L--------     47
d1rv9a_        1 ----------------------KNF--LTA--DW--PAPANVKTLITTRNGGVSQGAYQS     32

Query         48 TGYP-VEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAG    106
d1rv9a_       33 LNLGTHVGD--NPEAVRRNREIVQQ-Q---------------------------------     56

Query        107 APRNAAAVLHRGRVALTFAKHHLP------------NYGVFDEFRYFVPGDTMPIV----    150
d1rv9a_       57 --------V---GLPVAYLNQIHSTVVVNAAEALGG----------TPDADASVDDTGKV     95

Query        151 --------------RLHGV-DIALAICE-DLWQDGGRVPAARSAGA----GLLLSVNASP    190
d1rv9a_       96 ACAVMTADCLPVLFCDRAGTAVAAAHAGWRGLAGGVLQNTIAAMKVPPVEMMAYLGPAIS    155

Query        191 --YER-------------------DK-------DDTRLELVRKRAQEAGC-TTAYL-AMI    220
d1rv9a_      156 ADAFEVGQDVFDAFCTPMPEAATAFEGIGSGKFLADLYALARLILKREGVGGVYGGTHCT    215

Query        221 --GG---QDELVF---------DGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEP    266
d1rv9a_      216 VLERDTFFSYRRDGATGRMASL--------------------------------------    237

Query        267 PTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1rv9a_      238 ------------IWLDG-------------------    242


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.37)
DALI match                                                                   
Query        187 NASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGD-SIVVDRDGEVVARA    245
d1rv9a_       34 NLGTHVGDNPEAVRRNREIVQQQVGLPVAYLNQIHSTVVVNAAEALGGTPDADA-SVDDT     92

DALI match                  
Query        246 PQFSEGCVVLD    256
d1rv9a_       93 GKVACAVMTAD    103



top
23: d1a4ma_ Adenosine deaminase (ADA) (svm: 0.887)

SCOP Superfamily: Metallo-​dependent hydrolases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.27  Contact: 842
Modified z-scores:
dali:0.86 daliz:0.75 gdtts:0.91 tmscore:0.94 rmsd:0.44 AHM:0.41 LBcontacta:0.81 LBcontactb:0.78 LHM:0.18
id:0.69 blosum:0.08 compass:0.11 pearson:0.95
Scaled scores:
dali:0.65 daliz:0.24 gdtts:0.40 tmscore:0.53 rmsd:0.77 AHM:0.70 LBcontacta:0.25 LBcontactb:0.34 LHM:0.46
id:-0.01 blosum:0.04 compass:0.17 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:578.10)
Query          1 ---slqLRLA----lnQIDS----------------------------------------     13
d1a4ma_        1 tpafnkPKVElhvhldGAIKpetilyfgkkrgialpadtveelrniigmdkplslpgfla     60

Query         14 --------TVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMaltgypvedLALR-------     58
d1a4ma_       61 kfdyympvIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYS--phllansKVDPmpwnqte    118

Query         59 -ssFVEASRTALRELAARLAEEGFgeLPVLVGYL----------DRSEsaqpkygqpaga    107
d1a4ma_      119 gdvTPDDVVDLVNQGLQEGEQAFG--IKVRSILCcmrhqpswslEVLE------------    164

Query        108 prnaaavlhrgRVALTFAKhhlPNYGVFDEFRYF--VPGDtmpivrlhgvdialAICE--    163
d1a4ma_      165 ----lckkynqKTVVAMDLagdETIEGSSLFPGHveAYEG------avkngihrTVHAge    214

Query        164 --------------------dLWQD---ggrvpaARSAGAgLLLSvnaspyerdkdDTRL    200
d1a4ma_      215 vgspevvreavdilktervghGYHTiedealynrLLKENM-HFEV----cpwssylTGAW    269

Query        201 E-lvrKRAQEA----GCTTAYLAMiggqdelvfdgdsivvdrdgevvarapqFSEGCV--    253
d1a4ma_      270 DpkttHAVVRFkndkANYSLNTDD--------------------------plIFKSTLdt    303

Query        254 -------------vlDLDLpaaeaepptgvvddglridRLVISEE----pLPAYeaelag    296
d1a4ma_      304 dyqmtkkdmgfteeeFKRL---------ninaakssflPEEEKKEllerlYREY------    348

Query        297 gyadrl    302
d1a4ma_      349 -----q    349


hit structure      alignment
FAST alignment (Normalized score: 2.27 Raw score:736.00)
Query          1 SLQLRLALNQIDS-----------------------------------------------     13
d1a4ma_        1 -------------TPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNII     47

Query         14 ---------------------TVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV     52
d1a4ma_       48 GMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEV----------     97

Query         53 EDLALRSS------------------------FVEASRTALRELAARLAEEGF-GELPVL     87
d1a4ma_       98 --------RYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQ---AFGIKVR    146

Query         88 VGYLDRSESAQPKYGQPAGAPRNAAAVLHRG------------------------RVALT    123
d1a4ma_      147 SI-----------------------------LCCMRHQPSWSLEVLELCKKYNQKTVVAM    177

Query        124 -------------------------------FAKHHLPNYGVFDEFRYFVPGDTMPIVRL    152
d1a4ma_      178 DLAGDETIEGSSLFPGHVEAYEGAVKNGIHRTVHA-------------------------    212

Query        153 HGVDI------------------ALAICEDLWQDGG------RVPAARSAGAGLLLSVNA    188
d1a4ma_      213 -----GEVGSPEVVREAVDILKTERVG-HGYH----TIEDEALYNRLLKEN-MHFE----    257

Query        189 SPYE------------RDKDDTRLELVRKRAQEAG--CTTAY-LAMIGGQDELVFDGDSI    233
d1a4ma_      258 ----VCPWSSYLTGAWDPKTT---HAVVRFKN---DKANYSLNTDDP-------------    294

Query        234 VVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAE    293
d1a4ma_      295 ------------------------------------------------------------    295

Query        294 LAGGYADRL---------------------------------------------------    302
d1a4ma_      295 ---------LIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLY    345

Query        303 ----    303
d1a4ma_      346 REYQ    349


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:147.29)
Query          1 -----SLQLRLA-LN---QID---------------------------------------     12
d1a4ma_        1 TPAFN--KPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGF     58

Query         13 ---S--TVG-DI--A-GNAEAILRWTRHSAEQGAHLVAFPEMALTG----YPVEDLAL-R     58
d1a4ma_       59 LAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSK--VDPMPWNQ    116

Query         59 -SSFVEASRTALRELAARLAEE-GFGELPVLVGYLDR---SESAQPKYGQPAGAPRNAAA    113
d1a4ma_      117 T-EGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQ---------PSWSLEVLELC    166

Query        114 --VLHRGRVALTFAKHHLPNYGVFDEFRYFVP--GD-TM----PIVRLHGVDIALAICED    164
d1a4ma_      167 KK--YNQKTVVAMDLAGDE-TIEGSSLFPGHVEAYEGAVKNGI----------HRTVHAG    213

Query        165 L-W---QDG--G----R--V------------P-AARSAGAGLLLSVN-ASPYERDKDDT    198
d1a4ma_      214 EVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENM-HFEVCPWSSYLTGAWDPK    272

Query        199 RLELVRKRAQEAGCTTAYLAMIGGQDELVFDGD---SIV-VD--RDGEVVA--RAPQFSE    250
d1a4ma_      273 TTHAVVRFKNDKANYSLNTDDPL------IFKSTLDTDYQMTKK--DMGFTEE-------    317

Query        251 GCVVLDLDLPAA--EAEPPTGVVDDGLRIDRLV-ISEE-PLP-AYEAELAGGYADRL    302
d1a4ma_      318 ----EFKRLNINAA---KS---------SFLPEEEKKELLERLYREYQ---------    349


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.40)
DALI match          ....      ******.....       .   ......  ...........      
Query        162 CEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIG    221
d1a4ma_      236 GYHTIEDEALYNRLLKENMHFEVCPW-SSYLTGAWDPKTTHAVVRFKNDKANYS----LN    290

DALI match               
Query        222 GQDELVFD    229
d1a4ma_      291 TDDPLIFK    298



top
24: d1k87a2 Proline dehydrohenase domain of bifunctional PutA protein (svm: 0.885)

SCOP Superfamily: FAD-​linked oxidoreductase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.15  Contact: 797
Modified z-scores:
dali:0.90 daliz:0.89 gdtts:0.92 tmscore:0.93 rmsd:0.36 AHM:0.35 LBcontacta:0.88 LBcontactb:0.79 LHM:0.19
id:0.75 blosum:0.22 compass:0.21 pearson:0.92
Scaled scores:
dali:0.70 daliz:0.37 gdtts:0.47 tmscore:0.59 rmsd:0.79 AHM:0.72 LBcontacta:0.33 LBcontactb:0.40 LHM:0.45
id:-0.01 blosum:0.05 compass:0.15 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:553.80)
Query          1 --------------slqlrLALNQIDSTVG----DIAGNAEAILRWTRHSAEQG------     36
d1k87a2        1 getiaealanarkleekgfRYSYDMLGEAAltaaDAQAYMVSYQQAIHAIGKASngrgiy     60

Query         37 aHLVAFPemALTG--ypVEDLaLRSSFVEASRTALRELAARLAeegFGELPVLVGyldrs     94
d1k87a2       61 eGPGISI--KLSAlhprYSRA-QYDRVMEELYPRLKSLTLLAR---QYDIGINID-----    109

Query         95 esaqpkygqpagaPRNAaavlhrgrVALT----------faKHHLPNygvfdefryfvpg    144
d1k87a2      110 ------aeeadrlEISL---dllekLCFEpelagwngigfvIQAYQK----------rcp    150

Query        145 DTMP----ivrlhgvDIALAICE----------------------------dlWQDGGrV    172
d1k87a2      151 LVIDylidlatrsrrRLMIRLVKgaywdseikraqmdglegypvytrkvytdvSYLAC-A    209

Query        173 PAARSAGaglllsvnaspyerdkddTRLELVRKRAQEAG------CTTAYlamiggqdel    226
d1k87a2      210 KKLLAVP---------nliypqfatHNAHTLAAIYQLAGqnyypgQYEFQ----------    250

Query        227 vfdgdsivvdrdgevvaRAPQ---------------------------------------    247
d1k87a2      251 ----------------cLHGMgeplyeqvtgkvadgklnrpcriyapvgthetllaylvr    294

Query        248 --fsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1k87a2      295 rllengantsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdly    351


hit structure      alignment
FAST alignment (Normalized score: 2.65 Raw score:863.50)
Query          1 S-----------------LQLRLALNQIDSTVG--------DIAGNAEAILRWTRHSAEQ     35
d1k87a2        1 -GETIAEALANARKLEEKGFRYSYDML------GEAALTAADAQAYMVSYQQAIHAIGK-     52

Query         36 GA----------HLVAFPE--MALTGYPVEDL-----ALRSSFVEASRTALRELAARLAE     78
d1k87a2       53 --ASNGRGIYEGPGISI--KLSALH-------PRYSRAQYDRVMEELYPRLKSLTLLARQ    101

Query         79 EGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEF    138
d1k87a2      102 ---YDIGIN---------------------------------------------------    107

Query        139 RYFVPGDTMPIVRLHGV------------------------------DIALAICEDLWQD    168
d1k87a2      108 -----------------IDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVI---QAYQK    147

Query        169 G---GRVPAARSAGA--------GLLLSVNASPYERDKD---------------------    196
d1k87a2      148 -RCPLVIDYLID---LATRSRRRLMIRL-----------VKGAYWDSEIKRAQMDGLEGY    192

Query        197 ------DTRLELVRKRAQEA------GCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVAR    244
d1k87a2      193 PVYTRKVYTDVSYLACAKK-LLAVPNLIYPQF----------------------------    223

Query        245 APQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--    302
d1k87a2      224 ----------------------------------------------------------AT    225

Query        303 ------------------------------------------------------------    303
d1k87a2      226 HNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTH    285

Query        303 ------------------------------------------------------------    303
d1k87a2      286 ETLLAYLVRRLLENGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQEGQTGLPHPKIP    345

Query        303 ------    303
d1k87a2      346 LPRDLY    351


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:144.61)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1k87a2        1 ------------------GETIAEALANARKLEEKGF--RYSY--DMLG--E--AALTAA     34

Query         61 FVEASRTALRELAARLAEEGFGEL----PVLVGYLD--RSE-----SAQPKYGQP-AGAP    108
d1k87a2       35 DAQAYMVSYQQAIHAIGK-ASNGRGIYEGPGISIKLSALHPRYSRA----QYDRVMEELY     89

Query        109 -RNA-AA-VLHRGRVALTFAKHHLPNYGVFDEFRYF-VPG-DTM----PIVRLHGVDIAL    159
d1k87a2       90 PRLKSLTLLARQ-YDIGINID--A---EEADRLEISLDLLEKLCFEPELAGW----NGIG    139

Query        160 AICE----DLW-QDGGRVPAARS-AGAGLLLSVNA-SP-Y-------------------E    192
d1k87a2      140 FVIQAYQKRCPLVIDYLIDLATRSRRR--LMIRLVKGAYWDSEIKRAQMDGLEGYPVYTR    197

Query        193 RDK-DDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEV-V-----ARA    245
d1k87a2      198 KVYTDVSYLACAKKLLAVPNLIYPQFATH-------NAHTLAAIYQLAGQNYYPGQYEFQ    250

Query        246 PQ-FSEG--C--VVLD----LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAG    296
d1k87a2      251 CLHGMGEPLYEQVTGKVADG------------------------------------KLNR    274

Query        297 GY----------------------------A----------D--RL--------------    302
d1k87a2      275 PCRIYAPVGTHETLLAYLVRRLLENGANTSFVNRIADTSLPLDELVADPVTAVEKLAQQE    334

Query        303 -----------------    303
d1k87a2      335 GQTGLPHPKIPLPRDLY    351


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.07)
DALI match                                                    
Query          1 SLQLRLALNQIDSTVGDIAGNAE----AILRWTRHSAEQGAHLVA     41
d1k87a2       64 GISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINI    108



top
25: d1ceoa_ Endoglucanase CelC (svm: 0.888)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.19  Contact: 865
Modified z-scores:
dali:0.90 daliz:0.88 gdtts:0.93 tmscore:0.94 rmsd:0.41 AHM:0.46 LBcontacta:0.92 LBcontactb:0.88 LHM:0.21
id:0.82 blosum:0.05 compass:0.34 pearson:0.95
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.45 tmscore:0.57 rmsd:0.76 AHM:0.65 LBcontacta:0.33 LBcontactb:0.44 LHM:0.40
id:0.01 blosum:0.04 compass:0.17 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:619.80)
Query          1 slqLRLA---------------------------------------LNQIDSTvGDIA--     19
d1ceoa_        1 ---MVSFkaginlggwisqyqvfskehfdtfitekdietiaeagfdHVRLPFD-YPIIes     56

Query         20 ---------gnAEAILRWTRHSAEQGAhLVAFpemALTGypvEDLALRSSFVEASRTALR     70
d1ceoa_       57 ddnvgeykedgLSYIDRCLEWCKKYNL-GLVL---DMHHapgSTLFEDPNQQKRFVDIWR    112

Query         71 ELAARLAeegFGELPVLVGYLdrsesaqpkYGQP-aGAPRnaaavlhrgRVAL-------    122
d1ceoa_      113 FLAKRYI---NEREHIAFELL----nqvvePDSTrwNKLMlecikaireIDSTmwlyigg    165

Query        123 tfAKHHlpnygvfdefryfvPGDTmpivrlhgvdiaLAICE-------------------    163
d1ceoa_      166 nnYNSP-------------dELKN--ladidddyivYNFHFynpfffthqkahwsesama    210

Query        164 ---------------------------------------dlwQDGGRVPAARSAGAgLLL    184
d1ceoa_      211 ynrtvkypgqyegieefvknnpkysfmmelnnlklnkellrkDLKPAIEFREKKKC-KLY    269

Query        185 SVNaSPYE--RDKD--DTRLELVRKRAQEagcTTAYLAMIggqdelvfdgdsivvdrdge    240
d1ceoa_      270 CGEfGVIAiaDLESriKWHEDYISLLEEY---DIGGAVWN--------------------    306

Query        241 vvarAPQFsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggYAD    300
d1ceoa_      307 ----YKKM-----------------------------------------dfeiynedRKP    321

Query        301 RL---------    302
d1ceoa_      322 VSqelvnilar    332


hit structure      alignment
FAST alignment (Normalized score: 2.94 Raw score:930.70)
Query          1 SLQ-----------------------------------------LRLALNQIDSTVGD--     17
d1ceoa_        1 ---MVSFKAGINLGGWISQYQVFSKEHFDTFITEKDIETIAEAGFDHVRLPFD-----YP     52

Query         18 -----------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYP------VEDLALRSS     60
d1ceoa_       53 IIESDDNVGEYKEDGLSYIDRCLEWCKKYN-LGLVL---------DMHHAPGSTLFEDPN    102

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ceoa_      103 QQKRFVDIWRFLAKRY--INERE-HIAFE-------------------------------    128

Query        121 ------------------------------ALTFAKHHLPNYGVFDEFRYFVPGDTMPIV    150
d1ceoa_      129 LLNQVVEPDSTRWNKLMLECIKAIREIDSTMWLYIGG-----------------------    165

Query        151 RLHGV-------------------DIALAICEDLWQDGG---------------------    170
d1ceoa_      166 -----NNYNSPDELKNLADIDDDYIVYNFH---------FYNPFFFTHQKAHWSESAMAY    211

Query        171 -----------------------------------------RVPAARSAGA------GLL    183
d1ceoa_      212 NRTVKYPGQYEGIEEFVKNNPKYSFMMELNNLKLNKELLRKDLKPAIE---FREKKKCKL    268

Query        184 LSVNASPYERDKD-----------DTRLELVRKRAQEA--GCTTAYLAMIGGQDELVFDG    230
d1ceoa_      269 YC-----------GEFGVIAIADLESRIKWHEDYISL-LEEYDIGGAV------------    304

Query        231 DSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAY    290
d1ceoa_      305 ------------------------------------------------------------    305

Query        291 EAELAGGYADRL----------------------------    302
d1ceoa_      305 ------------WNYKKMDFEIYNEDRKPVSQELVNILAR    332


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:139.56)
Query          1 SLQLRLALNQIDS---TVGDI-A-GNAEAIL-RWTRHSAEQGAHLVAFPEMALTGYPVED     54
d1ceoa_        1 -MVSFKAGINLGGWISQYQVFSKEHFDTFITEKDIETIAEAGFDHVRL---PFDY--P--     52

Query         55 L-ALRSSFVEASRTALRELAARLAEEGFG-ELPVLVGY-LDRS--ESAQPKYGQPAGA-P    108
d1ceoa_       53 II-ESDDNVGEYKEDGLSYIDRCLEWCKKYNLGLVLDMHHAPGST---L--FEDPNQQKR    106

Query        109 RN-AA--AV-LH-RGR-VALTFAKHHLPNYG--VFDEFRYFVPGD--TM-PI--VRLHGV    155
d1ceoa_      107 FVDIWRFLAKRYINEREHIAFELLNQVVEPDST----RW-NKLMLECIKAIREIDST---    158

Query        156 DIALAICE--D-L-WQDGGRVPAARSAGAGLLLSVNASPYER------------------    193
d1ceoa_      159 MWLYIGGNNYNSPDELKNLA-DI--DDDY-IVYNFHFYNPFFFTHQKAHWSESAMAYNRT    214

Query        194 -------------------------D--K-----DD-TRLELVRKRAQEAGCTTAYLAMI    220
d1ceoa_      215 VKYPGQYEGIEEFVKNNPKYSFMMELNNLKLNKELLRKDLKPAIEFREKKKCKLYCGEFG    274

Query        221 GG-------QDELVFD--GD--SI-VVDRDGEVVARAPQ----FSEGC-----------V    253
d1ceoa_      275 VIAIADLES------RIKWHEDYISLLE-EYDIGGAVWNYKKMDFEIYNEDRKPVSQEL-    326

Query        254 VLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA-DRL    302
d1ceoa_      327 -----------------------------------------VNILAR---    332


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.13)
DALI match          ****************....
Query         19 AGNAEAILRWTRHSAEQGAHLVA     41
d1ceoa_       65 EDGLSYIDRCLEWCKKYNLGLVL     87



hit structures. 
top
26: d1thfd_ Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF (svm: 0.888)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 882
Modified z-scores:
dali:0.88 daliz:0.88 gdtts:0.90 tmscore:0.92 rmsd:0.43 AHM:0.48 LBcontacta:0.92 LBcontactb:0.93 LHM:0.17
id:0.99 blosum:0.90 compass:0.48 pearson:0.95
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.46 tmscore:0.56 rmsd:0.75 AHM:0.62 LBcontacta:0.40 LBcontactb:0.61 LHM:0.45
id:0.12 blosum:0.17 compass:0.27 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:593.60)
Query          1 SLQLRLALNqidstvgdIAGN-----------aeailrwTRHSAEQGAHLVAFpemALTG     49
d1thfd_        1 MLAKRIIAC----ldvkDGRVvkgsnfenlrdsgdpvelGKFYSEIGIDELVF---LDIT     53

Query         50 ypvedlalrssfVEASRTALRELAARLAEEgfGELPVLVGYLDRsesaqpkygqpagapr    109
d1thfd_       54 -----------aSVEKRKTMLELVEKVAEQ--IDIPFTVGGGIH--------------df     86

Query        110 naaavlhrGRVA-ltFAKHhlpnygvfdefryfvpGDTM------pivrlhgvDIALAIC    162
d1thfd_       87 etaselilRGADkvsINTA---------------aVENPslitqiaqtfgsqaVVVAIDA    131

Query        163 E----------------dlwqDGGRVPAARSAGAGLLLSVNA--SPYErdkddtRLELVR    204
d1thfd_      132 KrvdgefmvftysgkkntgilLRDWVVEVEKRGAGEILLTSIdrDGTK---sgyDTEMIR    188

Query        205 KRAQEAGCTTAYLAmiggqdelvfdgdsivvdrdgeVVARapqfsegcvvldldlpaaea    264
d1thfd_      189 FVRPLTTLPIIASG-------------gagkmehflEAFL--------------------    215

Query        265 epptgvvddglridrlviseeplpayeAELA-----ggyadrl    302
d1thfd_      216 -----agadaalaasvfhfreidvrelKEYLkkhgvnvrlegl    253


hit structure      alignment
FAST alignment (Normalized score: 3.10 Raw score:856.60)
Query          1 SLQLRLALNQIDSTVGDIA------------------GNAEAILRWTRHSAEQGAHLVAF     42
d1thfd_        1 -MLAKRIIACLDV------KDGRVVKGSNFENLRDSGDPVELGKFYSE----IGIDELVF     49

Query         43 PEMALTGYPVEDLALR------SSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSES     96
d1thfd_       50 ----------------LDITASVEKRKTMLELVEKVAEQ------IDIPFTVGGGIH---     84

Query         97 AQPKYGQPAGAPRNAAAVLHRG-----------RVALTFAKHHLPNYGVFDEFRYFVPGD    145
d1thfd_       85 ----------------------DFETASELILRGADKVSI--------------------    102

Query        146 TMPIVRLHG---------------------VDIALAICEDLWQDG---------------    169
d1thfd_      103 ---------NTAAVENPSLITQIAQTFGSQAVVVAID--------AKRVDGEFMVFTYSG    145

Query        170 ---------GRVPAARSAGAGLLLSVNASPYERDKDDT----------RLELVRKRAQEA    210
d1thfd_      146 KKNTGILLRDWVVEVEKRGAGEILLTS-----------IDRDGTKSGYDTEMIRFVRPLT    194

Query        211 GCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGV    270
d1thfd_      195 TLPIIA------------------------------------------------------    200

Query        271 VDDGLRIDRLVISEEPLPAYEAELAGGYADRL----------------------------    302
d1thfd_      201 --------------------------------SGGAGKMEHFLEAFLAGADAALAASVFH    228

Query        303 -------------------------    303
d1thfd_      229 FREIDVRELKEYLKKHGVNVRLEGL    253


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:140.00)
Query          1 SLQLRLALNQIDSTVGDIAGNA-----------EAILRWTRHSAEQGAHLVAFPEMALTG     49
d1thfd_        1 MLA-KRIIACL-DV--KDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELVF---LDIT     53

Query         50 YPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPR    109
d1thfd_       54 --A---S----V--EKRKTMLELVEKVAE-QI-DIPFTVGGGIHDFE-------------     87

Query        110 NAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD-TM--PI--VRLHGVDIALAICED    164
d1thfd_       88 -TASELILRGADKVSINTAA------------VENPSLITQIAQTFGS---QAVVVAIDA    131

Query        165 -------LW------------QDGGRVPAARSAGAGLLLSVNASPYERD-KDDTRLELVR    204
d1thfd_      132 KRVDGEFMVFTYSGKKNTGILLRDW-VVEVEKRGA-GEILLTSIDRDGTK-SGYDTEMIR    188

Query        205 KRAQEAGCTTAYLAMIGGQDELVFDGD---SIV-VDRDGEVVARAPQFS-E-G-C-V--V    254
d1thfd_      189 FVRPLTTLPIIASG----------GAGKMEHFLEAF-LAGADAALAASVFHFREIDVREL    237

Query        255 L---D---LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAEL--AGGYADRL    302
d1thfd_      238 KEYLKKHGVN--------------------------------VRLEGL--------    253


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.35)
DALI match                                                                   
Query        147 MPIVRLHGVDIALAICEDLW----QDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLEL    202
d1thfd_        7 IACLDVKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRK-TMLEL     65

DALI match                     
Query        203 VRKRAQEAGCTTAY    216
d1thfd_       66 VEKVAEQIDIPFTV     79



top
27: d1sr9a2 2-​isopropylmalate synthase LeuA,​ catalytic domain (svm: 0.666)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.24  Contact: 1036
Modified z-scores:
dali:0.91 daliz:0.86 gdtts:0.91 tmscore:0.94 rmsd:0.47 AHM:0.50 LBcontacta:0.92 LBcontactb:0.92 LHM:0.17
id:0.88 blosum:0.11 compass:0.07 pearson:0.91
Scaled scores:
dali:0.65 daliz:0.29 gdtts:0.38 tmscore:0.51 rmsd:0.72 AHM:0.63 LBcontacta:0.33 LBcontactb:0.48 LHM:0.47
id:0.02 blosum:0.06 compass:0.14 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:640.80)
Query          1 ---------slqLRLALN--qidSTVGDIaGNAEAILRWTRHSAEQGAHLVAfpemaltg     49
d1sr9a2        1 rtwpdrvidrapLWCAVDlrdgnQALIDP-MSPARKRRMFDLLVRMGYKEIE--------     51

Query         50 ypvedlalrssfveaSRTALRELAARLAEEGFGE--LPVLVGyldrsesaqpkygqpaga    107
d1sr9a2       52 ----------vgfpsASQTDFDFVREIIEQGAIPddVTIQVL----------------tq     85

Query        108 prnaaavlhrGRVA------ltFAKHHLPNygvfdEFRYFV------pGDTM--------    147
d1sr9a2       86 crpeliertfQACSgapraivhFYNSTSIL-----QRRVVFranraevQAIAtdgarkcv    140

Query        148 ----pivrlHGVDIALAICED-lWQDG--GRVPAARSAG------aGLLLSV-NASPYEr    193
d1sr9a2      141 eqaakypgtQWRFEYSPESYTgtELEYakQVCDAVGEVIaptperpIIFNLPaTVEMTT-    199

Query        194 dkdDTRLELVRKRAQEAG----CTTAYLAMIggqdelVFDGD-sivvdrdGEVVarapqf    248
d1sr9a2      200 --pNVYADSIEWMSRNLAnresVILSLHPHN-----dRGTAVaaaelgfaAGADriegcl    252

Query        249 SEGCvvldldlpaaeaepptgvvddglridrlviseeplpayEAEL--------------    294
d1sr9a2      253 FGNG------------------ertgnvclvtlglnlfsrgvDPQIdfsnideirrtvey    294

Query        295 --------aggyadrl    302
d1sr9a2      295 cnqlpvherhpyggdl    310


hit structure      alignment
FAST alignment (Normalized score: 2.44 Raw score:746.00)
Query          1 SL-----------QLRLALNQIDSTVGDIAG--------------NAEAILRWTRHSAEQ     35
d1sr9a2        1 --RTWPDRVIDRAPLWCA-------------VDLRDGNQALIDPMSPARKRRMFDLLVRM     45

Query         36 GAHLVAFPEMALTGYPVEDLALRSSF------VEASRTALRELAARLAEEG----FGELP     85
d1sr9a2       46 GYKEIE--------------------VGFPSASQTDFDFVREIIE------QGAIPDDVT     79

Query         86 VLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV-------------------ALTFAK    126
d1sr9a2       80 IQVLT------------------------------QCRPELIERTFQACSGAPRAIVHFY    109

Query        127 HHLPNYGVF-----DEFRYFVPGDTMPIVRLHGV--------------------------    155
d1sr9a2      110 ---------NSTSILQRRV---------------VFRANRAEVQAIATDGARKCVEQAAK    145

Query        156 -----DIALAICEDLWQ---------DGGRVPAARSAGA----------GLLLSVNA--S    189
d1sr9a2      146 YPGTQWRFEY-------SPESYTGTELEYAKQVCDA---VGEVIAPTPERPIIFNL-PAT    194

Query        190 PYERDKD---DTRLELVRKRAQEAG----CTTAYLAMIGGQDELVFDGDSIVVDRDGEVV    242
d1sr9a2      195 VEM----TTPNVYADSIEWMSRNLANRESVILSLHPH-----------------------    227

Query        243 ARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1sr9a2      228 ------------------------------------------------------------    228

Query        303 ------------------------------------------------------------    303
d1sr9a2      228 NDRGTAVAAAELGFAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDE    287

Query        303 -----------------------    303
d1sr9a2      288 IRRTVEYCNQLPVHERHPYGGDL    310


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:146.75)
Query          1 ---------SLQLRLALNQI---DSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALT     48
d1sr9a2        1 RTWPDRVID--RAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEV---GFP     55

Query         49 GYPVEDLALRSSFVEASRTALRELAARLA-EEGFGE-LPVLVGYLDRSESAQPKYGQPAG    106
d1sr9a2       56 -------------S--ASQTDFDFVREIIEQGAIPDDVTIQVLTQCRPE-----------     89

Query        107 APR-NAAA-VLHRGRVALTFAKHHLPNYGVFDEFRY----F-VPG-D-TM-PI--V----    150
d1sr9a2       90 -LIE-RTFQACSGAPRAIVHFYNSTSILQRRVVFRANRAEVQAIATDGARKCVEQAAKYP    147

Query        151 --RLHGVDIALAICEDL--W----QDGGRVPAAR--SAGA--GLLLSVNASPYERDKDDT    198
d1sr9a2      148 GT----QWRFEYSPESYTGTELEYAKQVCDAVGEVIAPTPERPIIFNLPATVEM-TTPNV    202

Query        199 RLELVRKRAQEA--GC--TTAYLAMIGGQDELVFDGD-SIV-VDRDGEVVAR-A--PQ--    247
d1sr9a2      203 YADSIEWMSRNLANRESVILSLHPHN-----DRGTAVAAAELGF-AAGADRIEGCLFGNG    256

Query        248 --FSE-GCV-VL-------DLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAG    296
d1sr9a2      257 ERTGNVCLVTLGLNLFSRG------------------------------------VDPQI    280

Query        297 -----------------------GYAD-----RL    302
d1sr9a2      281 DFSNIDEIRRTVEYCNQLPVHER--HPYGGDL--    310


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.34)
DALI match                                                     
Query         17 DIAGNAEAILRWTRHSAEQGAH------LVAFPEMALTGYPVEDLA     56
d1sr9a2      124 NRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTELEYAK    169



top
28: d1i60a_ Hypothetical protein IolI (svm: 0.887)

SCOP Superfamily: Xylose isomerase-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.18  Contact: 762
Modified z-scores:
dali:0.90 daliz:0.86 gdtts:0.92 tmscore:0.94 rmsd:0.44 AHM:0.46 LBcontacta:0.93 LBcontactb:0.89 LHM:0.17
id:0.96 blosum:0.51 compass:0.26 pearson:0.95
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.42 tmscore:0.54 rmsd:0.77 AHM:0.69 LBcontacta:0.35 LBcontactb:0.47 LHM:0.50
id:0.06 blosum:0.12 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:523.80)
Query          1 ---------------------------------------------------------sLQ      3
d1i60a_        1 mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthHI     60

Query          4 LRLALNQIDS----tvgDIAGNAEAILRWTRHSAEQGAhLVAFPEMaltGYPVEDLaLRS     59
d1i60a_       61 KPLALNALVFfnnrdekGHNEIITEFKGMMETCKTLGV-KYVVAVP---LVTEQKI-VKE    115

Query         60 SFVEASRTALRELAARLaeEGFGeLPVLVGyldrsesaqpkygqpagaPRNA--aavlhr    117
d1i60a_      116 EIKKSSVDVLTELSDIA--EPYG-VKIALE----------fvghpqctVNTFeqayeivn    162

Query        118 gRVAL------tfaKHHLpnygvfdefryfVPGDT------mPIVRlhgvdiaLAICE--    163
d1i60a_      163 tVNRDnvglvldsfHFHA------------MGSNIeslkqadGKKI------fIYHIDdt    204

Query        164 ------------------dlWQDGGRVPAARSAGAGLLLSvnaSPYE--RDKD--DTRLE    201
d1i60a_      205 edfpigfltdedrvwpgqgaIDLDAHLSALKEIGFSDVVS-veLFRPeyYKLTaeEAIQT    263

Query        202 LVRKRAQEAGcttaylamiggqdelvfdgdsivvdrdgevvarapqfsegcvvldldlpa    261
d1i60a_      264 AKKTTVDVVS--------------------------------------------------    273

Query        262 aeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1i60a_      274 ------------------------------------kyfsm    278


hit structure      alignment
FAST alignment (Normalized score: 2.04 Raw score:591.90)
Query          1 SLQLRLALNQIDSTVG--------------------------------------------     16
d1i60a_        1 ----------------MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLK     44

Query         17 ---------------------------------DIAGNAEAILRWTRHSAEQGAHLVAFP     43
d1i60a_       45 DHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVA-    103

Query         44 EMALTGYPVEDLALRSS---------FVEASRTALRELAARLAEEGF----GELPVLVGY     90
d1i60a_      104 -----------------VPLVTEQKIVKEEIKKSSVDVLTELSD---IAEPYGVKIAL--    141

Query         91 LDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIV    150
d1i60a_      142 ------------------------------------------------------------    142

Query        151 RLHGVDIALAICEDLWQD------------------------------------------    168
d1i60a_      142 ------------------EFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGS    183

Query        169 --------------------------------------------GGRVPAARSAG-AGLL    183
d1i60a_      184 NIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVV    243

Query        184 LSVNASPYERDKD---------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIV    234
d1i60a_      244 SVELFR-------PEYYKLTAEEAIQTAKKTTVDV-------------------------    271

Query        235 VDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAEL    294
d1i60a_      272 ------------------------------------------------------------    272

Query        295 AGGYADRL-------    302
d1i60a_      272 --------VSKYFSM    278


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:132.07)
Query          1 SLQLRLALNQI--DS---------------------TVGDIAGNAEAIL----R-WTR-H     31
d1i60a_        1 ---MKLCFNEATTLENSNLKLDLELCEKHGYDYIEI---RTMDKLPEYLKDHSLDDLAEY     54

Query         32 SAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYL     91
d1i60a_       55 FQTHHIKPLALN-A-LV---FF-NNRDEKGHNEIITEFKGMMETCK-T-L--GVKYVVAV    104

Query         92 DR------SESAQPKYGQPAGAPR-NA--AAV-LHRGRVALTFAKHHLPNYGVFDEFR--    139
d1i60a_      105 PLVTEQKI------VKEEIKKSSVDVLTE-LSDIAEPYGVKIALEF-VG--HPQCTVNTF    154

Query        140 -YFVPGD-TM--PIVR-LHGVDIALAIC--EDL--WQ-DGGRVPAARSAGAGLLLSVNA-    188
d1i60a_      155 E--QAYEIVNTVNRDNV------GLVLDSFHFHAMGSNIESLKQADG-K-K-IFIYHIDD    203

Query        189 ---------SPYERDK-DDTRLELVRKRAQEAG---CT-TAYLAMIGGQDELVFD-----    229
d1i60a_      204 TEDFPIGFLTDEDRVWPGQGA-IDLDAHLSALKEIGFSDVVSVELFRP----EYYKLTAE    258

Query        230 -G---DS--IV-VDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVI    282
d1i60a_      259 EAIQTAKKTTVDVVSKYF----------------SM------------------------    278

Query        283 SEEPLPAYEAELAGGYADRL    302
d1i60a_      279 --------------------    279


hit structure      alignment
HHsearch alignment (Probability: 0.22 E-value:0.01)
DALI match       ........     ..   *********************........   .....     
Query          4 LRLALNQI-----DSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1i60a_       60 IKPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVK-----    114

DALI match       ******************. .   .*****
Query         59 SSFVEASRTALRELAARLAEEGFGELPVLV     88
d1i60a_      115 EEIKKSSVDVLTELSDIAEPY---GVKIAL    141



top
29: d1l6sa_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) (svm: 0.892)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.26  Contact: 1005
Modified z-scores:
dali:0.89 daliz:0.87 gdtts:0.92 tmscore:0.94 rmsd:0.43 AHM:0.47 LBcontacta:0.90 LBcontactb:0.86 LHM:0.14
id:0.94 blosum:0.15 compass:0.15 pearson:0.91
Scaled scores:
dali:0.69 daliz:0.33 gdtts:0.45 tmscore:0.57 rmsd:0.75 AHM:0.67 LBcontacta:0.34 LBcontactb:0.44 LHM:0.53
id:0.05 blosum:0.05 compass:0.17 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:632.60)
Query          1 ------------------------------------------------------------      1
d1l6sa_        1 tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl     60

Query          1 --------slqlRLALNQIDS--tvGDIAGNA---EAILRWTRHSAE--QGAHlVAFPem     45
d1l6sa_       61 areierianagiRSVMTFGIShhtdETGSDAWredGLVARMSRICKQtvPEMI-VMSD-t    118

Query         46 ALTG--------ypveDLALrssfVEASRTALRELAARLAEEgfgeLPVLVGYLDRsesa     97
d1l6sa_      119 CFCEytshghcgvlxeHGVD----NDATLENLGKQAVVAAAA--gaDFIAPSAAMD----    168

Query         98 qpkygqpagaprnaaavLHRGR---------valtFAKHHLP----------nygvFDEF    138
d1l6sa_      169 ------------gqvqaIRQALdaagfkdtaimsySTKFASSfygpfreaagsalkGDRK    216

Query        139 rYFVP--------gDTMPivrlhgvdIALAICeDLWQDGGrVPAARS-AGAGLLLS--vn    187
d1l6sa_      217 -SYQMnpmnrreaiRESLldeaqgadCLMVKP-AGAYLDI-VRELRErTELPIGAYqvsg    273

Query        188 aSPYE-------RDKD-DTRLELVRKRAQEAgCTTAYlamiggqdelvfdgdsivvdrdg    239
d1l6sa_      274 eYAMIkfaalagAIDEeKVVLESLGSIKRAG-ADLIF----------------------s    310

Query        240 eVVARapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelagGYA    299
d1l6sa_      311 yFALD---------------------------------------------------lAEK    319

Query        300 DR-l    302
d1l6sa_      320 KIlr    323


hit structure      alignment
FAST alignment (Normalized score: 2.69 Raw score:840.40)
Query          1 SLQ----------------------------LRLALNQIDSTVGDIAG------------     20
d1l6sa_        1 ---TDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVE--------EEIDDYKAVEAM     49

Query         21 ------NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSF-----------VE     63
d1l6sa_       50 PGVMRIPEKHLAREIERIANAGIRSVM--------------------TFGISHHTDETGS     89

Query         64 ASR---TALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG--    118
d1l6sa_       90 DAWREDGLVARMSRICKQ-TVPEMIVMSD-----------------------------TC    119

Query        119 -------------------------------------RVALTFAK---------------    126
d1l6sa_      120 FCEYTSHGHCGVLXEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD    179

Query        127 --------------HHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGG--    170
d1l6sa_      180 AAGFKDTAIMSYSTKFAS----------------------------------------SF    199

Query        171 -------------------------------RVPAARSAGAGLLLSVNASPYERDKDDT-    198
d1l6sa_      200 YGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQGADCLMV-------------K    246

Query        199 ----RLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVV    254
d1l6sa_      247 PAGAYLDIVRELRERTELPIGAY-------------------------------------    269

Query        255 LDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL------------    302
d1l6sa_      270 ------------------------------------------------QVSGEYAMIKFA    281

Query        303 ------------------------------------------    303
d1l6sa_      282 ALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR    323


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:141.00)
Query          1 ---------------------------SLQL-----------------------------      4
d1l6sa_        1 TDLIQRPRRLRKSPALRAMFEETTLSL--NDLVLPIFVEEEIDDYKAVEAMPGVMRIPEK     58

Query          5 -------------RLALNQIDSTVGD---IAGNA---EAILRWTRHSAE-QGAHLVAFPE     44
d1l6sa_       59 HLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSD-    117

Query         45 MALTGYPVEDLA-LRS--SFV-EASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d1l6sa_      118 TCFCEYTSHGHCGVLXEHGVDNDATLENLGKQAVVAAAA-G--ADFIAPSAAMDG-----    169

Query        101 YGQPAGAPR-NAAAV-LHR-G-R--VAL-TFAKHHLPNYGVF-----------DEFRYFV    142
d1l6sa_      170 --------QV-QAIRQALDAAGFKDTAIMSYSTKFAS-SFYGPFREAAGSALKGDRKSYQ    219

Query        143 P-------G--DTM-PIV-RLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASP-    190
d1l6sa_      220 MNPMNRREAIRESLLDEAQ-G---ADCLMVKPAGAYLDIVRELRERTEL-PIGAYQVSGE    274

Query        191 -YE--RDK----D-D--TRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1l6sa_      275 YAMIKFAALAGAIDEEKVVLESLGSIKRAG-ADLIFS-------------YF--------    312

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1l6sa_      313 ---ALD-------------------------------------------------LAEKK    320

Query        301 R--L    302
d1l6sa_      321 ILR-    323


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.01)
DALI match                                       
Query         10 QIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA     41
d1l6sa_      219 QMNPM------NRREAIRESLLDEAQGADCLM    244



top
30: d1sgja_ Citrate lyase,​ beta subunit (svm: 0.888)

SCOP Superfamily: Phosphoenolpyruvate/​pyruvate domain  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.27  Contact: 828
Modified z-scores:
dali:0.87 daliz:0.85 gdtts:0.94 tmscore:0.94 rmsd:0.41 AHM:0.40 LBcontacta:0.89 LBcontactb:0.88 LHM:0.14
id:0.98 blosum:0.41 compass:0.23 pearson:0.93
Scaled scores:
dali:0.70 daliz:0.34 gdtts:0.50 tmscore:0.60 rmsd:0.78 AHM:0.70 LBcontacta:0.34 LBcontactb:0.49 LHM:0.54
id:0.06 blosum:0.08 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:532.30)
Query          1 slqlrLALNqidstvgdiagNAEAILRwTRHSAeqgahLVAFpemALTGypvedlALRSS     60
d1sgja_        1 ppallRSVL------fapgnRADLIAK-LPRSA----pDAVV--iDLED----avPGTAE     43

Query         61 FVEASRTALRELAARLAEEgFGELPVLVGYLdrsesaqpkygqpagAPRNaaavlhrgRV    120
d1sgja_       44 AKAAARPVAHDAARDLIAA-APHLAVFVRVN------------alhSPYF--eddlsvLT     88

Query        121 AL----tfaKHHLPnygvfdefryfvpgDTMP--ivrlhgvdIALAICE--dLWQD-gGR    171
d1sgja_       89 PElsgvvvpKLEMG-----------aeaRQVAqmlqerslplPILAGLEtgaGVWNarEI    137

Query        172 VPAArsagagLLLSvNASP---------YERDKD--DTRLELVRKRAQEAgCTTAYLAMI    220
d1sgja_      138 MEVP----evAWAY-FGAEdyttdlggkRTPGGLevLYARSQVALAARLT-GVAALDIVV    191

Query        221 GGqdelvfdgdsivvdrdgevvarapqfsEGCVvldldlpaaeaepptgvvddglridrl    280
d1sgja_      192 TAlndpetfradaeqgralgysgklcihpAQVA---------------------------    224

Query        281 viseeplpayeaeLAGGyadrl    302
d1sgja_      225 ----------lahEYFG-----    231


hit structure      alignment
FAST alignment (Normalized score: 2.79 Raw score:737.60)
Query          1 SLQ-----LRLALNQIDSTVGDIAG----NAEAILRWTRHSAEQGAHLVAFPEMALTGYP     51
d1sgja_        1 ---PPALLRSVLF------------APGNRADLIA----KLPRSAPDAVVI---------     32

Query         52 VEDL------ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA    105
d1sgja_       33 ----DLEDAVPGTAEAKAAARPVAHDAARDLIA-AAPHLAVFVR----------------     71

Query        106 GAPRNAAAVLHRG------------------RVAL-TFAKHHLPNYGVFDEFRYFVPGDT    146
d1sgja_       72 -------------VNALHSPYFEDDLSVLTPELSGVVVPK--------------------     98

Query        147 MPIVRLH--------------------GVDIALAICEDLWQDGGRVPAARSA--------    178
d1sgja_       99 -------LEMGAEARQVAQMLQERSLPLPILAGLET----------------GAGVWNAR    135

Query        179 ------GAGLLLSVNASPYERDKD--------------------DTRLELVRKRAQEAGC    212
d1sgja_      136 EIMEVPEVAWAYF-----------GAEDYTTDLGGKRTPGGLEVLYARSQVALAARLTGV    184

Query        213 TTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVD    272
d1sgja_      185 AAL---------------------------------------------------------    187

Query        273 DGLRIDRLVISEEPLPAYEAELAGGYADRL------------------------------    302
d1sgja_      188 ------------------------------DIVVTALNDPETFRADAEQGRALGYSGKLC    217

Query        303 --------------    303
d1sgja_      218 IHPAQVALAHEYFG    231


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:139.91)
Query          1 -SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1sgja_        1 P--PALLRSVLFAP---GNR--ADLIAKLPRSAP---D--AVV--IDLEDA-V--PGTA-     42

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRN-AA-AVLHR    117
d1sgja_       43 EAKAAARPVAHDAARDLIAA-APHLAVFVRVNA-L------H-S---PYFEDDLSVLTPE     90

Query        118 GRVALTFAK-HHL--PNYGVFDEFRYFVPG-DTMP-I------VRLHGVDIALAICEDLW    166
d1sgja_       91 --LSGVVVPKLEMGA-------------EARQVAQMLQERSLP------LPILAGLETGA    129

Query        167 Q-DGGRVPAARSAGAGLLLSVNASP-------YERDKDDTRLELVRKRAQEA-G-C-TTA    215
d1sgja_      130 GVWNA-REIMEVPEV-AWAYFGAEDYTTDLGGKRTPGGLEVLYARSQVALAARLTGVAAL    187

Query        216 YLAMIGG----QDELVFDG--DS-IVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPT    268
d1sgja_      188 DIVVTALNDPE------TFRADAEQGRA--LGYSGKLCIHPAQVALA-------------    226

Query        269 GVVDDGLRIDRLVISEEPLPAYEAELAGGY-ADRL    302
d1sgja_      227 --------------------------HEYFG----    231


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.03)
DALI match       . .....    .....
Query         27 RWTRHSAEQGAHLVAF     42
d1sgja_       17 DLIAKLPRSAPDAVVI     32



hit structures. 
top
31: d1bqca_ Beta-​mannanase (svm: 0.885)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.08  Contact: 920
Modified z-scores:
dali:0.85 daliz:0.85 gdtts:0.84 tmscore:0.88 rmsd:0.46 AHM:0.44 LBcontacta:0.89 LBcontactb:0.83 LHM:0.19
id:0.98 blosum:0.67 compass:0.49 pearson:0.94
Scaled scores:
dali:0.70 daliz:0.33 gdtts:0.39 tmscore:0.50 rmsd:0.74 AHM:0.68 LBcontacta:0.36 LBcontactb:0.45 LHM:0.43
id:0.09 blosum:0.13 compass:0.15 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:545.60)
Query          1 ------------------------------------------------------------      1
d1bqca_        1 atglhvkngrlyeangqefiirgvshphnwypqhtqafadikshgantvrvvlsngvrws     60

Query          1 ---------------sLQLRLALNQID-STVG--diaGNAEAILRWTRH---sAEQG--A     37
d1bqca_       61 kngpsdvanvislckqNRLICMLEVHDtTGYGeqsgaSTLDQAVDYWIElksvLQGEedY    120

Query         38 HLVAFpeMALTgYPVEdlalrsSFVEASRTALRELAARLAEEGFgELPVLVGYLdrsesa     97
d1bqca_      121 VLINI-gNEPY-GNDS------ATVAAWATDTSAAIQRLRAAGF-EHTLVVDAP------    165

Query         98 qpkygqpagaPRNAaavlhrgrvaltfakhhlpnygvfdefryfvpgdtmpivrlhgvdi    157
d1bqca_      166 ----nwgqdwTNTM-----------------------------rnnadqvyasdptgntv    192

Query        158 aLAICE----dlWQDGGRVPAARSAGaglLLSVN-aspYERDkddtRLELVRKRAQEAgC    212
d1bqca_      193 fSIHMYgvysqaSTITSYLEHFVNAG-lpLIIGEfghdHSDG--npDEDTIMAEAERL-K    248

Query        213 TTAY--------------lamiggqdelvfdgdsivvdrdGEVVarapqfsegcvvldld    258
d1bqca_      249 LGYIgwswsgngggveyldmvynfdgdnlspwgerifygpNGIA----------------    292

Query        259 lpaaeaepptgvvddglridrlviseeplPAYEaelaggyadrl    302
d1bqca_      293 -----------------------stakeaVIFG-----------    302


hit structure      alignment
FAST alignment (Normalized score: 2.42 Raw score:729.40)
Query          1 ---------------SLQLRLALNQIDSTVGDIAG----------NAEAILRWTRHSAEQ     35
d1bqca_        1 ATGLHVKNGRLYEANGQEFI---------------IRGVSHPHNWYPQH-TQAFADIKSH     44

Query         36 GAHLVAFPEMALTGYPVEDLALRSSFVEA-----------SRTALRELAARLAEEGFGEL     84
d1bqca_       45 GANTVRV----------------------VLSNGVRWSKNGPSDVANVISLCKQ---NRL     79

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDE-------    137
d1bqca_       80 ICML-------------------------------------------------EVHDTTG     90

Query        138 ---FRYFVPGDTMPIVRLHGV---------------------DIALAICEDLWQDG----    169
d1bqca_       91 YGEQSGAST------------LDQAVDYWIELKSVLQGEEDYVLINI---------GNEP    129

Query        170 ----------------GRVPAARSAGA-GLLLSVNASPYERDK--------DDTRLELVR    204
d1bqca_      130 YGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVD---------APNWGQDWTNTMRNNAD    180

Query        205 KRAQEAG-CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE    263
d1bqca_      181 QVYASDPTGNTVFSIHM-------------------------------------------    197

Query        264 AEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL---------------------    302
d1bqca_      198 ---------------------------------------YGVYSQASTITSYLEHFVNAG    218

Query        303 ------------------------------------------------------------    303
d1bqca_      219 LPLIIGEFGHDHSDGNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLS    278

Query        303 ------------------------    303
d1bqca_      279 PWGERIFYGPNGIASTAKEAVIFG    302


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:146.84)
Query          1 ---------------SLQLRLALNQID-ST-----------------------V---GDI     18
d1bqca_        1 ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWS     60

Query         19 AGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFV-EASRTALRELAARLA     77
d1bqca_       61 KNGPSDVANVISLCKQNRL-ICML---EVHDTTGYGEQSGA-STLDQAVDYWIELKSVLQ    115

Query         78 EEGFGELPVLVGYLDRS--ESAQPKYGQPAGAPR-NAA-AV--LH--RGRVALTFAKHHL    129
d1bqca_      116 --GEEDYVLINIGNEPYGN------DSATVAAWATDTSAAIQRLRAAGFEHTLVVDAP-N    166

Query        130 PNYGVFDEFRYFVPG--DTM-PIV----RLHGVDIALAICED-LW----QDGGRVPAARS    177
d1bqca_      167 -----WGQDW-TNTMRNNADQVYASDPT----GNTVFSIHMYGVYSQASTITSYLEHFVN    216

Query        178 AGAGLLLSVNASPYERD-KDDTRLELVRKRAQEAGCTTAYLAMI-GGQDELV-FDG----    230
d1bqca_      217 AGL-PLIIGEFGHDHSDG-NPDEDTIMAEAER--LKLGYIGWSWSGNGGGVEYLDMVYNF    272

Query        231 --------D-SIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLV    281
d1bqca_      273 DGDNLSPWGERIFY---GPNGIAS-------TAKEA------------------------    298

Query        282 ISEEPLPAYEAELAGGYADRL    302
d1bqca_      299 --------VIFG---------    302


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.10)
DALI match                                                            
Query        166 WQDG--GRVPAARSAGAGLLLSVNASPY-ERDKDDTRLELVRKRAQEAGCTTA    215
d1bqca_       30 WYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICM     82



top
32: d1b5ta_ Methylenetetrahydrofolate reductase (svm: 0.889)

SCOP Superfamily: FAD-​linked oxidoreductase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 757
Modified z-scores:
dali:0.87 daliz:0.86 gdtts:0.90 tmscore:0.92 rmsd:0.41 AHM:0.41 LBcontacta:0.90 LBcontactb:0.92 LHM:0.21
id:0.75 blosum:0.07 compass:0.12 pearson:0.90
Scaled scores:
dali:0.68 daliz:0.35 gdtts:0.44 tmscore:0.55 rmsd:0.76 AHM:0.67 LBcontacta:0.35 LBcontactb:0.56 LHM:0.43
id:-0.00 blosum:0.02 compass:0.16 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:553.70)
Query          1 slqLRLALnqidstvgDIAGNAEAILRWTRHSAEQGAHLVafpemaltgypvedlalrss     60
d1b5ta_        1 gqiNVSFE----ffppRTSEMEQTLWNSIDRLSSLKPKFV---------------svtyg     41

Query         61 fVEASRTALRELAARLAEEgFGELPVlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1b5ta_       42 aNSGERDRTHSIIKGIKDR-TGLEAA----------------------------------     66

Query        121 ALTFA------------------khhlpnygvfdEFRY---fvpGDTM----pivrlhGV    155
d1b5ta_       67 PHLTCidatpdelrtiardywnngirhivalrgdLPPGsgkpemYASDlvtllkevadFD    126

Query        156 DIALAiceDLWQ------DGGRVPAARSAG---AGLLLSVNaspyerdkddTRLELVRKR    206
d1b5ta_      127 ISVAA---YPEVhpeaksAQADLLNLKRKVdagANRAITQF---------fFDVESYLRF    174

Query        207 AQEAG-----CTTAYLAM-IGGQdeLVFD-------------------------------    229
d1b5ta_      175 RDRCVsagidVEIIPGILpVSNF--KQAKkfadmtnvripawmaqmfdgldddaetrklv    232

Query        230 ----gdsivvdrdgEVVA----rapqfsEGCVvldldlpaaeaepptgvvddglridrlv    281
d1b5ta_      233 ganiamdmvkilsrEGVKdfhfytlnraEMSY----------------------------    264

Query        282 iseeplpayeaELAGgyadrl    302
d1b5ta_      265 -------aichTLGV---rpa    275


hit structure      alignment
FAST alignment (Normalized score: 3.37 Raw score:972.20)
Query          1 SLQLRLALNQIDSTVGD-----IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL     55
d1b5ta_        1 GQINVSFE---------FFPPRTSEMEQTLWNSIDRLSSLKPKFVSV-------------     38

Query         56 ALRSSF----VEASRTALRELAARLAEEGF-GELPVLVGYLDRSESAQPKYGQPAGAPRN    110
d1b5ta_       39 ------TYGANSGERDRTHSIIKGIKD---RTGLEAAP----------------------     67

Query        111 AAAVLHRG----------------------RVALTFAKHHLPNYGVFDEFRY--------    140
d1b5ta_       68 --------HLTCIDATPDELRTIARDYWNNGIRH------------------IVALRGDL    101

Query        141 ---FVPGDTMPIVRLH-------------GVDIALAICEDLWQD-----------GGRVP    173
d1b5ta_      102 PPGSGKPEMY------ASDLVTLLKEVADFDISVAA--------YPEVHPEAKSAQADLL    147

Query        174 AARS---AGAGLLLSVNASPYERDKD------DTRLELVRKRAQ-EAGCTTAYLAMIGGQ    223
d1b5ta_      148 NLKRKVDAGANRAIT-----------QFFFDVESYLRFRDRCVSAGIDVEIIPGILPV--    194

Query        224 DELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVIS    283
d1b5ta_      195 ------------------------------------------------------------    195

Query        284 EEPLPAYEAELAGGYADRL-----------------------------------------    302
d1b5ta_      195 -------------------SNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGAN    235

Query        303 ----------------------------------------    303
d1b5ta_      236 IAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPA    275


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:138.86)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1b5ta_        1 --GQINVSFEF-FP-PRTSEMEQTLWNSIDRLSSLKPKFVSV--T-YG-------A----     42

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAG----APRNAA-AVL    115
d1b5ta_       43 -NSGERDRTHSIIKGIKDRTG--LEAAPHLTCIDATPD-------ELRTI-----AR-DY     86

Query        116 HRGRVALTFAKHHLPNYGVFDEFRYF-VPG-DTM--PI--VRLHGVDIALAICEDLW---    166
d1b5ta_       87 WNNGIRHIVALRGDL----PPGSGKPEMYASDLVTLLKEVAD----FDISVAAYPEVHPE    138

Query        167 ------QDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQ-EAGCTTAYLAM    219
d1b5ta_      139 AKSAQADLLNLKRKVDAGAN--RAITQ-FFF--D-VESYLRFRDRCVSAGIDVEIIPGIL    192

Query        220 IG---GQDELVF------D-------------------------G--DSIVVD-RDGEVV    242
d1b5ta_      193 PVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSR--EGVK    250

Query        243 ARAPQF----SEGC-VVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG    297
d1b5ta_      251 DFHFYTLNRAEMSYAIC---------------------------------------HTLG    271

Query        298 Y---ADRL    302
d1b5ta_      272 VRPA----    275


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.20)
DALI match                              
Query         21 NAEAILRWTRHSAEQGAHLVAFP     43
d1b5ta_      167 DVESYLRFRDRCVSAGIDVEIIP    189



top
33: d1qtwa_ Endonuclease IV (svm: 0.888)

SCOP Superfamily: Xylose isomerase-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.18  Contact: 714
Modified z-scores:
dali:0.87 daliz:0.87 gdtts:0.94 tmscore:0.93 rmsd:0.36 AHM:0.38 LBcontacta:0.88 LBcontactb:0.89 LHM:0.18
id:0.85 blosum:0.36 compass:0.40 pearson:0.95
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.52 tmscore:0.61 rmsd:0.80 AHM:0.71 LBcontacta:0.35 LBcontactb:0.52 LHM:0.44
id:0.02 blosum:0.09 compass:0.25 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:488.70)
Query          1 ----------------------------------------------------------SL      2
d1qtwa_        1 mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekYH     60

Query          3 QLR---LALNQIDS-----tvgDIAGNAEAILRWTRHSAEQGAHLVAFpeMALTgypved     54
d1qtwa_       61 YTSaqiLPHDSYLInlghpvteALEKSRDAFIDEMQRCEQLGLSLLNF--HPGS------    112

Query         55 lalRSSFVEASRTALRELAARLAEEGFgELPVLVG-------yLDRSesaqpkygqpaga    107
d1qtwa_      113 -hlMQISEEDCLARIAESINIALDKTQ-GVTAVIEntagqgsnLGFK-------------    157

Query        108 prnaaavlhrGRVA------ltfaKHHLpnygvfdefryfVPGD----------------    145
d1qtwa_      158 fehlaaiidgVEDKsrvgvcidtcHAFA------------AGYDlrtpaecektfadfar    205

Query        146 -tmpIVRLhgvdiaLAICE-----------------dlWQDGGrVPAARS-AGAG-LLLS    185
d1qtwa_      206 tvgfKYLR-----gMHLNDakstfgsrvdrhhslgegnIGHDA-FRWIMQdDRFDgIPLI    259

Query        186 vnaspyerdkddTRLELVRKRAQEAGcttaylamiggqdelvfdgdsivvdrdgevvara    245
d1qtwa_      260 ---------letINPDIWAEEIAWLK----------------------------------    276

Query        246 pqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1qtwa_      277 ------------------------------------------------aqqtekava    285


hit structure      alignment
FAST alignment (Normalized score: 2.36 Raw score:693.40)
Query          1 SLQ---------------------------------------------------------      3
d1qtwa_        1 ---MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACE     57

Query          4 -------LRLALNQIDSTVG-------------DIAGNAEAILRWTRHSAEQGAHLVAFP     43
d1qtwa_       58 KYHYTSAQILPH--------DSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLN--    107

Query         44 EMALTGYPVEDLALRSS----------FVEASRTALRELAARLAEEGFGELPVLVGYLDR     93
d1qtwa_      108 -----------------FHPGSHLMQISEEDCLARIAESINIALD-KTQGVTAVI-----    144

Query         94 SESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH    153
d1qtwa_      145 ------------------------------------------------------------    145

Query        154 GVDIALAICE--------------------------------------------DLWQDG    169
d1qtwa_      145 ----------ENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPA    194

Query        170 ---GRVPAARS-AGAGLL-LSVNASPYERDKDDT---------------------RLELV    203
d1qtwa_      195 ECEKTFADFARTVGFKYLRGMHLN----------DAKSTFGSRVDRHHSLGEGNIGHDAF    244

Query        204 RKRAQEAG-----CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLD    258
d1qtwa_      245 RWIM----QDDRFDGIPLI-----------------------------------------    259

Query        259 LPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL----------------    302
d1qtwa_      260 --------------------------------------------LETINPDIWAEEIAWL    275

Query        303 ----------    303
d1qtwa_      276 KAQQTEKAVA    285


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:132.45)
Query          1 SLQLR---------------------LALNQID-STVGDIAGNAEA--IL-RWTRHSAEQ     35
d1qtwa_        1 -MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKY     59

Query         36 GAH-LVAFPEMALTGYPVEDLAL----RSSFVEASRTALRELAARLAEEGFGELPVLVGY     90
d1qtwa_       60 HYTSAQILP--HDS-Y-LINLGHPVTEALEKSRDAFIDEMQRCEQL----G---LSLLNF    108

Query         91 LDRS----ESAQPKYGQPAGAPR-NA--AAVL--HRGRVALTFAKHHLPNYGVFDEFRYF    141
d1qtwa_      109 HPGSHLMQ----ISEEDCLARIAESINI--ALDK--TQGVTAVIE-NTAG--QGSNLGFK    157

Query        142 -VPGD--TM---PIVR-LHGVDIALAICE-DLW---Q----------D-GGRVP--AARS    177
d1qtwa_      158 FEHLAAIIDGVEDKSRV------GVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGF--    209

Query        178 AGAGLLLSVNA----------SPYERDKDD-TRLELVRKRAQEAGCT-TAYLAMIGGQDE    225
d1qtwa_      210 K-Y-LRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILET-----    262

Query        226 LVFDG--D--SIV-VDRDGEV----VARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLR    276
d1qtwa_      263 --INPDIWAEEIAWLKAQQTEKAVA-----------------------------------    285

Query        277 IDRLVISEEPLPAYEAELAGGYADRL    302
d1qtwa_      286 --------------------------    286


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.04)
DALI match       *************************
Query         18 IAGNAEAILRWTRHSAEQGAHLVAF     42
d1qtwa_       84 LEKSRDAFIDEMQRCEQLGLSLLNF    108



top
34: d1nofa2 Glycosyl hydrolase family 5 xylanase,​ catalytic domain (svm: 0.888)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 913
Modified z-scores:
dali:0.89 daliz:0.86 gdtts:0.91 tmscore:0.93 rmsd:0.45 AHM:0.44 LBcontacta:0.79 LBcontactb:0.82 LHM:0.19
id:0.96 blosum:0.33 compass:0.45 pearson:0.91
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.41 tmscore:0.53 rmsd:0.72 AHM:0.66 LBcontacta:0.25 LBcontactb:0.39 LHM:0.44
id:0.05 blosum:0.08 compass:0.08 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:562.20)
Query          1 -----------------------------slqlrLALNqidstvgDIAG-nAEAILRWTR     30
d1nofa2        1 iqgfggmsgvgwindltteqintaygsgvgqiglSIMR----vriDPDSskWNIQLPSAR     56

Query         31 HSAEQGaHLVAfpemALTG----------ypvEDLAlRSSFVEASRTALRELAARLAEEG     80
d1nofa2       57 QAVSLG-AKIM---aTPWSppaymksnnslinGGRL-LPANYSAYTSHLLDFSKYMQTNG    111

Query         81 FgeLPVLVGYL--------------------dRSESaqpkygqpagaprnaaavlhrgRV    120
d1nofa2      112 A--PLYAISIQnepdwkpdyescewsgdefksYLKS-----------------qgskfGS    152

Query        121 ALT-FAKHHLpnygvfdefryfvPGDT--mpivrlhgvdiALAICE-dlWQDGgrVPAAR    176
d1nofa2      153 LKViVAESLG----------fnpALTDpvlkdsdaskyvsIIGGHLygtTPKP--YPLAQ    200

Query        177 SAGAgLLLSVNASPYE-----RDKD-DTRLELVRKRAQEAgctTAYLAMIggqdelvfdg    230
d1nofa2      201 NAGK-QLWMTEHYVDSkqsanNWTSaIEVGTELNASMVSN--ySAYVWWY----------    247

Query        231 dsivvdrdgevvarAPQFsegcvvldldlpaaeaepptgvvddglridrlviseeplpay    290
d1nofa2      248 --------------IRRS------------------------------------------    251

Query        291 eaelaggyADRL---------------    302
d1nofa2      252 -yglltedGKVSkrgyvmsqyarfvrp    277


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:773.50)
Query          1 S-----------------------------------------------------------      1
d1nofa2        1 -IQGFGGMSGVGWINDLTTEQINTAYGSGVGQIGLSIMRVRIDPDSSKWNIQLPSARQAV     59

Query          2 --LQLRLALNQIDSTV-----------------GDIAGNAEAILRWTRHSAEQ--GAHLV     40
d1nofa2       60 SLGAKIMATP-WSPP-AYMKSNNSLINGGRLLPANYSAYTSHLLDFSKYMQTNGAPLYAI    117

Query         41 AFPEMALTGYPVEDLALRSS----------------FVEASRTALRELAARLAEEGFGEL     84
d1nofa2      118 S-------------------IQNEPDWKPDYESCEWSGDEFKSYLKSQGSK-----FGSL    153

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG-----------------------RVA    121
d1nofa2      154 KVI-------------------------------VAESLGFNPALTDPVLKDSDASKYVS    182

Query        122 LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH--------------------GVDIALAI    161
d1nofa2      183 I-------------------------------IGGHLYGTTPKPYPLAQNAGKQLWM---    208

Query        162 CEDLWQDG---------------------GRVPAARSAGAGLLLSVNASPYERDKD----    196
d1nofa2      209 --------TEHYVDSKQSANNWTSAIEVGTELNASMVSNYSAYVW-----------WYIR    249

Query        197 ------------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVAR    244
d1nofa2      250 RSYGLLTEDGKVSKRGYVMSQYARFVR---------------------------------    276

Query        245 APQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL-    302
d1nofa2      277 ----------------------------------------------------------P    277


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:131.55)
Query          1 SLQLRLALNQIDST---------------------------V-GDIAGNAEAILRWTRHS     32
d1nofa2        1 --IQGFGGMSGVGWINDLTTEQINTAYGSGVGQIGLSIMRVRIDPDSSKWNIQLPSARQA     58

Query         33 AEQGAHLVAFPEMALTG--------YPVEDLALRS-SFVEASRTALRELAARLAEEGFGE     83
d1nofa2       59 VSL-GAKIMA-TPWSPPAYMKSNNS--LINGGRLLPANYSAYTSHLLDFSKYMQTNGA--    112

Query         84 LPVLVGYLDRS----------ESAQPKYGQPAGAPR-NA-----AAVLHRGRVALTFAKH    127
d1nofa2      113 PLYAISIQNEPDWKPDYESCE-------WSGDEFKSY-LKSQGS-----KFGSLKVIVAE    159

Query        128 HLPNYGVFDEFRYFVPGD--T-----M-PIVRLHGVDIALAICEDLWQDGGRVPAARSAG    179
d1nofa2      160 SLGF------N--PALTDPVLKDSDASKYVS-------IIGGHLYGTTPKPYPLAQNAGK    204

Query        180 AGLLLSVNASPYERD-----KDD-TRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDS-    232
d1nofa2      205 Q--LWMTEHYVDSKQSANNWTSAIEVGTELNASMVSN-YSAYVWWYIR-----RSYGLLT    256

Query        233 -------IVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEE    285
d1nofa2      257 EDGKVSKRGYV--MSQYA-----------RFVRP--------------------------    277

Query        286 PLPAYEAELAGGYADRL    302
d1nofa2      278 -----------------    278


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.07)
DALI match       .    ..... ***************...... 
Query         11 IDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFP     43
d1nofa2       37 MRVRIDPDSSKWNIQLPSARQAVSLGAKIMATP     69



top
35: d1gzga_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) (svm: 0.895)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.00  Contact: 818
Modified z-scores:
dali:0.86 daliz:0.83 gdtts:0.91 tmscore:0.93 rmsd:0.43 AHM:0.45 LBcontacta:0.87 LBcontactb:0.83 LHM:0.14
id:0.84 blosum:0.11 compass:0.08 pearson:0.88
Scaled scores:
dali:0.67 daliz:0.32 gdtts:0.43 tmscore:0.54 rmsd:0.74 AHM:0.66 LBcontacta:0.32 LBcontactb:0.42 LHM:0.52
id:0.01 blosum:0.03 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:615.90)
Query          1 ------------------------------------------------------------      1
d1gzga_        1 nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid     60

Query          1 ---------slqlrLALNqIDSTV-------------gdiAGNAEAILRWTRHSAeqgAH     38
d1gzga_       61 qllieaeewvalgiPALA-LFPVTpvekksldaaeaynpeGIAQRATRALRERFP---EL    116

Query         39 LVafpemaltgypvEDLALR---------SSFVEASRTALRELAARLaeegfgelpVLVG     89
d1gzga_      117 GI-itdvaldpfttHGQNGIldddgyvlnDVSIDVLVRQALSHAEAG--------aQVVA    167

Query         90 Y-lDRSEsaqpkygqpagaprnaaavlhRGRVALTFA-KHHLPN--------------yg    133
d1gzga_      168 PsdMMDG--------rigairealesagHTNVRVMAYsAKYASAyygpfrdavgsasnlg    219

Query        134 vFDEFrYFVP-------gDTMP-ivrlhgvdiaLAICedLWQDgGRVPAARSAGAGLLLS    185
d1gzga_      220 kGNKA-TYQMdpansdeaLHEVaadlaegadmvMVKP--GMPYlDIVRRVKDEFRAPTFV    276

Query        186 VNASP----yERDK------DDTRLELVRKRAQEAgctTAYLAmiggqdelvfdGDSIvv    235
d1gzga_      277 YQVSGeyamhMGAIqngwlaESVILESLTAFKRAG--aDGILT-----------YFAK--    321

Query        236 drdgevvARAPqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaela    295
d1gzga_      322 -------QAAE-------------------------------------------------    325

Query        296 ggYADRl    302
d1gzga_      326 --QLRR-    329


hit structure      alignment
FAST alignment (Normalized score: 2.78 Raw score:877.60)
Query          1 S-----------------------------------------------------------      1
d1gzga_        1 -NRAYPYTRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSI     59

Query          2 -------------------------------------------------------LQLRL      6
d1gzga_       60 DQLLIEAEEWVALGIPALALFPVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGII    119

Query          7 ALNQIDSTV-------------------GDIAGNAEAILRWTRHSAEQGAHLVAFPEMAL     47
d1gzga_      120 TDV------ALDPFTTHGQNGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVA------    167

Query         48 TGYPVEDLALRSSFVEA----SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQ    103
d1gzga_      168 -----------------PSDMMDGRIGAIREALESAGHTNVRVMAY--------------    196

Query        104 PAGAPRNAAAVLHRG---------------------------------------------    118
d1gzga_      197 ---------------SAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVA    241

Query        119 -----RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH--------------------    153
d1gzga_      242 ADLAEGADM-------------------------------VMVKPGMPYLDIVRRVKDEF    270

Query        154 -GVDIALAICEDLWQDG-----------------GRVPAARSAGAGLLLSVNASPYERDK    195
d1gzga_      271 RAPTFVYQVSGEYA---MHMGAIQNGWLAESVILESLTAFKRAGADGI------------    315

Query        196 DDTRLE---LVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGC    252
d1gzga_      316 ------LTYFAKQAAE--------------------------------------------    325

Query        253 VVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL----    302
d1gzga_      326 --------------------------------------------------QLRR    329


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:138.66)
Query          1 ---------------------------SLQLRLALNQIDSTVGDIA--------------     19
d1gzga_        1 NRAYPYTRLRRNRRDDFSRRLVRENVL--TVDDLILPV-FV--LDGVNQRESIPSMPGVE     55

Query         20 GNAE-AILRWTRHSAEQGAHLVAFPEMALTG-YPV-EDLALRSSFVEASRTALRELAARL     76
d1gzga_       56 RLSIDQLLIEAEEWVALGI-PALAL--FPVTP--VE-KKSLDAAEAYNPEGIAQRATRAL    109

Query         77 AEEGFGELPVLVGYLD--R------SE-------SAQPKYGQPAGAPRNAAAVLHRGRVA    121
d1gzga_      110 RER-FPELGIITDVALDPFTTHGQNGILDDDGYV----LNDVSIDVLVRQALSHAEAGAQ    164

Query        122 LTFAKHHLPNYGVFDEFRYFVPGDTMPI-V------RLHGVDIALAICEDL---------    165
d1gzga_      165 VVAPSDMMD-----------GRIGAIREALESAGHT----NVRVMAYSAKYASAYYGPFR    209

Query        166 ------------------W-------QDGGRVPAARSAGAGLLLSVNASPYERDKDDTRL    200
d1gzga_      210 DAVGSASNLGKGNKATYQMDPANSDEALHEVAADLAEGAD--MVMVK-P-G-----MPYL    260

Query        201 ELVRKRAQEAGCTTAYLAMIGGQDELVFDG----------------DSIVVDRDGEVVAR    244
d1gzga_      261 DIVRRVKDEFRAPTFVYQVSGE----YAMHMGAIQNGWLAESVILESLTAFK-RAGADGI    315

Query        245 APQFSEGCVVLD-LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1gzga_      316 LT---YFAKQAAE-------------------------------------QLRR-----    329


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.03)
DALI match                                
Query         17 DIAGNAEAILRWTRHSAEQGAHLVA     41
d1gzga_      143 LNDVSIDVLVRQALSHAEAGAQVVA    167



hit structures. 
top
36: d1q7za2 Cobalamin-​dependent methionine synthase MetH,​ N-​terminal domain (svm: 0.891)

SCOP Superfamily: Homocysteine S-​methyltransferase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.23  Contact: 879
Modified z-scores:
dali:0.86 daliz:0.81 gdtts:0.90 tmscore:0.93 rmsd:0.43 AHM:0.44 LBcontacta:0.86 LBcontactb:0.87 LHM:0.19
id:0.97 blosum:0.29 compass:0.29 pearson:0.96
Scaled scores:
dali:0.66 daliz:0.29 gdtts:0.41 tmscore:0.54 rmsd:0.76 AHM:0.69 LBcontacta:0.30 LBcontactb:0.45 LHM:0.43
id:0.06 blosum:0.09 compass:0.23 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:552.60)
Query          1 -----------SLQLRLALNQIDS------TVGD-IAGN---AEAILRWTRHSAEQGAHL     39
d1q7za2        1 mrnrrevskllSERVLLLDGAYGTefmkygYDDLpEELNikaPDVVLKVHRSYIESGSDV     60

Query         40 VAfpemaltgypvedlALRSsFVEASRTALRELAARLAeEGFGELPVLVgyldrsesaqp     99
d1q7za2       61 IL---tntfgatrmklRKHG-LEDKLDPIVRNAVRIAR-RAAGEKLVFG-----------    104

Query        100 kygqpagaprnaaavlhrgrvaLTFAkhhlpnygvfdefRYFV-----------------    142
d1q7za2      105 ----------------------DIGP------------tGELPyplgstlfeefyenfre    130

Query        143 ----------------------PGDT----mpivrlhgvdIALAicedLWQD-----GGR    171
d1q7za2      131 tveimveegvdgiifetfsdilELKAavlaarevsrdvflIAHM---tFDEKgrsltGTD    187

Query        172 VPAARSAG-----aGLLLSVnaspyerdkddtRLELVRKRAQEAG-----cTTAYLA--m    219
d1q7za2      188 PANFAITFdeldidALGINC----------slGPEEILPIFQELSqytdkfLVVEPNagk    237

Query        220 iggqDELVFDGD--sivvdrdGEVV------arapqfsEGCVV-------ldLDLPAAEa    264
d1q7za2      238 piveNGKTVYPLkphdfavhiDSYYelgvnifggccgtTPEHVklfrkvlgnRKPLQRK-    296

Query        265 epptgvvddglridrlviseeplpayeaelaggyadrl    302
d1q7za2      297 ----------------------------------kkri    300


hit structure      alignment
FAST alignment (Normalized score: 3.03 Raw score:911.50)
Query          1 S-----------------------------------------------------------      1
d1q7za2        1 -MRNRREVSKLLSERVLLLDGAYGTEFMKYGYDDLPEELNIKAPDVVLKVHRSYIESGSD     59

Query          2 ---------------------------------------LQLRLALNQIDSTV-------     15
d1q7za2       60 VILTNTFGATRMKLRKHGLEDKLDPIVRNAVRIARRAAGEKLVFGDI------GPTGELP    113

Query         16 -----GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEA---SRT     67
d1q7za2      114 YPLGSTLFEEFYENFRETVEIMVEEGVDGIIFE---------------------TFSDIL    152

Query         68 ALRELAARLAEEG-FGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG--------    118
d1q7za2      153 ELKAAVLAARE--VSRDVFLIAHMTFD-------------------------EKGRSLTG    185

Query        119 -------------RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVD---------    156
d1q7za2      186 TDPANFAITFDELDIDALG--------------------------------INCSLGPEE    213

Query        157 --------------IALAICEDLWQDGG-------------------------RVPAARS    177
d1q7za2      214 ILPIFQELSQYTDKFLVV----------EPNAGKPIVENGKTVYPLKPHDFAVHIDSYYE    263

Query        178 AGAGLLLSVNASPYERDKDDT----RLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSI    233
d1q7za2      264 LGVNIFGG-------------CCGTTPEHVKLFRKV------------------------    286

Query        234 VVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAE    293
d1q7za2      287 ------------------------------------------------------------    287

Query        294 LAGGYADRL--------------    302
d1q7za2      287 ---------LGNRKPLQRKKKRI    300


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:151.96)
Query          1 -----------SLQLRLALNQIDS-------TVGDIAGN---AEAILRWTRHSAEQGAHL     39
d1q7za2        1 MRNRREVSKLLSERVLLLDGAYGTEFMKYGYDDLPEELNIKAPDVVLKVHRSYIESGSDV     60

Query         40 VAFPEMALT-GYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRS-ESA     97
d1q7za2       61 ILTNTFGATR-----MKLRKHGLEDKLDPIVRNAVRIARRAAGEKLVFGDIGPTGEL--P    113

Query         98 QPKYGQP-AGA-PRNA-AA-VLHRGRV-ALTFAKHHLPNYGVFDEFRYFVPGD-TM-PI-    149
d1q7za2      114 YPLGSTLFEEFYENFRETVEIMVEEGVDGIIFETFSDI----------LELKAAVLAARE    163

Query        150 --VRLHGVDIALAICE---DLW---QD-GGRVPAARSAGAGLLLSVNASPYERDKDDTRL    200
d1q7za2      164 VSRDV---FLIAHMTFDEKGRSLTGTDPANFAITFDELDIDALGINC-SLG----PEEIL    215

Query        201 ELVRKRAQEAGCTTAYLAMI--G-GQDELVFDGD----S--IV--VDRDGEVVARAPQFS    249
d1q7za2      216 PIFQELSQYTDKFLVVEPNAGKPIVENGKTVYPLKPHDFAVHIDSYYELGVNIFGGCCGT    275

Query        250 E--GC--VV--L-DLDLPAA-----EAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG    297
d1q7za2      276 TPEHVKLFRKVLGNRKPLQRKKKRI-----------------------------------    300

Query        298 YADRL    302
d1q7za2      301 -----    301


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match       *******************           .  .... ......... ....... .   
Query         23 EAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFG     82
d1q7za2       44 DVVLKVHRSYIESGSDVILTNTFGATRMKLRKHGLEDKLDPIVRNAV-RIARRAAGE---     99

DALI match         ....   
Query         83 ELPVLVGYL     91
d1q7za2      100 --KLVFGDI    106



top
37: d1xi3a_ Thiamin phosphate synthase (svm: 0.891)

SCOP Superfamily: Thiamin phosphate synthase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 751
Modified z-scores:
dali:0.85 daliz:0.87 gdtts:0.86 tmscore:0.88 rmsd:0.41 AHM:0.43 LBcontacta:0.93 LBcontactb:0.92 LHM:0.22
id:0.98 blosum:0.86 compass:0.55 pearson:0.95
Scaled scores:
dali:0.71 daliz:0.38 gdtts:0.44 tmscore:0.52 rmsd:0.73 AHM:0.62 LBcontacta:0.47 LBcontactb:0.65 LHM:0.41
id:0.10 blosum:0.16 compass:0.28 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:499.40)
Query          1 ---slqLRLAlnqidstvgdiagnaEAILRWTRHSAEQGAHLVAfpemALTGypvedlal     57
d1xi3a_        1 nlrnklKLYV---------itdrrlKPEVESVREALEGGATAIQ---mRIKN--------     40

Query         58 rssfveASRTALRELAARLAeEGFG--ELPVLVGyldrsesaqpkygqpagaprnaaavl    115
d1xi3a_       41 ------APTREMYEIGKTLR-QLTReyDALFFVD---------------------drvdv     72

Query        116 hrgRVAL--tFAKHhlpnygvfdefryfvpGDTM---pivrlhgvdIALAicedlwqdgG    170
d1xi3a_       73 alaVDADgvqLGPE----------------DMPIevakeiapnliiGASV------yslE    110

Query        171 RVPAARSAGAGLLLSVNaspyerdkddtRLELVRKRAQEAGCTTAYLAMiggqdelvfdg    230
d1xi3a_      111 EALEAEKKGADYLGAGS--vfptdarviGLEGLRKIVESVKIPVVAIGG-----------    157

Query        231 dsivvdrdgeVVAR----apqfSEGCvvldldlpaaeaepptgvvddglridrlviseep    286
d1xi3a_      158 ---inkdnarEVLKtgvdgiavISAV---------------------------mgaedvr    187

Query        287 lpayeaeLAGGYAdrl    302
d1xi3a_      188 kateelrKIVEEV-lg    202


hit structure      alignment
FAST alignment (Normalized score: 3.50 Raw score:863.10)
Query          1 SLQ------LRLALNQIDSTVGDIAGNAE----AILRWTRHSAEQGAHLVAFPEMALTGY     50
d1xi3a_        1 ---NLRNKLKLYVITD-------------RRLKPEVESVREALEGGATAIQ---------     35

Query         51 PVEDLALRSS------FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQP    104
d1xi3a_       36 ----------MRIKNAPTREMYEIGKTLRQLTRE---YDALFFV----------------     66

Query        105 AGAPRNAAAVLHRG----------RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH-    153
d1xi3a_       67 --------------DDRVDVALAVDADG-------------------------------V     81

Query        154 ------------------GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDK    195
d1xi3a_       82 QLGPEDMPIEVAKEIAPNLIIGAS-----VYSL-EEALEAEKKGADYLGA----------    125

Query        196 DDT-----------RLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVAR    244
d1xi3a_      126 ---GSVFPTDARVIGLEGLRKIVESVKIPVVAI---------------------------    155

Query        245 APQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--    302
d1xi3a_      156 ----------------------------------------------------------GG    157

Query        303 ---------------------------------------------    303
d1xi3a_      158 INKDNAREVLKTGVDGIAVISAVMGAEDVRKATEELRKIVEEVLG    202


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:125.81)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1xi3a_        1 NLRNKLKLYVITDRR-L-KPEVESVREALEGGA---T--AIQ--MRIK------------     39

Query         61 FVEASRTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQPAGAPRNAAA-VLHRG    118
d1xi3a_       40 NAP--TREMYEIGKTLRQLTREYDALFFVD---------------------DRVDVALAV     76

Query        119 RVALTFAKHHLPNYGVFDEFRYFVPGDTM-PI--VRLHGVDIALAICEDLWQDGGRVPAA    175
d1xi3a_       77 DADGVQLGP--------------EDMPIEVAKEIAPN---LIIGAS--VYSLE-EALEAE    116

Query        176 RSAGAGLLLSVNASPYE---RDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDG--    230
d1xi3a_      117 KKGAD--YLGAGSVFPTDAR----VIGLEGLRKIVESVKIPVVAIG---------GINKD    161

Query        231 DS--IVVDRDGEVVARAP-QFSE--------GC--VVLDLDLPAAEAEPPTGVVDDGLRI    277
d1xi3a_      162 NAREVLK---TGVDGIAVI-SAVMGAEDVRKATEELRK----------------------    195

Query        278 DRLVISEEPLPAYEAELAGGY--ADRL    302
d1xi3a_      196 ----------------IVEEVLG----    202


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.02)
DALI match                                           
Query          6 LALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA     41
d1xi3a_       31 ATAIQMRIKNAPTREMYEIGKTLRQLTREYDALFFV     66



top
38: d1lucb_ Bacterial luciferase beta chain,​ LuxB (svm: 0.887)

SCOP Superfamily: Bacterial luciferase-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.22  Contact: 781
Modified z-scores:
dali:0.88 daliz:0.86 gdtts:0.89 tmscore:0.91 rmsd:0.45 AHM:0.50 LBcontacta:0.88 LBcontactb:0.93 LHM:0.24
id:0.74 blosum:0.05 compass:0.21 pearson:0.79
Scaled scores:
dali:0.66 daliz:0.32 gdtts:0.42 tmscore:0.51 rmsd:0.72 AHM:0.62 LBcontacta:0.31 LBcontactb:0.54 LHM:0.36
id:-0.01 blosum:0.00 compass:0.06 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:526.40)
Query          1 slqlrlalnqidSTVG---DIAGNAEAILRWTRHSAEQGAHLVAfpemaltgypvedlal     57
d1lucb_        1 ----mkfglfflNFMNskrSSDQVIEEMLDTAHYVDQLKFDTLA-------------vye     43

Query         58 rSSFV-eASRTaLRELAARLAEEGfgELPVLVGyldrsesaqpkygqpagaprnaaavlh    116
d1lucb_       44 nHFSNngVVGA-PLTVAGFLLGMT-kNAKVASL---nhvitthhpvrvaeeaclldqmse     98

Query        117 rgrvALTFA---------------------------------------------------    125
d1lucb_       99 grfaFGFSDceksadmrffnrptdsqfqlfsechkiindafttgychpnndfysfpkisv    158

Query        126 khhlpnygvfdefryfvPGDTMpivrlhgVDIALAICEDLWQD-gGRVPAARSAG-----    179
d1lucb_      159 nphafteggpaqfvnatSKEVV-ewaaklGLPLVFRWDDSNAQrkEYAGLYHEVAqahgv    217

Query        180 ---aGLLLSVNASP-----------------------------------------YERDK    195
d1lucb_      218 dvsqVRHKLTLLVNqnvdgeaaraearvyleefvresysntdfeqkmgellsenaIGTYE    277

Query        196 D--DTRLELVRKRAqeagctTAYLAMI-GGQDelvfdgdsivvdrdgevvarapqfSEGC    252
d1lucb_      278 EstQAARVAIECCG-----aADLLMSFeSMED-------------------kaqqrAVID    313

Query        253 vvldldlpaaeaepptgvvddglridrlviseeplpayeaeLAGGyadrl    302
d1lucb_      314 --------------------------------------vvnANIV-----    320


hit structure      alignment
FAST alignment (Normalized score: 2.81 Raw score:871.90)
Query          1 SLQLRLALNQIDSTV------GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED     54
d1lucb_        1 --MKFGLFFL-----NFMNSKRSSDQVIEEMLDTAHYVDQLKFDTLAV------------     41

Query         55 LALRSSFVEASRT------------ALRELAARLAEEGFGELPVL-VGYLDRSESAQPKY    101
d1lucb_       42 -------------YENHFSNNGVVGAPLTVAGFLLG-MTKNAKVASLNHV----------     77

Query        102 GQPAGAPRNAAAVLHRGRV-----------------------ALTFAKHHLPNYGV----    134
d1lucb_       78 -------------------ITTHHPVRVAEEACLLDQMSEGRFAFGF---------SDCE    109

Query        135 -FDEFRYFVPGDTMPIVRLHGVDIALAICE------------------------------    163
d1lucb_      110 KSADMR------------------------FFNRPTDSQFQLFSECHKIINDAFTTGYCH    145

Query        164 ---------------------------DLWQDGGRVPAARSAGAGLLLSVNASPYERDKD    196
d1lucb_      146 PNNDFYSFPKISVNPHAFTEGGPAQFVNATSK-EVVEWAAKLG-LPLVF-----------    192

Query        197 ------DTRLELVRKRAQEAG----------CTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1lucb_      193 RWDDSNAQRKEYAGLYHEV--AQAHGVDVSQVRHKLTLL---------------------    229

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1lucb_      230 ------------------------------------------------------------    230

Query        301 RL----------------------------------------------------------    302
d1lucb_      230 --VNQNVDGEAARAEARVYLEEFVRESYSNTDFEQKMGELLSENAIGTYEESTQAARVAI    287

Query        303 ---------------------------------    303
d1lucb_      288 ECCGAADLLMSFESMEDKAQQRAVIDVVNANIV    320


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:137.80)
Query          1 SLQLRLALNQIDSTVG---DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1lucb_        1 ----MKFGLFFLNFMNSKRSSDQVIEEMLDTAHYVDQLKFDTLAV-YENHFSNNG-----     50

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVG-YLD-RSESAQPKYGQPAGAPR--NAAA    113
d1lucb_       51 ---V--VGA-PLTVAGFLLG-M-TKNAKVASLNHVITTHHPV--------R--VAE--EA     90

Query        114 V-LH-RGR-VALTFAKHHLPNYGVFDEFRYF-V-------PG--DT--MP--I-------    149
d1lucb_       91 CLLDQMSEGRFAFGFSD-CE---KSADMRFFNRPTDSQFQLFSECHKIINDAFTTGYCHP    146

Query        150 ---------------VRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERD    194
d1lucb_      147 NNDFYSFPKISVNPHAFTEGGPAQFVNATSKEVVEWAAKL-G---L--PLVFRWDD-S--    197

Query        195 KDDTRLELVRKRAQ-E------AG-CTTAYLAMI---------------GGQDEL-----    226
d1lucb_      198 -NAQRKEYAGLYHEVAQAHGVDVSQVRHKLTLLVNQNVDGEAARAEARVYLEEFVRESYS    256

Query        227 -------V--FD--GD----------S--IVVDRDGEVVARAPQF-SE--------GC-V    253
d1lucb_      257 NTDFEQKMGELLSENAIGTYEESTQAARVAIEC--CGAADLLMSFESMEDKAQQRAVIDV    314

Query        254 VLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1lucb_      315 VN-------------------------------------ANIV------    320


hit structure      alignment
HHsearch alignment (Probability: 0.16 E-value:0.01)
DALI match               .  ....*************************         
Query          2 LQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGY     50
d1lucb_        1 MKFGLFFLNFMNSKRSSDQVIEEMLDTAHYVDQLKFDTLAVYENHFSNN     49



top
39: d1lt8a_ Betaine-​homocysteine S-​methyltransferase (svm: 0.889)

SCOP Superfamily: Homocysteine S-​methyltransferase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.23  Contact: 871
Modified z-scores:
dali:0.85 daliz:0.85 gdtts:0.88 tmscore:0.90 rmsd:0.43 AHM:0.47 LBcontacta:0.83 LBcontactb:0.83 LHM:0.21
id:0.88 blosum:0.19 compass:0.34 pearson:0.87
Scaled scores:
dali:0.67 daliz:0.32 gdtts:0.41 tmscore:0.52 rmsd:0.74 AHM:0.63 LBcontacta:0.29 LBcontactb:0.42 LHM:0.43
id:0.02 blosum:0.04 compass:0.12 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 3.3 Raw score:564.90)
Query          1 -------SLQLRLALNQIDS-------------tVGDIA-----GNAEAILRWTRHSaeq     35
d1lt8a_        1 kgilerlNAGEIVIGDGGFVfalekrgyvkagpwTPEAAvehpeAVRQLHREFLRAG---     57

Query         36 gahlvafpemaltgypvedLALRssFVEASRTALRELAARLAeegFGELPVLvgyldrse     95
d1lt8a_       58 --------snvmqtftfyaSEDK--GQEVNEAAADIARQVAD---EGDALVA--------     96

Query         96 saqpkygqpagaprnaaavlhrgrvaLTFAKhhlpnygvfdefRYFV-------------    142
d1lt8a_       97 --------------------------GGVSQ-----------tPSYLsaksetevkkvfl    119

Query        143 ------------------------pgDTMPivrlhgvDIALAICE-dlWQDG-----gRV    172
d1lt8a_      120 qqlevfmkknvdfliaeyfehveeavWAVEtliasgkPVAATMAIgpeGDLHgvppgeAA    179

Query        173 PAARSAGAGLLLSVNASpyerdkdDTRLELVRKRAQEA-----GCTTAYLAMIG------    221
d1lt8a_      180 VRLVKAGASIIGVNCHF-----dpTISLKTVKLMKEGLeaaqlKAHLMSQPLAYhtpdan    234

Query        222 ---------gQDELV-----fdgdsivvdrdgEVVA--rapqfSEGCVvldldlpaaeae    265
d1lt8a_      235 kqgfidlpefPFGLEprvatrwdiqkyareayNLGVryiggccGFEPY------------    282

Query        266 pptgvvddglridrlviseeplpayEAEL-------------------------------    294
d1lt8a_      283 ---------------hiraiaeelaPERGflppasekhgswgsgldmhtkpwvrararke    327

Query        295 -------------aggyadrl    302
d1lt8a_      328 ywenlriasgrpynpsmskpd    348


hit structure      alignment
FAST alignment (Normalized score: 2.56 Raw score:830.80)
Query          1 S-----------------------------------------------------------      1
d1lt8a_        1 -KGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSN     59

Query          2 --------------------------------LQLRLALNQIDSTV---------GDIAG     20
d1lt8a_       60 VMQTFTFYASEDKGQEVNEAAADIARQVADEGDALVAGGV------SQTPSYLSAKSETE    113

Query         21 NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEA---SRTALRELAARLA     77
d1lt8a_      114 VKKVFLQQLEVFMKKNVDFLIAE---------------------YFEHVEEAVWAVETLI    152

Query         78 EEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG-------------------    118
d1lt8a_      153 AS---GKPVAATMAIG-------------------------PEGDLHGVPPGEAAVRLVK    184

Query        119 -RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVD---------------------    156
d1lt8a_      185 AGASIIG--------------------------------VNCHFDPTISLKTVKLMKEGL    212

Query        157 -------IALAICEDLWQDG-----------------------------------GRVPA    174
d1lt8a_      213 EAAQLKAHLMSQ--------PLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYARE    264

Query        175 ARSAGAGLLLSVNASPYERDKDDT----RLELVRKRAQEAGCTTAYLAMIGGQDELVFDG    230
d1lt8a_      265 AYNLGVRYIGG-------------CCGFEPYHIRAIAEE---------------------    290

Query        231 DSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAY    290
d1lt8a_      291 ------------------------------------------------------------    291

Query        291 EAELAGGYADRL------------------------------------------------    302
d1lt8a_      291 ------------LAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGR    338

Query        303 ----------    303
d1lt8a_      339 PYNPSMSKPD    348


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:150.83)
Query          1 -------SLQLRLALNQI--DS-T------V--GDIAGN---AEAILRWTRHSAEQGAHL     39
d1lt8a_        1 KGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV     60

Query         40 VAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFG--ELPVLVGYLDRSE-S     96
d1lt8a_       61 MQT--FTFYA------S-ED--KG--QEVNEAAADIARQVADEGDALVAGGVSQTPSYLS    107

Query         97 AQPKYGQPAGAPR-NAAA-VLHRGRV-ALTFAKHHLPNYGVFDEFRYFVPG-DTM--PI-    149
d1lt8a_      108 AKSET--EVKKVFL-QQLEVFMKKNVDFLIAEYFEHV-----------EEAVWAVETLIA    153

Query        150 VRLHGVDIALAICEDL-W----QD-GGRVPAARSAGAGLLLSVNASPYERDKDDTRLELV    203
d1lt8a_      154 SGK---PVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGV-NCHFDP----TISLKTV    205

Query        204 RKRAQEA-----GCTTAYLAMIG---------------GQDELV-FDG----D--SI-VV    235
d1lt8a_      206 KLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREA    265

Query        236 DRDGEVV-ARAPQFSE--GC--VVLDL--DLPAAEAEPPTGVVDDGLRIDRLVISEEPLP    288
d1lt8a_      266 Y-NLGVRYIGGCCGFEPYHIRAIAEELAP-------------------------------    293

Query        289 AYEAELAG--------G-----------------Y--ADR-L---------------    302
d1lt8a_      294 --ERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPD    348


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.21)
DALI match       ..........                          . ................. . ..
Query         23 EAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFG     82
d1lt8a_       44 EAVRQLHREFLRAGSNVMQTFTFYAS----------EDKGQEVNEAAADIARQVADEGDA     93

DALI match       .....  
Query         83 ELPVLVG     89
d1lt8a_       94 LVAGGVS    100



top
40: d1luca_ Bacterial luciferase alpha chain,​ LuxA (svm: 0.888)

SCOP Superfamily: Bacterial luciferase-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.24  Contact: 791
Modified z-scores:
dali:0.85 daliz:0.85 gdtts:0.92 tmscore:0.92 rmsd:0.41 AHM:0.41 LBcontacta:0.88 LBcontactb:0.80 LHM:0.16
id:0.75 blosum:0.08 compass:0.08 pearson:0.81
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.48 tmscore:0.59 rmsd:0.74 AHM:0.65 LBcontacta:0.35 LBcontactb:0.42 LHM:0.47
id:0.00 blosum:0.01 compass:0.09 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 3.3 Raw score:544.70)
Query          1 slqlRLALNqIDSTVG--------DIAGNAEAILRWTRHSaeqgahlVAFPemaltgypV     52
d1luca_        1 ----MKFGN-FLLTYQppelsqteVMKRLVNLGKASEGCG------fDTVW-----lleH     44

Query         53 EDLalrssfveASRTALRELAARLAeegfgeLPVLVG----yldRSESaqpkygqpagap    108
d1luca_       45 HFT--efgllgNPYVAAAHLLGATE------TLNVGTaaivlptAHPV----------rq     86

Query        109 rnaaavlHRGRVA--ltfAKHHLpnygvfdEFRYF-----------vPGDT---------    146
d1luca_       87 aedvnllDQMSKGrfrfgICRGL-------YDKDFrvfgtdmdnsraLMDCwydlmkegf    139

Query        147 --------------------mpivrlhgvdIALAicedLWQDgGRVPAARSAGAgLLLSv    186
d1luca_      140 negyiaadnehikfpkiqlnpsaytqggapVYVV----AESA-STTEWAAERGL-PMIL-    192

Query        187 naspyerdkddTRLELVRKRAQEAG------------ctTAYLAMI--------------    220
d1luca_      193 --------swiINTHEKKAQLDLYNevatehgydvtkidHCLSYITsvdhdsnrakdicr    244

Query        221 gGQDELV------------------------fdgdsivvdrdgEVVARapqfsegcvvld    256
d1luca_      245 nFLGHWYdsyvnatkifridysyeinpvgtpeeciaiiqqdidATGID------------    292

Query        257 ldlpaaeaepptgvvddglridrlviseeplpayeAELAGGYadrl    302
d1luca_      293 --------niccgfeangseeeiiasmklfqsdvmPYLKEKQ----    326


hit structure      alignment
FAST alignment (Normalized score: 2.90 Raw score:908.40)
Query          1 SLQLRLALNQIDSTVG-------DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1luca_        1 --MKFGNFLL------TYQPPELSQTEVMKRLVNLGKASEGCGFDTVWL-----------     41

Query         54 DLALRSSFVEASRT------------ALRELAARLAEEG-FGELPVL-VGYLDRSESAQP     99
d1luca_       42 --------------LEHHFTEFGLLGNPYVAAAHLLG--ATETLNVGTAAIV--------     77

Query        100 KYGQPAGAPRNAAAVLHRGRV-----------------------ALTFAKHHLPNYGV--    134
d1luca_       78 ---------------------LPTAHPVRQAEDVNLLDQMSKGRFRFGI---------CR    107

Query        135 ---FDEFRYFVPGDTMPIVRLHGVD-----------------------------------    156
d1luca_      108 GLYDKDFR-----------------VFGTDMDNSRALMDCWYDLMKEGFNEGYIAADNEH    150

Query        157 ------------------IALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD--    196
d1luca_      151 IKFPKIQLNPSAYTQGGAPVYV---VAESA-STTEWAAERG-LPMI------------LS    193

Query        197 -----DTRLELVRKRAQEAG----------CTTAYLAMIGGQDELVFDGDSIVVDRDGEV    241
d1luca_      194 WIINTHEKKAQLDLYNEV--ATEHGYDVTKIDHCLSYI----------------------    229

Query        242 VARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADR    301
d1luca_      230 ------------------------------------------------------------    230

Query        302 L-----------------------------------------------------------    302
d1luca_      230 -TSVDHDSNRAKDICRNFLGHWYDSYVNATKIFRIDYSYEINPVGTPEECIAIIQQDIDA    288

Query        303 --------------------------------------    303
d1luca_      289 TGIDNICCGFEANGSEEEIIASMKLFQSDVMPYLKEKQ    326


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:139.00)
Query          1 SLQLRLALNQIDSTV--GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1luca_        1 ---MKFGNFLLTYQPPELSQTEVMKRLVNLGKASEGCGFDTVWL-LEHHFTEFG------     50

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLV-GYLD-RSES--AQPKYGQPAGAPR--NAA    112
d1luca_       51 --L--LGN-PYV-AAAHLLGA-TETLNVGTAAIVLPTAHPVR------------QAE--D     89

Query        113 AV-LH-RGR-VALTFAKHHLPNYGVFDEFRY-----F-VP---GD--TM-PI--------    149
d1luca_       90 VNLLDQMSKGRFRFGICRGL-----YDKDFRVFGTDMDNSRALMDCWYDLMKEGFNEGYI    144

Query        150 -----------------VRLH--GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASP    190
d1luca_      145 AADNEHIKFPKIQLNPSAYTQGG--APVYVV--AE-SAST-TEWAAERGL-PMILSW-I-    195

Query        191 YERDKDDTRLELVRKRAQEAG------------CTTAYLAM----------------IG-    221
d1luca_      196 -------INTHEKKAQLDLYNEVATEHGYDVTKIDHCLSYITSVDHDSNRAKDICRNFLG    248

Query        222 GQDELV--------F--DG--DS----------IV-VDRDGEVV-ARAPQFSE-------    250
d1luca_      249 HWYDSYVNATKIFRIDYSYEINPVGTPEECIAIIQQDIDATGIDNICCGFEANGSEEEII    308

Query        251 -GC--VVL--DLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG--YADRL    302
d1luca_      309 ASMKLFQSDV------------------------------------MPYLKEKQ-----    326


hit structure      alignment
HHsearch alignment (Probability: 0.15 E-value:0.01)
DALI match       .  ..... ......................     . ....       
Query          2 LQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGY     50
d1luca_        1 MKFGNFLLTYQPPELSQTEVMKRLVNLGKASEGCGFDTVWLLEHHFTEF     49



hit structures. 
top
41: d1rvka1 Hypothetical protein Atu3453 (svm: 0.885)

SCOP Superfamily: Enolase C-​terminal domain-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.25  Contact: 758
Modified z-scores:
dali:0.83 daliz:0.84 gdtts:0.89 tmscore:0.90 rmsd:0.37 AHM:0.41 LBcontacta:0.75 LBcontactb:0.77 LHM:0.19
id:0.79 blosum:0.23 compass:0.20 pearson:0.89
Scaled scores:
dali:0.69 daliz:0.34 gdtts:0.48 tmscore:0.57 rmsd:0.77 AHM:0.67 LBcontacta:0.25 LBcontactb:0.39 LHM:0.43
id:0.02 blosum:0.06 compass:0.18 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:494.40)
Query          1 --SLQLRLALNQidstvgdiaGNAEAILRWTRHSAEQGAHLVAFPemaLTGYPVEdlalr     58
d1rvka1        1 yrDKVLAYGSIMcgdelegglATPEDYGRFAETLVKRGYKGIKLH---TWMPPVS-----     52

Query         59 ssfveASRTALRELAARLAEEGFGELPVLVGYL--DRSEsaqpkygqpagaprnaaavlh    116
d1rvka1       53 ---waPDVKMDLKACAAVREAVGPDIRLMIDAFhwYSRT-----------dalalgrgle     98

Query        117 rGRVALT--fAKHHlpnygvfdefryfVPGDtmpivrlhgvdialAICEDlWQDG-----    169
d1rvka1       99 kLGFDWIeepMDEQ-----------slSSYK---wlsdnldipvvGPESA-AGKHwhrae    143

Query        170 ---------------------grvPAARSAG----AGLLLSvnaspyerdkddtrlelvr    204
d1rvka1      144 wikagacdilrtgvndvggitpalKTMHLAEafgmECEVHG-------------------    184

Query        205 kraqeagcttaylamiggqdelvfdgdsiVVDR----------dgevvarapqfSEGC--    252
d1rvka1      185 -----------------------------NTAMnlhvvaatkncrwyergllhpFLEYdd    215

Query        253 -------------vvLDLDLpaaeaepptgvvddglridrlviseeplpayeaelaggya    299
d1rvka1      216 ghdylkslsdpmdrdGFVHV-----------------------pdrpglgedidftfidn    252

Query        300 drl    302
d1rvka1      253 nrv    255


hit structure      alignment
FAST alignment (Normalized score: 2.90 Raw score:804.50)
Query          1 SL----QLRLALNQIDSTVGDIAG-----------NAEAILRWTRHSAEQGAHLVAFPEM     45
d1rvka1        1 --YRDKVLAYGSI-----------MCGDELEGGLATPEDYGRFAETLVKRGYKGIK----     43

Query         46 ALTGYPVEDLALRSSFVEA------------SRTALRELAARLAEEG--FGELPVLVG--     89
d1rvka1       44 -------------------LHTWMPPVSWAPDVKMDLKACAAVRE--AVGPDIRLMIDAF     82

Query         90 YLDRSESAQPKYGQPAGAPRNAAAVLHR-------------GRVALTFAKHHLPNYGVFD    136
d1rvka1       83 HWYS------------------------RTDALALGRGLEKLGFDWI-------------    105

Query        137 EFRYFVPGDTMPIVRLHGV-----------------------------------------    155
d1rvka1      106 -------------------EEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIK    146

Query        156 ----DIALAICEDLWQDG------------GRVPAARSAGAGLLLSVNASPYERDKDDT-    198
d1rvka1      147 AGACDILRT---------GVNDVGGITPALKTMHLAEAFG-MECEV-------------H    183

Query        199 -RLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDL    257
d1rvka1      184 GNTAMNLHVVAATK----------------------------------------------    197

Query        258 DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL---------------    302
d1rvka1      198 ---------------------------------------------NCRWYERGLLHPFLE    212

Query        303 -------------------------------------------    303
d1rvka1      213 YDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV    255


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:126.16)
Query          1 SL-QLRLALNQIDSTVGD--IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1rvka1        1 YRD-KVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKL---HTWM--P--PV-     51

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVGYLD-RSESAQPKYGQPAGAP--RNAAAV    114
d1rvka1       52 S-WAP-D-VKMDLKACAAVREAVGPDIRLMIDAFHWYSRT---------D-ALA--LGRG     96

Query        115 LHRGRVALTFA----------------------KH-HLPN-----------YGVFDEFRY    140
d1rvka1       97 LEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKA---------    147

Query        141 FVPGDTMPIVRLHGVDIALAICEDLWQ--DG-GRVPAARS-AGAGLLLSVNASPYERDKD    196
d1rvka1      148 ---GACDI---------LRTGVNDVGGITPALKTMHLAEAFGME--CEVHG-N-------    185

Query        197 DTRLELVRKRAQEAGCTTAYLAMIG--GQDELVFDGDSIVVDRDGEVVARAPQF----SE    250
d1rvka1      186 --TAMNLHVVAATKNCRWYERGLLHPF-------LEY------------DDGHDYLKS--    222

Query        251 G-CVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG-Y------ADRL    302
d1rvka1      223 LSDPMDR------------------------------------DGFVHVPDRPGLGEDID    246

Query        303 ---------    303
d1rvka1      247 FTFIDNNRV    255


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match                                                
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA     41
d1rvka1       41 GIKLHTWMPPVSWAP-DVKMDLKAC-AAVREAVGPDIRLMI     79



top
42: d7a3ha_ Endoglucanase Cel5a (svm: 0.885)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.14  Contact: 682
Modified z-scores:
dali:0.84 daliz:0.85 gdtts:0.86 tmscore:0.88 rmsd:0.41 AHM:0.43 LBcontacta:0.84 LBcontactb:0.81 LHM:0.20
id:0.78 blosum:0.36 compass:0.51 pearson:0.96
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.41 tmscore:0.51 rmsd:0.77 AHM:0.67 LBcontacta:0.32 LBcontactb:0.44 LHM:0.43
id:0.02 blosum:0.08 compass:0.23 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:517.50)
Query          1 --------------------SLQL------------------------------rLALNq     10
d7a3ha_        1 svveehgqlsisngelvnerGEQVqlkgmsshglqwygqfvnyesmkwlrddwgiNVFR-     59

Query         11 IDSTVG-----diAGNAEAILRWTRHSAEQGAhLVAFpemALTGYPVEdlalrssFVEAS     65
d7a3ha_       60 AAMYTSsggyiddPSVKEKVKEAVEAAIDLDI-YVII---DWHILSDN---dpniYKEEA    112

Query         66 RTALRELAARLAeegfGELPVLVGYldrsesaqpkygqpagaprnaaavlhrgrvaltfa    125
d7a3ha_      113 KDFFDEMSELYG----DYPNVIYEI-----------------------------------    133

Query        126 khhlpnygvFDEF-ryfVPGDT------mpivrlhgvdialAICE----DLWQdggRVPA    174
d7a3ha_      134 -----anepNGSDvtwgNQIKPyaeevipiirnndpnniiiVGTGtwsqDVHH---AADN    185

Query        175 ArsagaglllsvnaSPYERDKDDTRLELVRKRAQEAgcTTAYLA----miggqdelvfdg    230
d7a3ha_      186 Q---ladpnvmyafHFYAGTHGQNLRDQVDYALDQG-aAIFVSEwgtsaatgdggvflde    241

Query        231 dsivvdrdgEVVArapQFSEgcvvldldlpaaeaepptgvvddglridrlviseeplpay    290
d7a3ha_      242 aqvwidfmdERNLswaNWSL----------------thkdessaalmpganptggwteae    285

Query        291 eaelaggYADR---l    302
d7a3ha_      286 lspsgtfVREKires    300


hit structure      alignment
FAST alignment (Normalized score: 2.44 Raw score:734.70)
Query          1 SLQL-------------------------------------------------------R      5
d7a3ha_        1 ----SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGIN     56

Query          6 LALNQIDSTVGDI---------AGNAEAILRWTRHSAEQGAHLVAFPEMALTGY--PVED     54
d7a3ha_       57 VFRAAMY------TSSGGYIDDPSVKEKVKEAVEAAIDLD-IYVII--------DWHILS    101

Query         55 LAL---RSSFVEASRTALRELAARLAEEGFGEL-PVLVGYLDRSESAQPKYGQPAGAPRN    110
d7a3ha_      102 ---DNDPNIYKEEAKDFFDEMSEL-----YGDYPNVIYE---------------------    132

Query        111 AAAVLHRGRV---------------------------------ALTFAKHHLPNYGVFDE    137
d7a3ha_      133 ----------IANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVG-----------    171

Query        138 FRYFVPGDTMPIVRLHGV------------------------------------------    155
d7a3ha_      172 ------------------TGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDY    213

Query        156 -----DIALAICEDLWQDG-------------------GRVPAARSAGAGLLLSVNASPY    191
d7a3ha_      214 ALDQGAAIFVS--------EWGTSAATGDGGVFLDEAQVWIDFMDER---NLSWA-----    257

Query        192 ERDKD-----------------------------DTRLELVRKRAQEAGCTTAYLAMIGG    222
d7a3ha_      258 -----NWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR--------------    298

Query        223 QDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVI    282
d7a3ha_      299 ------------------------------------------------------------    299

Query        283 SEEPLPAYEAELAGGYADRL--    302
d7a3ha_      299 --------------------ES    300


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:144.46)
Query          1 -------------------SLQLRLALNQIDSTV--GDIAGNAE-AILRWTRHSAEQGAH     38
d7a3ha_        1 SVVEEHGQLSISNGELVNERGEQVQLKG-MSSHGLQWYGQFVNYESMKWLRDDW-GI---     55

Query         39 LVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLD----RS     94
d7a3ha_       56 -NVFR--AAMY--TSSGGYIDD--PSVKEKVKEAVEAAI-DLD--IYVIIDWHILSDN--    103

Query         95 ESAQPKYGQPAGAPRNA--AAV--LHRGRVALTFAKHHLPNYG----VFDEFR--YFVPG    144
d7a3ha_      104 ---D-PNIYKEEAKDFFDE-MSELYGDYPNVIYEIANEPNGSDVTWG----NQIK--PYA    152

Query        145 D-TM--PI---VRLHGVDIALAICE--DLWQDGGRVPAARSAGAGLLLSVNASPYERDKD    196
d7a3ha_      153 EEVIPIIRNNDPNN----IIIVGTGTWSQDVHHAADNQL-ADPN--VMYAFHFYAGTH-G    204

Query        197 DTRLELVRKRAQEAGCTTAYLAMIGGQDELV--FD---G--DS-IVVDRDGEVVARA-P-    246
d7a3ha_      205 QNLRDQVDYALDQGAA-IFVSEWGTSAATGDGGVFLDEAQVWIDFMD----ERNLSWANW    259

Query        247 --------Q--------------------F--SEGCVVLDLDLPAAEAEPPTGVVDDGLR    276
d7a3ha_      260 SLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR---------------------    298

Query        277 IDRLVISEEPLPAYEAELAGGYADRL    302
d7a3ha_      299 -----------------E-S------    300


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.14)
DALI match         ....         *******************....
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA     41
d7a3ha_       58 FRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVII     95



top
43: d1jk7a_ Protein phosphatase-​1 (PP-​1) (svm: 1.977)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.15  Contact: 897
Modified z-scores:
dali:0.91 daliz:0.82 gdtts:0.92 tmscore:0.95 rmsd:0.44 AHM:0.46 LBcontacta:0.96 LBcontactb:0.94 LHM:0.21
id:0.98 blosum:0.56 compass:0.29 pearson:0.98
Scaled scores:
dali:0.63 daliz:0.23 gdtts:0.39 tmscore:0.46 rmsd:0.71 AHM:0.59 LBcontacta:0.39 LBcontactb:0.54 LHM:0.35
id:0.07 blosum:0.12 compass:0.22 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:424.90)
Query          1 ------------------------------------------------slQLRLALNQid     12
d1jk7a_        1 klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpillelEAPLKICG--     58

Query         13 stvgdiagNAEAILRWTRHSA--EQGAhLVAFpemaltgypvedlalrssfveasrtALR     70
d1jk7a_       59 ----dihgQYYDLLRLFEYGGfpPESN-YLFL-----------------gdyvdrgkQSL     96

Query         71 ELAARLAeeGFGE-----LPVLVG-YLDRS---esaqpkygqpagaprnaaavlhrgrVA    121
d1jk7a_       97 ETICLLL--AYKIkypenFFLLRGnHECASinriygfydeckrryniklwktftdcfnCL    154

Query        122 LTfakhhlpnygvfdefryfvpgdtmPIVRlhGVDIA-LAIC------------------    162
d1jk7a_      155 PI------------------------AAIV--DEKIFcCHGGlspdlqsmeqirrimrpt    188

Query        163 -------------EDLW-----------------QDGGRVPAARSAGAGLLLSVN-ASPY    191
d1jk7a_      189 dvpdqgllcdllwSDPDkdvlgwgendrgvsftfGAEVVAKFLHKHDLDLICRAHqVVED    248

Query        192 erdkddtrlelVRKRAqeagctTAYLA-mIGGQDELVFDGdsivvdrdgevvarapqfse    250
d1jk7a_      249 -------gyefFAKRQ------LVTLFsaPNYCGEFDNAG--------------------    275

Query        251 GCVVLDLDLpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1jk7a_      276 AMMSVDETL---------------------------------mcsfqilkpa    294


hit structure      alignment
FAST alignment (Normalized score: 1.85 Raw score:551.30)
Query          1 SLQ---------------------------------------------------LRLALN      9
d1jk7a_        1 ---KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKIC     57

Query         10 QIDSTVGD-----IAGNAEAILRWTRHSAEQGA------HLVAFPEMALTGYPVEDLALR     58
d1jk7a_       58 --------GDIHGQYYDLLRLFEY---------GGFPPESNYL-----------------     83

Query         59 SSFVEA----------SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAP    108
d1jk7a_       84 ------FLGDYVDRGKQSLETICLLLAYKI-KYPE-------------------------    111

Query        109 RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTM---------------------    147
d1jk7a_      112 ---------------------------------------NFFLLRGNHECASINRIYGFY    132

Query        148 -----------------------PIVRLHGVDIALAICED--------------------    164
d1jk7a_      133 DECKRRYNIKLWKTFTDCFNCLPIAAIVD-EKIFCC----HGGLSPDLQSMEQIRRIMRP    187

Query        165 -----------------LWQDGG--------------RVPAARS----AGAGLLLSVNAS    189
d1jk7a_      188 TDVPDQGLLCDLLWSDPDKDV--LGWGENDRGVSFTFGAEVVAKFLHKHDLDLICR----    241

Query        190 PYERDKDDTRLELVRKRAQEAGC---------------TTAYLAM-IGGQ-DELVFDGDS    232
d1jk7a_      242 -----------------------AHQVVEDGYEFFAKRQLVTLF-SAPNYCGEFD-----    272

Query        233 IVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEA    292
d1jk7a_      273 ---------------NAGAMMSV-------------------------------------    280

Query        293 ELAGGYADRL--------------    302
d1jk7a_      281 ----------DETLMCSFQILKPA    294


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:116.62)
Query          1 -------------------------------------------------SLQLRLALNQI     11
d1jk7a_        1 KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLE-LEAPLKICGD     59

Query         12 DSTVGDIAGNAEAILRWTRHSAEQ-GAHLVAFPEMALTGY-PVEDLALRSSFVEASRTAL     69
d1jk7a_       60 IH----G--QYYDLLRLFEYGGFPPESNYLFL-GDYVDRGK-------------QSLETI     99

Query         70 RELAARLAEEGFGELPVLV-G-YLDRS--------------------ESAQPKYGQPAG-    106
d1jk7a_      100 CLLLA-YKI-KYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLW-----------KT    146

Query        107 APRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLW    166
d1jk7a_      147 -FTDCFN--------CLPI----------------------AAI-V-DEKIFCCHGG-LS    172

Query        167 QDGGRVPAARSA-------------GAGLLLSVNASPYERDKDD-----------TRLEL    202
d1jk7a_      173 PDLQSMEQIRRIMRPTDVPDQGLLC------DLLWSDPDKDVLGWGENDRGVSFTFGAEV    226

Query        203 VRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ----------FSEGC    252
d1jk7a_      227 VAKFLHKHDLDLICRAHQVV----EDGYEFF-A----KRQLVTLFSAPNYCGEFDNAGAM    277

Query        253 VVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA-----DRL    302
d1jk7a_      278 MSVD-----------------------------------ETLMCSFQILKPA---    294


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.10)
DALI match              *************.... ....
Query         14 TVGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1jk7a_       56 ICGDIHGQYYDLLRLFEYGGFPPESNYLF     84



top
44: d1edga_ Endoglucanase CelA (svm: 0.888)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.15  Contact: 735
Modified z-scores:
dali:0.87 daliz:0.86 gdtts:0.91 tmscore:0.93 rmsd:0.41 AHM:0.44 LBcontacta:0.89 LBcontactb:0.92 LHM:0.20
id:0.75 blosum:0.15 compass:0.23 pearson:0.89
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.44 tmscore:0.56 rmsd:0.75 AHM:0.68 LBcontacta:0.33 LBcontactb:0.54 LHM:0.42
id:0.01 blosum:0.07 compass:0.14 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:595.20)
Query          1 ------------------SLQL------rlaLNQIDS--TVGD-----------------     17
d1edga_        1 mydaslipnlqipqknipNNDGmnfvkglrlGWNLGNtfDAFNgtnitneldyetswsgi     60

Query         18 -----------------------------------iagnaeaILRWTRHSAEQGAHLVaf     42
d1edga_       61 kttkqmidaikqkgfntvripvswhphvsgsdykisdvwmnrVQEVVNYCIDNKMYVI--    118

Query         43 pemaltgypvedlalRSSFVE--------asrTALRELAARLAEEG---fgeLPVLVgyl     91
d1edga_      119 --------lnthhdvDKVKGYfpssqymasskKYITSVWAQIAARFanydehLIFEGmne    170

Query         92 DRSES------aqpKYGQpagaprnaaavlhrgRVAL-----------------tFAKHh    128
d1edga_      171 PRLVGhanewwpelTNSD--vvdsincinqlnqDFVNtvratggknasrylmcpgYVAS-    227

Query        129 lpnygvfdefryfvpgDTMP---------ivrlhGVDIALAICE----------------    163
d1edga_      228 ---------------pDGATndyfrmpndisgnnNKIIVSVHAYcpwnfaglamadggtn    272

Query        164 ---------dlWQDGGrVPAARSAGA---GLLLSVN-aSPYE-RDKD--DTRLELVRKRA    207
d1edga_      273 awnindskdqsEVTWF-MDNIYNKYTsrgIPVIIGEcgAVDKnNLKTrvEYMSYYVAQAK    331

Query        208 QEagcTTAYLAMIGGQ---DELVFDgdsivvdrdgevvarapqfsegcvvldldlpaaea    264
d1edga_      332 AR---GILCILWDNNNfsgTGELFG-----------------------------------    353

Query        265 epptgvvddglridrlviseeplpayeaelaggyADRL---------------    302
d1edga_      354 --------------------------ffdrrscqFKFPeiidgmvkyafglin    380


hit structure      alignment
FAST alignment (Normalized score: 1.99 Raw score:675.00)
Query          1 SLQ---------------------------------------------------------      3
d1edga_        1 ---MYDASLIPNLQIPQKNIPNNDGMNFVKGLRLGWNLGNTFDAFNGTNITNELDYETSW     57

Query          4 -----------------LRLALNQIDSTVGDIA---------------GNAEAILRWTRH     31
d1edga_       58 SGIKTTKQMIDAIKQKGFNTVRIPV--------SWHPHVSGSDYKISDVWMNRVQEVVNY    109

Query         32 SAEQGAHLVAFPEMALTGYPVEDLAL----------------------------------     57
d1edga_      110 CIDNK-MYVI----------------LNTHHDVDKVKGYFPSSQYMASSKKYITSVWAQI    152

Query         58 ------------------------------------RSSFVEASRTALRELAARLAEEG-     80
d1edga_      153 AARFANYDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQDFVNTVRA--T    210

Query         81 ---FGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDE    137
d1edga_      211 GGKNASRYLMC-------------------------------------------------    221

Query        138 FRYFVPGDTMPIVRLHGV---------------------------DIALAICEDLWQDG-    169
d1edga_      222 ------------------PGYVASPDGATNDYFRMPNDISGNNNKIIVSV---------H    254

Query        170 --------------------------------GRVPAARSAGA-----GLLLSVN---AS    189
d1edga_      255 AYCPWNFAGLAMADGGTNAWNINDSKDQSEVTWFMDNIYNK--YTSRGIPVII--GECGA    310

Query        190 PYERDKD--DTRLELVRKRAQEAG---CTTAYLAMIGGQD--------ELVFDGDSIVVD    236
d1edga_      311 VDKN---NLKTRVEYMSYYVAQ--AKARGILCILW-----DNNNFSGTGELF--------    352

Query        237 RDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAG    296
d1edga_      353 ------------------------------------------------------------    353

Query        297 GYADRL----------------------------    302
d1edga_      353 ------GFFDRRSCQFKFPEIIDGMVKYAFGLIN    380


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:128.99)
Query          1 -------------------SL-QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLV     40
d1edga_        1 MYDASLIPNLQIPQKNIPNNDGMNFVK-----------------------------GLRL     31

Query         41 AFPEMALTGYPVEDLALRSS--FVEAS-RTALRELAARLAEEGF-GELPVLVGYLDRSES     96
d1edga_       32 GWN--LGNTFDAFNGTNITNELDYETSWSGIKTT-KQMIDAIKQKGFNTVRIPVSWHPH-     87

Query         97 AQPKYGQPAGAPR--NAA-AV--LHRGRV-ALTFAK-HH----LPNYG--VFD--EFR--    139
d1edga_       88 VSGSDYKISDVWMNR-VQEVVNYCIDNKMYVILNTHHDVDKVKGYFPSSQ--YMA-SSKK    143

Query        140 YFV-PGD--TM--PI-VRLHGVDIALAIC-E------------------------DLWQD    168
d1edga_      144 -YITSVWAQIAARFANYDEH--LIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLN    200

Query        169 GGRVPAARS----AGAGLLLSVNASPYERDKDDTRLELVRKRAQEA----GC-TTAYLAM    219
d1edga_      201 QDFVNTVRATGGKNASRYLMCPGYVAS----PDGATNDYFRMP-NDISGNNNKIIVSVHA    255

Query        220 I------GGQ-DE-LV-------------FDG--DS--IV-VDRDGEVVARA-PQFSE--    250
d1edga_      256 YCPWNFAGLAMADG-GTNAWNINDSKDQS-EVTWFMDNIYNKYTSRGIPVIIG-ECGAVD    312

Query        251 -------------GC--VV--LDL------------------------------------    257
d1edga_      313 KNNLKTRVEYMSYYVAQAKARGILCILWDNNNFSGTGELFGFFDRRSCQFKFPEIIDGMV    372

Query        258 --DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELA---GGYADRL    302
d1edga_      373 KY-----------------------------------AFGLIN-------    380


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.14)
DALI match                                                                   
Query         26 LRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELP     85
d1edga_       64 KQMIDAIKQKGFNTVRIPVSWHPHVSGSDYKISDVWMNRVQEVVNYCIDN-------KMY    116

DALI match          
Query         86 VLV     88
d1edga_      117 VIL    119



top
45: d1q6oa_ 3-​keto-​L-​gulonate 6-​phosphate decarboxylase (svm: 0.889)

SCOP Superfamily: Ribulose-​phoshate binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.38  Contact: 856
Modified z-scores:
dali:0.88 daliz:0.86 gdtts:0.87 tmscore:0.91 rmsd:0.47 AHM:0.47 LBcontacta:0.91 LBcontactb:0.93 LHM:0.19
id:0.96 blosum:0.56 compass:0.56 pearson:0.95
Scaled scores:
dali:0.66 daliz:0.33 gdtts:0.39 tmscore:0.50 rmsd:0.70 AHM:0.62 LBcontacta:0.36 LBcontactb:0.58 LHM:0.42
id:0.05 blosum:0.11 compass:0.25 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:492.00)
Query          1 slqlRLALNqidstvgdiaGNAEAILRWTRHSAEQgAHLVAfpemaltgypvedlalrss     60
d1q6oa_        1 --lpMLQVA-------ldnQTMDSAYETTRLIAEE-VDIIE------------------v     32

Query         61 fveasRTALRELAARLAeEGFGeLPVLVGyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1q6oa_       33 gtilcVGEGVRAVRDLK-ALYPhKIVLAD-------------------------------     60

Query        121 aLTFA----khhlpnygvfdefryfvpGDTM--------pivrlHGVDIALAICEDlwQD    168
d1q6oa_       61 -AKIAdagkilsrmcfeanadwvtvicCADIntakgaldvakefNGDVQIELTGYW--TW    117

Query        169 GGrVPAARSAGAGLLLSVNAS--PYER-dkDDTRLELVRKRAQEaGCTTAYLAMIggqde    225
d1q6oa_      118 EQ-AQQWRDAGIGQVVYHRSRdaQAAGvawGEADITAIKRLSDM-GFKVTVTGGL-----    170

Query        226 lvfdgdsivvdrdgEVVArapqfsegcvvldldlpaaeaepptgvvddglridrlvisee    285
d1q6oa_      171 -----aledlplfkGIPI-----------------------------hvfiagrsirdaa    196

Query        286 plpayeAELA--GGYAdrl    302
d1q6oa_      197 spveaaRQFKrsIAEL--w    213


hit structure      alignment
FAST alignment (Normalized score: 3.60 Raw score:912.50)
Query          1 SLQLRLALNQIDSTVGDIAG-NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1q6oa_        1 -LPMLQVALDN---------QTMDSAYETTRLIAE-EVDIIEVGT---------------     34

Query         60 SFVEASRTA------LRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAA    113
d1q6oa_       35 ---------ILCVGEGVRAVRDLKA-LYPHKIVLA-------------------------     59

Query        114 VLHRG------------------RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH--    153
d1q6oa_       60 -----DAKIADAGKILSRMCFEANADW-------------------------------VT     83

Query        154 ---------------------GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYE    192
d1q6oa_       84 VICCADINTAKGALDVAKEFNGDVQIELTGY--WTW-EQAQQWRDAGIGQVVY-------    133

Query        193 RDKD--------------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRD    238
d1q6oa_      134 ----HRSRDAQAAGVAWGEADITAIKRLSD-MGFKVTVT---------------------    167

Query        239 GEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGY    298
d1q6oa_      168 ------------------------------------------------------------    168

Query        299 ADRL----------------------------------------------    302
d1q6oa_      168 ----GGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW    213


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:130.38)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1q6oa_        1 ----LPMLQVALDN-QTMDSAYETTRLIAEEV----D--IIEVGTILC-------V----     38

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQ--PKYGQPAGAPRN-AAAVLHR    117
d1q6oa_       39 G--EGVRAVRDLKALYP---H--KIVLADAKIAD-A-GKI----------LSR-MCFE--     76

Query        118 GRVALTFAKHHLPNYGVFDEFRYFVPGDTM--PI-VR---LHGVDIALAICEDLWQDGGR    171
d1q6oa_       77 ANADWVTVICCA------------DINTAKGALDVAKEFN----GDVQIELTGYWTWEQ-    119

Query        172 VPAARSAGAGLLLSVNASP--Y--ERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELV    227
d1q6oa_      120 AQQWRDAGI-GQVVYHRSRDAQAAGVAWGEADITAIKRLSD-MGF-KVTVTGG-------    169

Query        228 FDG--DSIVVDRDGEVVA-RAPQ-FSE--------GC--VVLDLDLPAAEAEPPTGVVDD    273
d1q6oa_      170 -LALEDLPLFK---GIPIHVFIAGRSIRDAASPVEAARQFKR------------------    207

Query        274 GLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1q6oa_      208 --------------------SIAELW---    213


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.03)
DALI match                    
Query         29 TRHSAEQGAHLVA     41
d1q6oa_      175 LPLFKGIPIHVFI    187



hit structures. 
top
46: d1auia_ Protein phosphatase-​2B (PP-​2B,​ calcineurin A subunit) (svm: 1.979)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.12  Contact: 814
Modified z-scores:
dali:0.91 daliz:0.82 gdtts:0.95 tmscore:0.97 rmsd:0.44 AHM:0.44 LBcontacta:0.90 LBcontactb:0.90 LHM:0.27
id:0.58 blosum:0.04 compass:0.24 pearson:0.92
Scaled scores:
dali:0.62 daliz:0.24 gdtts:0.42 tmscore:0.52 rmsd:0.71 AHM:0.63 LBcontacta:0.29 LBcontactb:0.45 LHM:0.23
id:-0.03 blosum:0.03 compass:0.11 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 2.1 Raw score:450.60)
Query          1 ------------------------------------------------------------      1
d1auia_        1 tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr     60

Query          1 ------slQLRLALNQidstvgdiagNAEAILRWTRHSAE-qGAHLVAFpEMALTGYpve     53
d1auia_       61 qeknlldiDAPVTVCG------dihgQFFDLMKLFEVGGSpaNTRYLFL-GDYVDRG---    110

Query         54 dlalrssfveasrTALRELAARlaeeGFGELPVLVG--YLDRS-esaqpkygqpagaprn    110
d1auia_      111 ----------yfsIECVLYLWA-lkiLYPKTLFLLRgnHECRHlteyftfkqeckikyse    159

Query        111 aaavlhrgrvaLTFAkhhlpnygvfdefryfvpgdtmpivrlhgvdiaLAICEdlWQDGG    170
d1auia_      160 rvydacmdafdCLPL------------------------aalmnqqflCVHGG--LSPEI    193

Query        171 rVPAArsAGAG-------lllsvnaspyerdKDDT--------------------RLELV    203
d1auia_      194 nTLDD-iRKLDrfkeppaygpmcdilwsdplEDFGnektqehfthntvrgcsyfySYPAV    252

Query        204 RKRAQEAGCTTAYLA-MIGGqdelvfdGDSIvvdrDGEVV-----------arapqFSEG    251
d1auia_      253 CEFLQHNNLLSILRAhEAQD-----agYRMYrksqTTGFPslitifsapnyldvynNKAA    307

Query        252 CVVLDldlpaaeaepptgvvddglridrlviseeplpayeaELAGG--------------    297
d1auia_      308 VLKYE------------------------------------NNVMNirqfncsphpywlp    331

Query        298 ------------------------------------------yadrl    302
d1auia_      332 nfmdvftwslpfvgekvtemlvnvlnicssfeeakgldrinermppr    378


hit structure      alignment
FAST alignment (Normalized score: 2.00 Raw score:674.80)
Query          1 SLQ---------------------------------------------------------      3
d1auia_        1 ---TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGAS     57

Query          4 ------------LRLALNQIDSTVGD-----IAGNAEAILRWTRHSAEQGAH-------L     39
d1auia_       58 ILRQEKNLLDIDAPVTVC--------GDIHGQFFDLMKLFEV----------GGSPANTR     99

Query         40 VAFPEMALTGYPVEDLALRSS-------FVEASRTALRELAARLAEEGFGELPVLVGYLD     92
d1auia_      100 YLFLG----------------DYVDRGYFSIECVLYLWALKI-----LYPK-TLFL----    133

Query         93 RSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTM-----    147
d1auia_      134 -------------------------------------------------------LRGNH    138

Query        148 -----------------------------------PIVRLHGVDIALAICEDL-------    165
d1auia_      139 ECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMN-QQFLCV-----HGGLSPE    192

Query        166 ------------------------------------------------------WQDGGR    171
d1auia_      193 INTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAV    252

Query        172 VPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGC-------------------    212
d1auia_      253 CEFLQHNNLLSILR---------------------------AHEAQDAGYRMYRKSQTTG    285

Query        213 --TTAYLAM-IGG-QDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPT    268
d1auia_      286 FPSLITIF-SAPNYLDVYN--------------------NKAAVLK--------------    310

Query        269 GVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--------------------------    302
d1auia_      311 ----------------------------------YENNVMNIRQFNCSPHPYWLPNFMDV    336

Query        303 ------------------------------------------    303
d1auia_      337 FTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPPR    378


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:117.40)
Query          1 ------------------------------------------------------------      1
d1auia_        1 TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILR     60

Query          1 ------SLQLR-LALNQIDST--------------------------VGDIAGNAEAILR     27
d1auia_       61 QEKNLL-DIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLY    119

Query         28 WTRHSAEQ-GAHLVAFPEMALTGYPVEDLALRSSFVEASR-TA-----------LRELAA     74
d1auia_      120 LWALKILYPKTLFLLR-GNHEC-----------RHLTEYFTFKQECKIKYSERVYDACMD    167

Query         75 RLAEEGFGELPVL---------VGY--------------LDRSESAQPKYGQPAGAPRNA    111
d1auia_      168 AFD----C-LPLAALMNQQFLCVHGGLSPEINTLDDIRK---------------------    201

Query        112 AAVLHRGRVA-----LTF--AKHHLPNY-----------GVFDEFRYFVPGDTMPIVRLH    153
d1auia_      202 ---LDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTH----NTVRGCSYF--------    246

Query        154 GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCT    213
d1auia_      247 ----------Y--SYPAVCEFLQHNNLLSILRAHEAQDA-----GYR-MYRKSQTTGFPS    288

Query        214 TAYLAMIGG-QDELVFDGDSIVVDRDGEVVARAPQFSE----------------------    250
d1auia_      289 LITIFSAPNYLDVYNNKAAVLKYE--NNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE    346

Query        251 --------------------------------GCVVLDLDLPAAEAEPPTGVVDDGLRID    278
d1auia_      347 KVTEMLVNVLNICSSFEEAKGLDRINERMPPR----------------------------    378

Query        279 RLVISEEPLPAYEAELAGGYADRL    302
d1auia_      379 ------------------------    379


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.30)
DALI match              ***********
Query         14 TVGDIAGNAEAILRWTRH     31
d1auia_       74 VCGDIHGQFFDLMKLFEV     91



top
47: d1foba_ Beta-​1,​4-​galactanase (svm: 0.889)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.25  Contact: 979
Modified z-scores:
dali:0.90 daliz:0.88 gdtts:0.89 tmscore:0.93 rmsd:0.47 AHM:0.49 LBcontacta:0.93 LBcontactb:0.90 LHM:0.20
id:0.89 blosum:0.21 compass:0.23 pearson:0.94
Scaled scores:
dali:0.69 daliz:0.33 gdtts:0.38 tmscore:0.53 rmsd:0.74 AHM:0.63 LBcontacta:0.35 LBcontactb:0.46 LHM:0.41
id:0.02 blosum:0.07 compass:0.17 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:578.00)
Query          1 -------------------------------------slQLRLALNqidsTVGD--iaGN     21
d1foba_        1 altyrgadisslllledegysyknlngqtqaletiladaGINSIRQ--rvWVNPsdgsYD     58

Query         22 AEAILRWTRHSAEQGAhLVAFPemALTG------yPVED-----lalRSSFVEASRTALR     70
d1foba_       59 LDYNLELAKRVKAAGM-SLYLD--LHLSdtwadpsDQTTpsgwsttdLGTLKWQLYNYTL    115

Query         71 ELAARLAEEGFgeLPVLVGYL--------drsESAQpkygQPAGAP-------rnaaavl    115
d1foba_      116 EVCNTFAENDI--DIEIISIGneiragllwplGETS----SYSNIGallhsgawgvkdsn    169

Query        116 HRGRvALTFAKHHlpnygvfdefryfvpgdtmpivrlhgvdiaLAICE----dlWQDGGR    171
d1foba_      170 LATTpKIMIHLDD--gwswdqqnyfyetvlatgellstdfdyfGVSYYpfysasATLASL    227

Query        172 VPAARSA----gaGLLLSVnaspyERDK----------------dDTRLELVRKRAQEAG    211
d1foba_      228 KTSLANLqstydkPVVVVE-tnwpVSCPnpayafpsdlssipfsvAGQQEFLEKLAAVVE    286

Query        212 ----CTTAYLAMiggqdelvfdgdsivvdrdgevvarAPQFSegcvvldldlpaaeaepp    267
d1foba_      287 attdGLGVYYWE------------------------pAWIGN------------------    304

Query        268 tgvvddglridrlviseeplpayeaelaggYADRL--------------    302
d1foba_      305 -------------------aglgsscadnlMVDYTtdevyesietlgel    334


hit structure      alignment
FAST alignment (Normalized score: 2.55 Raw score:808.70)
Query          1 SLQ----------------------------------------LRLALNQIDSTVGDIAG     20
d1foba_        1 ---ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIR------------     45

Query         21 ------------NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL-----------     57
d1foba_       46 QRVWVNPSDGSYDLDYNLELAKRVKAAG-MSLYL---------------DLHLSDTWADP     89

Query         58 -------------RSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQP    104
d1foba_       90 SDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAEND------------------------    125

Query        105 AGAPRNAAAVLHRGRV--------------------------------------------    120
d1foba_      126 ----------------IDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSN    169

Query        121 ----ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGV---------------------    155
d1foba_      170 LATTPKIMIH-----------------------------LDDGWSWDQQNYFYETVLATG    200

Query        156 -------DIALAICEDLWQ----------DGGRVPAARSAGA------GLLLSVNASPYE    192
d1foba_      201 ELLSTDFDYFGVS------YYPFYSASATLASLKTSLAN---LQSTYDKPVVV-------    244

Query        193 RDKD---------------------------DTRLELVRKRAQEAGCTT--------AYL    217
d1foba_      245 ----VETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAV-----VEATTDGLGVY    295

Query        218 AMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRI    277
d1foba_      296 Y-----------------------------------------------------------    296

Query        278 DRLVISEEPLPAYEAELAGGYADRL-----------------------------------    302
d1foba_      297 -------------------------WEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETL    331

Query        303 ---    303
d1foba_      332 GEL    334


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:126.98)
Query          1 --SLQLRL-----------------------------------ALNQIDSTVGDI-AGNA     22
d1foba_        1 AL--TYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYD     58

Query         23 -EAILRWTRHSAEQGAHLVAFPEMALT-GYP-VEDLALRSSFV------E--ASR-TALR     70
d1foba_       59 LDYNLELAKRVKAAGM-SLYLDLHLSDTWADPSDQTT-PSGWSTTDLGTLKW-QLYNYTL    115

Query         71 ELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLP    130
d1foba_      116 EVCNTFAENDI--DIEIIS---------------------IGN-----------EI-RAG    140

Query        131 -----NYGVFDEFRYF-VPGD--TM-PI--VR--LHGVDIALAICE------DLWQ-DGG    170
d1foba_      141 LLWPL-----GETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYET    195

Query        171 RVP-A-ARSAGAGLLLSVNASP-YERD-KDD-TRLELVRKRAQEAGCTTAYLAMI-----    220
d1foba_      196 VLATGELLST-D-FDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSC    253

Query        221 ------------------------GGQDELVFDGD--SI-VVDRDGEVVARAPQFSEG--    251
d1foba_      254 PNPAYAFPSDLSSIPFSVAGQQEF----------LEKLAAVVEATTDGLGVYYWEPAWIG    303

Query        252 ---------------------------CVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISE    284
d1foba_      304 NAGLGSSCADNLMVDYTTDEVYESIET---------------------------------    330

Query        285 EPLPAYEAELAGGYADRL    302
d1foba_      331 ----------LGEL----    334


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.09)
DALI match       *****************....
Query         21 NAEAILRWTRHSAEQGAHLVA     41
d1foba_       58 DLDYNLELAKRVKAAGMSLYL     78



top
48: d1j93a_ Uroporphyrinogen decarboxylase,​ UROD (svm: 0.875)

SCOP Superfamily: UROD/​MetE-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.22  Contact: 684
Modified z-scores:
dali:0.85 daliz:0.87 gdtts:0.90 tmscore:0.90 rmsd:0.36 AHM:0.39 LBcontacta:0.88 LBcontactb:0.88 LHM:0.39
id:0.95 blosum:0.75 compass:0.48 pearson:0.95
Scaled scores:
dali:0.73 daliz:0.40 gdtts:0.50 tmscore:0.60 rmsd:0.81 AHM:0.72 LBcontacta:0.35 LBcontactb:0.52 LHM:0.26
id:0.07 blosum:0.14 compass:0.27 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:517.50)
Query          1 ------------------------------------------------------------      1
d1j93a_        1 tqpllldavrgkeverppvwlmrqagrymksyqllcekyplfrdrsenvdlvveislqpw     60

Query          1 ------------------------------------------------------------      1
d1j93a_       61 kvfrpdgvilfsdiltplsgmnipfdiikgkgpvifdplrtaadvekvrefipeksvpyv    120

Query          1 ------------sLQLRLALN-qidSTVG---------------------------DIAG     20
d1j93a_      121 gealtilrkevnnQAAVLGFVgapfTLASyvveggssknftkikrlafaepkvlhaLLQK    180

Query         21 NAEAILRWTRHSAEQGAHLVAFPEMaltgypvedLALRSSFVEASRTALRELAARLAEEg     80
d1j93a_      181 FATSMAKYIRYQADSGAQAVQIFDS------watELSPVDFEEFSLPYLKQIVDSVKLT-    233

Query         81 FGELPVLVGY---lDRSEsaqpkygqpagaprnaaavlhrgRVALTFAKHhlpnygvfde    137
d1j93a_      234 HPNLPLILYAsgsgGLLE------------------rlpltGVDVVSLDW----------    265

Query        138 fryfvPGDTMpivrlhgvdialaiceDLWQD----ggrvPAARSAGaglllsvnaspyer    193
d1j93a_      266 -----TVDMAdgrrrlgpnvaiqgnvDPGVLfgskefitNRINDTV---kkagkgkhiln    317

Query        194 dkddtRLELvRKRAQEAGcttaylamiggqdelvfdgdsivvdrdgevvarapqfsegcv    253
d1j93a_      318 lghgiKVGTpEENFAHFF------------------------------------------    335

Query        254 vldldlpaaEAEPptgvvddglridrlviseeplpayeaelaggyadrl    302
d1j93a_      336 -----eiakGLRY------------------------------------    343


hit structure      alignment
FAST alignment (Normalized score: 2.91 Raw score:937.50)
Query          1 S-----------------------------------------------------------      1
d1j93a_        1 -TQPLLLDAVRGKEVERPPVWLMRQAGRYMKSYQLLCEKYPLFRDRSENVDLVVEISLQP     59

Query          2 ------------------------------------------------------------      2
d1j93a_       60 WKVFRPDGVILFSDILTPLSGMNIPFDIIKGKGPVIFDPLRTAADVEKVREFIPEKSVPY    119

Query          2 --------------LQLRLALNQIDSTV--------------------------------     15
d1j93a_      120 VGEALTILRKEVNNQAAVLGFV------GAPFTLASYVVEGGSSKNFTKIKRLAFAEPKV    173

Query         16 --GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL--------RSSFV-EA     64
d1j93a_      174 LHALLQKFATSMAKYIRYQADSGAQAVQI---------------FDSWATELSPVDFEEF    218

Query         65 SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG------    118
d1j93a_      219 SLPYLKQIVDSVKL-THPNLPLILY-----------------------------ASGSGG    248

Query        119 --------RVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVD--------------    156
d1j93a_      249 LLERLPLTGVDVVSL-------------------------------DWTVDMADGRRRLG    277

Query        157 ---IALAICEDLWQDG------------------GRVPAARSAGA---GLLLSV---NAS    189
d1j93a_      278 PNVAIQGN--------VDPGVLFGSKEFITNRINDTVKK------AGKGKHIL-NLGHGI    322

Query        190 PYERDKD-----DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVAR    244
d1j93a_      323 K------VGTPEENFAHFFEIAK-------------------------------------    339

Query        245 APQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL--    302
d1j93a_      340 ----------------------------------------------------------GL    341

Query        303 --    303
d1j93a_      342 RY    343


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:131.70)
Query          1 SLQLRL------------------------------------------------------      6
d1j93a_        1 -TQPLLLDAVRGKEVERPPVWLMRQAGRYMKSYQLLCEKYPLFRDRSENVDLVVEISLQP     59

Query          7 ------ALNQIDSTVGDIAGN--------------------------------A---E-A     24
d1j93a_       60 WKVFRPDGVILFSDILTPLSGMNIPFDIIKGKGPVIFDPLRTAADVEKVREFIPEKSVPY    119

Query         25 ILRWTRHSAE--QGAHLVAFPEMAL-TG-YP-----VE--D-LAL---------RSSFVE     63
d1j93a_      120 VGEALTILRKEVNNQAAVLGFVGAPFTLASYVVEGGSSKNFTKIKRLAFAEPKVLHALLQ    179

Query         64 ASRTALRELAARLAEEGFGELPVLVGYLDRS--ESAQPKYGQPAGAPR-NAA-AV--LHR    117
d1j93a_      180 KFATSMAKYIRYQADS-G--AQAVQIFDSWATE---L-SPVDFEEFSLPYLKQIVDSVKL    232

Query        118 GRV-ALTFA-KHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAA    175
d1j93a_      233 THPNLPLILYASGSGG------L--LERLPLTGVD--------VVSLDWTVDMADGRRRL    276

Query        176 RSAGAGLLLSVNASPYERDKDD--TRLELVRKRAQEAGCT-TAYLA-MIGGQDELVFD-G    230
d1j93a_      277 GPN-V--AIQGNVD-PGVLFGSKEFITNRINDTVKKAGKGKHILNLGHGI----KVGTPE    328

Query        231 --DSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLP    288
d1j93a_      329 ENFAHFF---EIAKG-------------LRY-----------------------------    343

Query        289 AYEAELAGGYADRL    302
d1j93a_      344 --------------    344


hit structure      alignment
HHsearch alignment (Probability: 0.14 E-value:0.02)
DALI match       ****************************               *****************
Query         18 IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLA     77
d1j93a_      178 LQKFATSMAKYIRYQADSGAQAVQIFDSWATELSPVD------FEEFSLPYLKQIVDSVK    231

DALI match       **.. ******
Query         78 EEGFGELPVLV     88
d1j93a_      232 LTHP-NLPLIL    241



top
49: d1tf7a1 Circadian clock protein KaiC (svm: 1.007)

SCOP Superfamily: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Fold: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 540
Modified z-scores:
dali:0.86 daliz:0.90 gdtts:0.87 tmscore:0.86 rmsd:0.36 AHM:0.41 LBcontacta:0.81 LBcontactb:0.86 LHM:0.39
id:0.91 blosum:0.79 compass:0.62 pearson:0.91
Scaled scores:
dali:0.75 daliz:0.44 gdtts:0.54 tmscore:0.58 rmsd:0.79 AHM:0.72 LBcontacta:0.40 LBcontactb:0.66 LHM:0.28
id:0.08 blosum:0.14 compass:0.29 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:411.50)
Query          1 ----------------------------------------------------sLQLRLAL      8
d1tf7a1        1 ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiieFDEPGVF     60

Query          9 NQID------------------------------------stvgDIAGNAEAILRWTRHS     32
d1tf7a1       61 VTFEetpqdiiknarsfgwdlaklvdegklfildaspdpegqevVGGFDLSALIERINYA    120

Query         33 A-EQGAHLVAFPemALTGypvedlalrssFVEASRTALRELAARLAEEgfgELPVLVGYl     91
d1tf7a1      121 IqKYRARRVSID--SVTS-----vfqqydASSVVRRELFRLVARLKQI---GATTVMTT-    169

Query         92 drsesaqpkygqpagAPRNaaavlhrgrVALTFAKHHLPNygvfdefryfvpgdtmpivr    151
d1tf7a1      170 ---------erieeyGPIA-rygveefvSDNVVILRNVLE---------------gerrr    204

Query        152 lhgvdialaicedlwqdgGRVPaarsagaglllsvnaspyerdkddtrlelvrkRAQEAg    211
d1tf7a1      205 rtleilklrgtshmkgeyPFTI--------------------------------TDHGI-    231

Query        212 cttaylamiggqdelvfdgdsivvdrdgevvarapqfsegcvvldldlpaaeaePPTGvv    271
d1tf7a1      232 ---------------------------------------------------nifPLGA--    238

Query        272 ddglridrlviseeplpayeaelaggyadrl    302
d1tf7a1      239 ---------------------------mrlt    242


hit structure      alignment
FAST alignment (Normalized score: 2.60 Raw score:703.80)
Query          1 ----------------------------------------------------SLQLRLAL      8
d1tf7a1        1 EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVF     60

Query          9 NQIDST-----------------------------------------VGDIAGNAEAILR     27
d1tf7a1       61 V-----TFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIE    115

Query         28 WTRHSA-EQGAHLVAFPEMALTGYPVEDLALRSS----------FVEASRTALRELAARL     76
d1tf7a1      116 RINYAIQKYRARRVSID-----------------SVTSVFQQYDASSVVRRELFRLVARL    158

Query         77 AEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG---------------RVA    121
d1tf7a1      159 KQI---GATTVMTTER--------------------------IEEYGPIARYGVEEFVSD    189

Query        122 LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAG    181
d1tf7a1      190 NVVILRNV----------------------------------------------------    197

Query        182 LLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEV    241
d1tf7a1      198 ------------------------------------------------------------    198

Query        242 VARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADR    301
d1tf7a1      198 ------------------------------------------------------------    198

Query        302 L---------------------------------------------    302
d1tf7a1      198 -LEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLT    242


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:100.58)
Query          1 -----SLQL------------RL-----ALNQIDSTVGDIAGNAEAILRWTRHSAEQGAH     38
d1tf7a1        1 EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTS-------G--TG--KT---------     40

Query         39 LVAF--------PEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGE------L     84
d1tf7a1       41 LFSIQFLYNGII----------------------------------------EFDEPGV-     59

Query         85 PVL-VG-YLDRSESAQPKYGQPAGAPRNAAA-VLHRGRVALT--------FAKHHLPNYG    133
d1tf7a1       60 --FV-TFEET----------------PQDIIKNARSFGWDLAKLVDEGKLFILDAS----     96

Query        134 VFDEFRYF-------VPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSV    186
d1tf7a1       97 ---PDPEGQEVVGGF---------------------DLSALIERINYAIQKYRARRVSID    132

Query        187 N-AS--P-YERDKD-DT-RLELVRKRAQEAGCTTAYLAMIGG-----QDELVFDGDSIVV    235
d1tf7a1      133 SVTSVFQQYDASSVVRRELFRLVARLKQ-IGATTVMTTERIEEYGPI----ARYGVEEFV    187

Query        236 DRDGEVVARAP--QFSE--------GCVV-LDLDLPAAEAEPPTGVVDDGLRIDRLVISE    284
d1tf7a1      188 -----SDNVVILR--NVLEGERRRRTLEILKLRG--------------------------    214

Query        285 EPLPAYEAELAGG----------------------YADRL    302
d1tf7a1      215 -------TSHMKGEYPFTITDHGINIFPLGAMRLT-----    242


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.33)
DALI match                                                         
Query        203 VRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGC    252
d1tf7a1      154 LVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERR    203



top
50: d7odca2 Eukaryotic ornithine decarboxylase (svm: 0.601)

SCOP Superfamily: PLP-​binding barrel  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.00  Contact: 650
Modified z-scores:
dali:0.86 daliz:0.87 gdtts:0.93 tmscore:0.92 rmsd:0.34 AHM:0.36 LBcontacta:0.84 LBcontactb:0.85 LHM:0.22
id:0.76 blosum:0.24 compass:0.08 pearson:0.81
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.54 tmscore:0.62 rmsd:0.79 AHM:0.69 LBcontacta:0.31 LBcontactb:0.48 LHM:0.35
id:0.02 blosum:0.06 compass:0.11 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:454.80)
Query          1 ------------slqlrlalnQIDSTV------------------gdIAGNAEAIL---R     27
d7odca2        1 dlgdilkkhlrwlkalprvtpFYAVKCndsraivstlaaigtgfdcaSKTEIQLVQglgV     60

Query         28 WTRhsaeqgahlvafpemaltgypvedlalrssfveASRTALRELAARLaeegfgelpVL     87
d7odca2       61 PAE-------------------------rviyanpcKQVSQIKYAASNG--------vQM     87

Query         88 VGylDRSEsaqpkygqpagaprnaaavlhrgRVAL--tfAKHHLpnygvfdefryFVPGD    145
d7odca2       88 MT-fDSEI----------------elmkvarAHPKaklvLRIAT-----------KFGAT    119

Query        146 T------mpivrlhgvdiALAIC-------------eDLWQdgGRVPAARSAGAGLLLSV    186
d7odca2      120 LktsrlllerakelnidvIGVSFhvgsgctdpdtfvqAVSDarCVFDMATEVGFSMHLLD    179

Query        187 NASPYE--------RDKD-DTRLELVRKRAQeagCTTAYLAMIG--GQDElvfdgdsivv    235
d7odca2      180 IGGGFPgsedtklkFEEItSVINPALDKYFP-sdSGVRIIAEPGryYVAS----------    228

Query        236 drdgevvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaela    295
d7odca2      229 ------------------------------------------------------------    229

Query        296 ggyadrl    302
d7odca2      229 ------a    229


hit structure      alignment
FAST alignment (Normalized score: 2.56 Raw score:674.00)
Query          1 SLQ---------------------------------------------------------      3
d7odca2        1 ---DLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQG     57

Query          4 ------LRLALNQIDSTVGDIAGNAEA-----ILRWTRHSAEQGAHLVAFPEMALTGYPV     52
d7odca2       58 LGVPAERVIY-----------------ANPCKQVSQIKYAASNGVQMMT-----------     89

Query         53 EDLALRSSFVEASRTA--LRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRN    110
d7odca2       90 ----------------FDSEIELMKVAR-AHPKAKL------------------------    108

Query        111 AAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGV---------------    155
d7odca2      109 ---------------------------------------------VLRIATKFGATLKTS    123

Query        156 --------------DIALAICEDLWQDG-------------GRVPAARS---------AG    179
d7odca2      124 RLLLERAKELNIDVIGVSF---------HVGSGCTDPDTFVQAVSDARCVFDMATEVGFS    174

Query        180 AGLLLSVNASPYERDKD--------DTRLELVRKRAQEA------GCTTAYLAMIGGQDE    225
d7odca2      175 MHLLDIGGGFPG-----SEDTKLKFEEITSVINPALDK-YFPSDSGVRIIAEP-------    221

Query        226 LVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEE    285
d7odca2      222 ------------------------------------------------------------    222

Query        286 PLPAYEAELAGGYADRL--------    302
d7odca2      222 -----------------GRYYVASA    229


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:110.21)
Query          1 ---SLQLRLALNQIDSTVGDIAG-NAEAILRWT-RHSAEQGAHLVAFPEMALTGYPVEDL     55
d7odca2        1 DLG------------------DIL-KKHLRWLKALPRV------TPF---YAV-------     25

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVL    115
d7odca2       26 ------K-CNDS--RAIVSTLAAI-G--T-GFDCA-SKT----------------EIQLV     55

Query        116 HRGRV-A--LTFAKHHLPNYGVFDEFRYFVPGD-TM--PI-VRLHGVDIALAICEDLWQD    168
d7odca2       56 QGLGVPAERVIYANPC--------------KQVSQIKYAASNG----VQMMT---FDS-E     93

Query        169 GGRVPAARS-AGAGLLLSVNASP----YERDKDDTRLELVRKRAQEAG-CTTAYLAMIGG    222
d7odca2       94 IE-LMKVARAHPKAKLVL-RIATKFGA-----TLKTSRLLLERAKELNIDVIGVSFHVGS    146

Query        223 QDEL--VF-DGD--S--IV--VDRDGEVVARAPQ----------------F--SEG--C-    252
d7odca2      147 GCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSEDTKLKFEEITSVINPALD    206

Query        253 --VVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG-------------    297
d7odca2      207 KYFPS-------------------------------------DSGVRIIAEPGRYYVASA    229

Query        298 YADRL    302
d7odca2      230 -----    230


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.34)
DALI match                             
Query         21 NAEAILRWTRHSAEQGAHLVAF     42
d7odca2      119 TLKTSRLLLERAKELNIDVIGV    140



hit structures. 
top
51: d1ogsa2 Glucosylceramidase,​ catalytic domain (svm: 0.886)

SCOP Superfamily: (Trans)glycosidases  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.15  Contact: 883
Modified z-scores:
dali:0.87 daliz:0.86 gdtts:0.89 tmscore:0.92 rmsd:0.45 AHM:0.43 LBcontacta:0.90 LBcontactb:0.90 LHM:0.17
id:0.63 blosum:0.02 compass:0.04 pearson:0.76
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.40 tmscore:0.52 rmsd:0.74 AHM:0.69 LBcontacta:0.33 LBcontactb:0.49 LHM:0.46
id:-0.02 blosum:-0.01 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 3.3 Raw score:558.80)
Query          1 -----------------------------------slqlRLALN-qiDSTV---gDIAG-     20
d1ogsa2        1 vkgfggamtdaaalnilalsppaqnlllksyfseegigyNIIRVpmaSCDFsirtYTYAd     60

Query         21 -----------naEAIL-RWTRHSAEQG-----aHLVAfpeMALT--------gypveDL     55
d1ogsa2       61 tpddfqlhnfslpEEDTkLKIPLIHRALqlaqrpVSLL-asPWTSptwlktngavngkGS    119

Query         56 ALR---SSFVEASRTALRELAARLAEEGFgeLPVLV------gyldrsesaqpkygqpaG    106
d1ogsa2      120 LKGqpgDIYHQTWARYFVKFLDAYAEHKL--QFWAVtaenepsagllsgypfqclgftpE    177

Query        107 APR------naaavlhrgRVAL-TFAKhhlpnygvfdefryfvpgdtmpivrlhgvdiAL    159
d1ogsa2      178 HQRdfiardlgptlanstHHNVrLLML-----ddqrlllphwakvvltdpeaakyvhgIA    232

Query        160 AIC--edlWQDGGRVPAAR---SAGAglLLSVNaspYERD-----------kdDTRLELV    203
d1ogsa2      233 VHWyldflAPAKATLGETHrlfPNTM-lFASEA-cvGSKFweqsvrlgswdrgMQYSHSI    290

Query        204 RKRAQEAgCTTAYLA-------migGQDELVFDGD------------sivvdrdgEVVAr    244
d1ogsa2      291 ITNLLYH-VVGWTDWnlalnpeggpNWVRNFVDSPiivditkdtfykqpmfyhlgHFSK-    348

Query        245 apqfsegcvvlDLDLpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1ogsa2      349 ---------fiPEGS-------------------------------------------    354


hit structure      alignment
FAST alignment (Normalized score: 2.41 Raw score:788.10)
Query          1 ------------------------------------------------------------      1
d1ogsa2        1 VKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYAD     60

Query          1 --------------------------------SLQLRLALNQIDSTVG------------     16
d1ogsa2       61 TPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASP-WTSP--TWLKTNGAVNGK    117

Query         17 ----------DIAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGYPVEDLALRSS----     60
d1ogsa2      118 GSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVT-------------------AENE    158

Query         61 ----------------FVEASRTALR-ELAARLAEEGFGELPVLVGYLDRSESAQPKYGQ    103
d1ogsa2      159 PSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLL----------------    202

Query        104 PAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHG---------    154
d1ogsa2      203 ---------------------------------------------------MLDDQRLLL    211

Query        155 ------------------VDIALAICEDLWQDG-----GRVPAARSAGAGLLLSVNASP-    190
d1ogsa2      212 PHWAKVVLTDPEAAKYVHGIAVHW---YLDF--LAPAKATLG-----------------E    249

Query        191 ------------------------YERDKD--DTRLELVRKRAQEA-----GCTTAYLAM    219
d1ogsa2      250 THRLFPNTMLFASEACVGSKFWEQSVRL--GSWDRGMQYSHSIIT-NLLYHVVGWTD---    303

Query        220 IGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDR    279
d1ogsa2      304 ------------------------------------------------------------    304

Query        280 LVISEEPLPAYEAELAGGYADRL-------------------------------------    302
d1ogsa2      304 -----------------------WNLALNPEGGPNWVRNFVDSPIIVDITKDTFYKQPMF    340

Query        303 --------------    303
d1ogsa2      341 YHLGHFSKFIPEGS    354


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:123.26)
Query          1 ------------------------------------------------------------      1
d1ogsa2        1 VKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYAD     60

Query          1 -------------------------------SLQLRLALNQIDS---------T---VGD     17
d1ogsa2       61 TPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSL    120

Query         18 I-------A-GNAEAILRWTRHSAE-QGAHLVAF-PEMALTGYPVEDLA------LRSSF     61
d1ogsa2      121 KGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENE--PSAGLLSGYPFQCLG---FT    175

Query         62 VEASRTALR-ELAARLAEEGFGELPVLVGYLD--RSESAQPKYGQPAGAPR------NAA    112
d1ogsa2      176 PEHQRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPH---------WAKVVLTDPE---    223

Query        113 AVLHRGRVALTFAKHHLPNYGVFDEF--RYFVPGDTMPI------VRLHGVDIALAICED    164
d1ogsa2      224 ---AAKYVHGIAVHWYLDFL-----APA---KATLGETHRLFPNT------MLFASEACV    266

Query        165 LW-------------Q--D-GGRVPAARSAGAGLLLSVN---------ASPYERDKDDTR    199
d1ogsa2      267 GSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGP-NWVRNF--VDS    323

Query        200 LEL---------VRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSE    250
d1ogsa2      324 PIIVDITKDTFYKQPMFYHLGHFS----------------------KF------------    349

Query        251 GCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL    302
d1ogsa2      350 --------IPEGS---------------------------------------    354


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.68)
DALI match                         
Query         22 AEAILRWTRHSAEQGAHL     39
d1ogsa2      133 ARYFVKFLDAYAEHKLQF    150



top
52: d1onra_ Transaldolase (svm: 0.633)

SCOP Superfamily: Aldolase  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.16  Contact: 882
Modified z-scores:
dali:0.91 daliz:0.91 gdtts:0.90 tmscore:0.91 rmsd:0.41 AHM:0.46 LBcontacta:0.89 LBcontactb:0.87 LHM:0.19
id:0.75 blosum:0.45 compass:0.23 pearson:0.94
Scaled scores:
dali:0.71 daliz:0.39 gdtts:0.44 tmscore:0.54 rmsd:0.76 AHM:0.66 LBcontacta:0.37 LBcontactb:0.51 LHM:0.44
id:0.00 blosum:0.09 compass:0.13 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:487.30)
Query          1 ------------------------slQLRLALNQID------------------------     12
d1onra_        1 tdkltslrqyttvvadtgdiaamklyQPQDATTNPSlilnaaqipeyrkliddavawakq     60

Query         13 ----stvgDIAGNAEAILRWTRHSAEQGAHLVAFpemaLTGYpvedlalrssFVEASRTA     68
d1onra_       61 qsndraqqIVDATDKLAVNIGLEILKLVPGRIST---eVDAR-------lsyDTEASIAK    110

Query         69 LRELAARLAEEGFG-ELPVLVG---yLDRSesaqpkygqpagaprnaaavlhrgRVAL-t    123
d1onra_      111 AKRLIKLYNDAGISnDRILIKLastwQGIR----------------aaeqlekeGINCnl    154

Query        124 fAKHHlpnygvfdefryfvpgDTMPivrlhgvdIALAiceDLWQ----------------    167
d1onra_      155 tLLFS------------faqaRACA---eagvfLISP---FVGRildwykantdkkeyap    196

Query        168 -----dGGRVPAARSAG----aglLLSVnaspyerdkddtRLELVRKRaqeaGCTTAYLa    218
d1onra_      197 aedpgvVSVSEIYQYYKehgyetvVMGA---------sfrNIGEILEL---aGCDRLTI-    243

Query        219 miggqdelvfdgdsivvdrdgeVVARapqfsegcvvldldlpaaEAEPP-----------    267
d1onra_      244 --------------------apALLK---elaesegaierklsyTGEVKarparitesef    280

Query        268 -tgvvddglridrlviseeplpayeaelaggyadrl    302
d1onra_      281 lwqhnqdpmavdklaegirkfaidqeklekmigdll    316


hit structure      alignment
FAST alignment (Normalized score: 2.76 Raw score:851.30)
Query          1 ----------SLQL--------------RLALNQIDSTVG--------------------     16
d1onra_        1 TDKLTSLRQYTTVVADTGDIAAMKLYQPQDATT-------NPSLILNAAQIPEYRKLIDD     53

Query         17 ---------------DIAGNAEAILRWTRHSAEQG--AHLVAFPEMALTGYPVEDLALRS     59
d1onra_       54 AVAWAKQQSNDRAQQIVDATDKLAVNIGLEILK--LVPGRIST-----------------     94

Query         60 S--------FVEASRTALRELAARLAEEGFGEL----PVLVGYLDRSESAQPKYGQPAGA    107
d1onra_       95 -EVDARLSYDTEASIAKAKRLIKLYNDAG----ISNDRILI-------------------    130

Query        108 PRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICE----    163
d1onra_      131 --------------------------------------------------------KLAS    134

Query        164 ---------------------DLWQDGGRVPAARSAGAGLLLSVNASPYERDK-------    195
d1onra_      135 TWQGIRAAEQLEKEGINCNLTLLFSF-AQARACAEAGVFLIS-----------PFVGRIL    182

Query        196 ---------------DDTRLELVRKRAQEA------GCTTAYLAMIGGQDELVFDGDSIV    234
d1onra_      183 DWYKANTDKKEYAPAEDPGVVSVSEIYQY-YKEHGYETVVMG------------------    223

Query        235 VDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAEL    294
d1onra_      224 ------------------------------------------------------------    224

Query        295 AGGYADRL----------------------------------------------------    302
d1onra_      224 --------ASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARI    275

Query        303 -----------------------------------------    303
d1onra_      276 TESEFLWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL    316


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:131.12)
Query          1 --------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTG---     49
d1onra_        1 TDKLTSLR--QYTTVVADT----------G-D-IAAMKLYQ---PQDATTNPSLILNAAQ     43

Query         50 ----------------------YPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVL     87
d1onra_       44 IPEYRKLIDDAVAWAKQQSNDR--------AQQIVDATDKLAVNIGLEIL-KLV-PGRIS     93

Query         88 VGYLDRSESAQPKYGQPAGAPRN--AAAV--LH--RGRV--ALTFAKHHLPNYGVFDEFR    139
d1onra_       94 TEVDARLS-YD-TE---ASIAKAKR--LIKLYNDAGISNDRILIKLASTW----------    136

Query        140 YFVPGD-TM-PI----VRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASP-YE    192
d1onra_      137 --QGIRAAEQLEKEGI-------NCNLTL-LFS-FAQARACAEAGVF-LISPFVGRILDW    184

Query        193 -R-----DKD----DTRLELVRKRAQEAGC-----TTAYLAMIGGQDELVFDGDSIVVDR    237
d1onra_      185 YKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVVMGASF---------RNIGEIL--    233

Query        238 DGEVVAR--A-PQFSEGC--VV-----LDL-DLP------AAEAEPP-TGVVDDG-----    274
d1onra_      234 --ELAGCDRLT-IAPALLKELAESEGAIERKLSYTGEVKA------RP--ARITESEFLW    282

Query        275 ----------------------------------LRIDRLVISEEPLPAYEAELAGGYAD    300
d1onra_      283 QHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL--------------------------    316

Query        301 RL    302
d1onra_      317 --    317


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.29)
DALI match                                      
Query          9 NQIDSTVG-DIAGNAEAILRWTRHSAEQGAH     38
d1onra_       94 TEVDARLSYDTEASIAKAKRLIKLYNDAGIS    124



top
53: d1kkoa1 beta-​Methylaspartase (svm: 0.887)

SCOP Superfamily: Enolase C-​terminal domain-​like  |  SCOP Fold: TIM beta/​alpha-​barrel  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.17  Contact: 786
Modified z-scores:
dali:0.85 daliz:0.82 gdtts:0.91 tmscore:0.93 rmsd:0.44 AHM:0.49 LBcontacta:0.70 LBcontactb:0.74 LHM:0.16
id:0.85 blosum:0.05 compass:0.39 pearson:0.78
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.44 tmscore:0.56 rmsd:0.74 AHM:0.62 LBcontacta:0.23 LBcontactb:0.35 LHM:0.48
id:0.02 blosum:0.02 compass:0.05 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:503.60)
Query          1 ------------------------slqLRLALNQIDSTVG------DIAGNAEAILRWTR     30
d1kkoa1        1 pcvpeaiplfgqsgddryiavdkmilkGVDVLPHALINNVeeklgfKGEKLREYVRWLSD     60

Query         31 HSAEQG----AHLVAFPEMaltgypvedlalRSSFvEASRTALRELAARLAeegfgeLPV     86
d1kkoa1       61 RILSLRssprYHPTLHIDV----ygtiglifDMDP-VRCAEYIASLEKEAQ------GLP    109

Query         87 LVGY-LDRSESAQpkygqpaGAPRnaaavlhrgrVALT---fakHHLPnygvfdefryfv    142
d1kkoa1      110 LYIEgPVDAGNKP----dqiRMLTaitkeltrlgSGVKivadewCNTY----------qd    155

Query        143 pGDTMpivrlhgvdiaLAICE------dlwQDGGrVPAARSAGaglllsvnaSPYErdkD    196
d1kkoa1      156 iVDFT-----dagschMVQIKtpdlggihnIVDA-VLYCNKHG--meayqggTCNE--tE    205

Query        197 DTRLELVRKRAQEAgctTAYLamiggqdelvfdgdsivvdrdgevvaraPQFSegcvvld    256
d1kkoa1      206 ISARTCVHVALAAR--pMRML-------------------------ikpGMGF-------    231

Query        257 ldlpaaeaepptgvvddglridrlviseeplpayeaelaggyadrl    302
d1kkoa1      232 --------------------------deglnivfnemnrtiallqt    251


hit structure      alignment
FAST alignment (Normalized score: 2.19 Raw score:602.50)
Query          1 S--LQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL---     55
d1kkoa1        1 -PCVPEAIP--LFGQSGDDRYIAVDKMIL----------------------------KGV     29

Query         56 -------ALRSSF-------VEASRTALRELAARLAEEG---FGELPVLVGYLDRSESAQ     98
d1kkoa1       30 DVLPHALINNV--EEKLGFKGEKLREYVRWLSDRILS--LRSSPRYHPTLHID-------     78

Query         99 PKYGQPAGAPRNAAAVLHRGRV-----------------------------ALTFAKHHL    129
d1kkoa1       79 ----------------------VYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYI----    112

Query        130 PNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDL------------------------    165
d1kkoa1      113 ------------------------------------EGPVDAGNKPDQIRMLTAITKELT    136

Query        166 --------------WQDGGRVPAARSA-GAGLLLSVNASPYERDKD-----------DTR    199
d1kkoa1      137 RLGSGVKIVADEWCNTYQ-DIVDFTDAGSCHM--------------VQIKTPDLGGIHNI    181

Query        200 LELVRKRAQEA-GCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLD    258
d1kkoa1      182 VDAVLYCNK--HGMEAYQGG----------------------------------------    199

Query        259 LPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRL----------------    302
d1kkoa1      200 --------------------------------------------TCNETEISARTCVHVA    215

Query        303 ------------------------------------    303
d1kkoa1      216 LAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT    251


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:139.16)
Query          1 ----SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d1kkoa1        1 PCVP----EAIPLFGQSG--D--DRYIAVDKMILKGV------DVLP--HALI--N--N-     39

Query         57 LRSSFV----EASRTALRELAARLAEEG-FGELPVLVGY-L--DRS-ESAQPKYGQPAGA    107
d1kkoa1       40 -VEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGL-IFD--MDPVRCA     95

Query        108 PRNA-AAVLHRGRVALTFAK-HHLP-NYGVFDEFRYF-VPGD-TM--PIVRLHGVDIALA    160
d1kkoa1       96 EYIAS-LEKE-AQGLPLYIEGPVDAGNKP--DQIRMLTAITKELTRLGSG-------VKI    144

Query        161 ICE--D-----L--WQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAG    211
d1kkoa1      145 VADEWCNTYQDIVDFTDAGSC--H---------MVQIKTPDLGGIHNIVDAVLYCNKHGM    193

Query        212 CTTAYLAMIGGQDELVF--DG--DS-IVVDRDGEVVA--RAPQFS-----EG--CVV-LD    256
d1kkoa1      194 --EAYQGGTCN----ETEISARTCVHVAL----AARPMRMLIKPGMGFDEGLNIVFNE-M    242

Query        257 LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA---DRL    302
d1kkoa1      243 -------------------------------------NRTIALLQT---    251


hit structure      al