HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T542A
Query:
T542_A.pdb A
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1j31a_ Hypothetical protein PH0642 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 20.18 1.328 1.00 28.1 14.8 0.39
2 d1f89a_ hypothetical protein yl85 Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 19.28 1.412 1.00 26.4 13.5 0.40
3 d1uf5a_ N-​carbamoyl-​D-​aminoacid amidohydrolase Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 19.04 1.647 1.00 24.9 13.2 0.41
4 d1emsa2 NIT-​FHIT fusion protein,​ N-​terminal domain Carbon-​nitrogen hydrolase Carbon-​nitrogen hydrolase α+β 18.99 1.501 1.00 25.8 13.5 0.40
5 d1kqpa_ NH3-​dependent NAD+-​synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 17.10 0.943 1.00 22.5 11.6 0.37
6 d1gpma1 GMP synthetase,​ central domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 9.73 2.423 1.00 17.0 8.9 0.27
7 d1ni5a1 Putative cell cycle protein MesJ,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 7.03 1.453 1.00 13.9 6.1 0.28
8 d1q15a1 beta-​Lactam synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.42 1.626 0.99 13.1 5.1 0.26
9 d1jgta1 beta-​Lactam synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.26 1.914 0.99 10.8 5.0 0.26
10 d1sura_ Phosphoadenylyl sulphate (PAPS) reductase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.21 1.838 1.00 11.1 5.4 0.27
11 d1ct9a1 Asparagine synthetase B,​ C-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 5.78 1.652 0.99 10.0 4.7 0.27
12 d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 5.47 1.669 1.00 12.4 5.4 0.23
13 d1k92a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 5.28 1.735 1.00 11.0 4.5 0.25
14 d1ii7a_ Mre11 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.84 1.211 0.04 7.2 2.9 0.35
15 d1uf3a_ Hypothetical protein TT1561 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.53 0.840 0.94 6.8 3.7 0.28
16 d1hp1a2 5'​-​nucleotidase (syn. UDP-​sugar hydrolase),​ N-​terminal domain Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.21 1.234 0.03 6.6 2.7 0.31
17 d4kbpa2 Plant purple acid phosphatase,​ catalytic domain Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.09 1.317 0.01 6.0 2.5 0.29
18 d1utea_ Mammalian purple acid phosphatase Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 4.06 1.230 0.01 6.2 2.5 0.30
19 d1ntfa_ Salivary nitrophorin DNase I-​like DNase I-​like α+β 3.90 1.260 0.08 4.8 2.6 0.30
20 d1ru8a_ Putative N-​type ATP pyrophosphatase PF0828 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 3.67 0.947 0.99 7.4 3.5 0.21
21 d2dnja_ Deoxyribonuclease I DNase I-​like DNase I-​like α+β 3.63 1.427 0.05 4.0 2.8 0.28
22 d1s3la_ Putative phosphodiesterase MJ0936 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 3.55 1.430 0.34 6.5 2.9 0.14
23 d1vyba_ Endonuclease domain of LINE-​1 reverse transcriptase homolog DNase I-​like DNase I-​like α+β 3.35 1.447 0.06 4.0 2.2 0.27
24 d1su1a_ Phosphodiesterase yfcE Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 3.11 1.234 0.25 4.6 2.6 0.23
25 d1nnwa_ Hypothetical protein PF1291 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 3.10 1.235 0.09 3.7 2.3 0.26
26 d1hd7a_ DNA repair endonuclease Hap1 DNase I-​like DNase I-​like α+β 3.02 1.447 0.09 4.0 2.5 0.22
27 d1mjha_ ​(​Hypothetical​(​ protein MJ0577 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 3.00 0.261 0.95 9.0 3.0 0.18
28 d1wdua_ Endonuclease domain of TRAS1 retrotransposon (ORF2) DNase I-​like DNase I-​like α+β 2.90 1.447 0.10 3.7 2.4 0.25
29 d1akoa_ DNA-​repair enzyme exonuclease III DNase I-​like DNase I-​like α+β 2.87 1.447 0.09 3.2 2.4 0.27
30 d1sr4b_ Cytolethal distending toxin subunit B DNase I-​like DNase I-​like α+β 2.75 1.446 0.01 3.6 2.1 0.28
31 d1i9za_ Synaptojanin,​ IPP5C domain DNase I-​like DNase I-​like α+β 2.75 1.445 0.02 2.6 2.8 0.30
32 d1jmva_ Universal stress protein A,​ UspA Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.67 0.827 0.96 7.9 3.3 0.17
33 d1jila_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.51 1.013 0.02 6.1 1.7 0.23
34 d1qopb_ Tryptophan synthase,​ beta-​subunit Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.435 -0.349 0.11 4.0 1.9 0.22
35 d1iira_ UDP-​glucosyltransferase GtfB UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 2.39 0.846 0.03 5.4 0.8 0.24
36 d1tq8a_ Hypothetical protein Rv1636 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.37 0.952 0.95 8.5 1.5 0.17
37 d1mopa_ Pantothenate synthetase (Pantoate-​beta-​alanine ligase,​ PanC) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.36 0.837 0.04 6.0 2.4 0.27
38 d1a3wa3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.343 -0.822 0.01 6.3 2.4 0.18
39 d1t57a_ Hypothetical protein MTH1675 PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.28 1.031 0.04 4.9 2.2 0.18
40 d1ceoa_ Endoglucanase CelC (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.27 0.699 0.02 3.9 2.1 0.28
41 d1efvb_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.26 1.688 0.07 7.1 0.5 0.17
42 d1p5ja_ L-​serine dehydratase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.25 1.487 0.05 7.6 2.2 0.21
43 d1j0aa_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.243 0.521 0.03 7.3 1.8 0.24
44 d1k87a2 Proline dehydrohenase domain of bifunctional PutA protein FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 2.24 0.696 0.03 2.9 1.9 0.32
45 d1rq2a1 Cell-​division protein FtsZ Tubulin nucleotide-​binding domain-​like Tubulin nucleotide-​binding domain-​like α/β 2.231 0.474 0.16 5.1 3.0 0.18
46 d1vjna_ Hypothetical protein TM0207 Metallo-​hydrolase/​oxidoreductase Metallo-​hydrolase/​oxidoreductase α+β 2.207 -0.278 0.06 3.1 2.0 0.20
47 d1rzua_ Glycogen synthase 1,​ GlgA UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 2.206 -0.664 0.09 3.9 1.0 0.30
48 d1g5ba_ lambda ser/​thr protein phosphatase Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 2.20 1.232 0.05 2.2 1.5 0.22
49 d1v7ca_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.19 0.624 0.03 6.3 2.2 0.23
50 d1a49a3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.186 0.243 0.01 5.6 2.5 0.18
51 d1tuba1 Tubulin alpha-​subunit Tubulin nucleotide-​binding domain-​like Tubulin nucleotide-​binding domain-​like α/β 2.179 -0.397 0.05 4.2 3.1 0.21
52 d1h3fa1 Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.16 0.735 0.01 4.5 1.6 0.19
53 d7a3ha_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.12 0.698 0.03 3.6 1.9 0.29
54 d1jzta_ Hypothetical protein YNL200c (YNU0 YEAST) YjeF N-​terminal domain-​like YjeF N-​terminal domain-​like α/β 2.122 -0.679 0.02 4.2 2.1 0.21
55 d1ll2a_ Glycogenin Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 2.11 0.829 0.01 4.8 0.9 0.18
56 d1irxa2 Class I lysyl-​tRNA synthetase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.096 0.566 0.01 4.2 1.2 0.20
57 d1k6wa2 Cytosine deaminase catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 2.09 0.697 0.01 3.0 1.4 0.27
58 d1n3la_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.078 0.570 0.01 4.1 1.2 0.20
59 d1bqca_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 2.08 0.696 0.15 4.1 1.7 0.29
60 d1nzja_ Glutamyl-​Q tRNA-​Asp synthetase YadB Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.074 0.572 0.01 4.6 1.0 0.15
61 d1auka_ Arylsulfatase A Alkaline phosphatase-​like Alkaline phosphatase-​like α/β 2.071 -0.575 0.01 2.3 1.3 0.33
62 d1j1ua_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.03 0.837 0.01 5.2 1.1 0.23
63 d1q7za2 Cobalamin-​dependent methionine synthase MetH,​ N-​terminal domain Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 2.02 0.703 0.02 4.5 2.1 0.31
64 d1od6a_ Phosphopantetheine adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.01 1.591 0.02 7.0 1.1 0.17
65 d1edga_ Endoglucanase CelA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.96 0.700 0.03 3.4 1.4 0.29
66 d1o97c_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.93 1.605 0.13 6.7 0.7 0.17
67 d1foba_ Beta-​1,​4-​galactanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.93 0.700 0.02 4.0 1.9 0.29
68 d1gzga_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.93 0.705 0.04 4.0 2.0 0.28
69 d1o58a_ O-​acetylserine sulfhydrylase (Cysteine synthase) Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.93 1.493 0.03 7.1 2.3 0.22
70 d1l6sa_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.92 0.708 0.06 4.2 2.1 0.28
71 d1h1na_ Endocellulase EngI (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.92 0.699 0.03 3.9 1.9 0.28
72 d1t64a_ Histone deacetylase 8,​ HDAC8 Arginase/​deacetylase Arginase/​deacetylase α/β 1.89 0.729 0.01 2.9 1.4 0.26
73 d1egza_ Endoglucanase Cel5a (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.88 0.700 0.03 3.3 1.9 0.29
74 d1j09a2 Glutamyl-​tRNA synthetase (GluRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.88 0.768 0.01 4.6 0.7 0.19
75 d1owla2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 1.86 0.963 0.01 5.8 1.5 0.16
76 d1np7a2 Cryptochrome Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 1.86 0.965 0.01 5.7 1.2 0.16
77 d1tdja1 Allosteric threonine deaminase N-​terminal domain Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.85 0.836 0.05 7.7 2.1 0.21
78 d1ug6a_ Beta-​glucosidase A (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.84 0.699 0.01 3.9 2.0 0.29
79 d1ep3b2 Dihydroorotate dehydrogenase B,​ PyrK subunit Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.84 0.903 0.01 6.0 0.9 0.19
80 d1gpja2 Glutamyl tRNA-​reductase middle domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.84 0.962 0.03 4.7 2.2 0.19
81 d1nvma2 4-​hydroxy-​2-​oxovalerate aldolase DmpG,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 1.82 0.701 0.04 3.1 2.0 0.28
82 d1o5ka_ Dihydrodipicolinate synthase Aldolase TIM beta/​alpha-​barrel α/β 1.82 0.711 0.11 3.4 1.9 0.31
83 d1jk7a_ Protein phosphatase-​1 (PP-​1) Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.82 1.230 0.01 2.2 1.3 0.23
84 d1gtra2 Glutaminyl-​tRNA synthetase (GlnRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.81 0.630 0.01 4.7 0.7 0.21
85 d1o97d1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.81 1.078 0.04 6.0 1.3 0.17
86 d1v4va_ UDP-​N-​acetylglucosamine 2-​epimerase UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.81 0.631 0.02 5.1 0.9 0.27
87 d1vjza_ Endoglucanase homologue TM1752 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.80 0.698 0.02 3.4 1.0 0.28
88 d1vi2a1 Putative shikimate dehydrogenase YdiB NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.80 0.712 0.03 6.4 2.0 0.20
89 d1auia_ Protein phosphatase-​2B (PP-​2B,​ calcineurin A subunit) Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.79 1.229 0.01 2.3 1.4 0.23
90 d1b5ta_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.78 0.698 0.04 3.5 2.5 0.25
91 d1vjga_ Hypothetical protein alr1529 SGNH hydrolase Flavodoxin-​like α/β 1.76 0.830 0.02 4.3 1.0 0.20
92 d1nofa2 Glycosyl hydrolase family 5 xylanase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.76 0.696 0.02 3.6 1.5 0.26
93 d1u0la2 Probable GTPase EngC (YjeQ),​ C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.75 0.841 0.01 4.6 1.0 0.19
94 d1oyba_ Old yellow enzyme (OYE) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.75 0.698 0.03 2.4 1.7 0.22
95 d1r30a_ Biotin synthase Radical SAM enzymes TIM beta/​alpha-​barrel α/β 1.74 0.702 0.02 2.7 2.4 0.25
96 d1q77a_ Hypothetical protein Aq 178 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.74 0.842 0.06 5.6 1.7 0.15
97 d1vyra_ Pentaerythritol tetranirate reductase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.74 0.699 0.02 2.6 1.8 0.27
98 d1h2ba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.73 1.232 0.02 5.2 2.3 0.19
99 d1u3da2 Cryptochrome Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 1.73 0.844 0.01 5.4 1.2 0.17
100 d1m3ua_ Ketopantoate hydroxymethyltransferase PanB Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.73 0.699 0.07 2.8 1.8 0.26
101 d1q6oa_ 3-​keto-​L-​gulonate 6-​phosphate decarboxylase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.73 0.710 0.03 3.7 2.4 0.26
102 d1coza_ CTP:glycerol-​3-​phosphate cytidylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.73 0.883 0.02 5.9 2.1 0.16
103 d1kwga2 A4 beta-​galactosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.72 0.703 0.04 2.7 1.7 0.25
104 d1jrla_ Thioesterase I,​ TAP SGNH hydrolase Flavodoxin-​like α/β 1.72 0.783 0.09 4.0 2.5 0.17
105 d1tz9a_ Mannonate dehydratase UxuA Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.72 0.696 0.04 2.6 1.5 0.27
106 d1efva1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.71 1.686 0.07 6.2 1.0 0.16
107 d1rqba2 Transcarboxylase 5S subunit,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 1.70 0.702 0.03 3.1 1.3 0.27
108 d1lt8a_ Betaine-​homocysteine S-​methyltransferase Homocysteine S-​methyltransferase TIM beta/​alpha-​barrel α/β 1.70 0.701 0.03 2.9 1.8 0.29
109 d1dnpa2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 1.70 0.967 0.01 6.2 1.4 0.19
110 d1qyca_ Phenylcoumaran benzylic ether reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.69 0.633 0.04 6.4 1.3 0.26
111 d1gk8a1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.69 0.699 0.03 2.6 1.7 0.26
112 d1bhga3 beta-​Glucuronidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.69 0.696 0.01 2.8 1.5 0.27
113 d1r3sa_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.68 0.701 0.07 2.7 1.7 0.27
114 d1eexa_ Diol dehydratase,​ alpha subunit Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 1.68 0.655 0.01 3.2 1.6 0.22
115 d1rvka1 Hypothetical protein Atu3453 Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.67 0.706 0.03 3.1 1.6 0.26
116 d1p1ma2 Hypothetical protein TM0936,​ probable catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.67 0.694 0.01 2.8 1.6 0.24
117 d1q8fa_ Pyrimidine nucleoside hydrolase YeiK Nucleoside hydrolase Nucleoside hydrolase α/β 1.67 1.223 0.10 3.3 1.0 0.22
118 d1d3ga_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.66 0.702 0.02 2.8 1.9 0.29
119 d1un7a2 N-​acetylglucosamine-​6-​phosphate deacetylase,​ NagA,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.66 0.695 0.01 2.5 1.4 0.27
120 d1iqra2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 1.66 0.965 0.01 5.3 1.5 0.16
121 d1lqaa_ Tas protein NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.66 0.702 0.01 3.0 1.1 0.30
122 d1q74a_ 1D-​myo-​inosityl 2-​acetamido-​2-​deoxy-​alpha-​D-​glucopyranoside deacetylase MshD LmbE-​like LmbE-​like α/β 1.66 0.695 0.01 4.0 0.9 0.22
123 d1f3la_ Arginine methyltransferase,​ HMT1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.66 0.876 0.01 2.8 1.0 0.24
124 d1vlia2 Spore coat polysaccharide biosynthesis protein SpsE,​ N-​terminal domain Aldolase TIM beta/​alpha-​barrel α/β 1.66 0.714 0.24 3.2 1.5 0.29
125 d1pe1a_ 3-​deoxy-​D-​manno-​octulosonate 8-​phosphate synthase (KDO8P synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.65 0.711 0.04 3.3 1.7 0.28
126 d1qx4a2 cytochrome b5 reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.65 1.278 0.01 4.7 1.8 0.17
127 d1iexa1 Beta-​D-​glucan exohydrolase,​ N-​terminal domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.65 0.697 0.03 1.5 1.4 0.29
128 d1c1da1 Phenylalanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.65 0.965 0.01 5.2 2.3 0.18
129 d1ec7a1 D-​glucarate dehydratase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.64 0.701 0.05 2.8 1.4 0.27
130 d1geha1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 1.64 0.699 0.04 2.8 1.6 0.28
131 d1ntha_ Monomethylamine methyltransferase MtmB Monomethylamine methyltransferase MtmB TIM beta/​alpha-​barrel α/β 1.63 0.700 0.01 3.5 1.6 0.32
132 d1e43a2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.63 0.696 0.02 1.9 1.3 0.30
133 d1ujpa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.63 0.710 0.02 2.9 2.3 0.26
134 d1l7da1 Nicotinamide nucleotide transhydrogenase dI component NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.62 0.963 0.02 5.0 2.0 0.18
135 d1n8na_ Class B acid phosphatase HAD-​like HAD-​like α/β 1.61 0.835 0.01 3.3 1.4 0.15
136 d1viza_ PcrB protein homolog YerE FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.61 0.700 0.03 2.9 2.0 0.23
137 d1te2a_ Phosphatase YniC HAD-​like HAD-​like α/β 1.60 0.842 0.01 3.7 1.4 0.19
138 d1ps9a1 2,​4-​dienoyl-​CoA reductase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.60 0.699 0.02 2.4 1.8 0.26
139 d1ihua1 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.60 0.654 0.01 3.0 0.6 0.22
140 d1ur3m_ Hypothetical oxidoreductase YdhF NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.60 0.701 0.01 2.1 1.4 0.29
141 d1qg8a_ Spore coat polysaccharide biosynthesis protein SpsA Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.59 0.672 0.01 3.6 0.8 0.18
142 d1s95a_ Serine/​threonine protein phosphatase 5,​ PP5 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.59 1.228 0.02 1.7 1.4 0.25
143 d1ecea_ Endocellulase E1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.59 0.697 0.06 2.7 1.2 0.31
144 d1nnla_ Phosphoserine phosphatase HAD-​like HAD-​like α/β 1.59 0.774 0.01 3.5 0.9 0.19
145 d1e19a_ Carbamate kinase Carbamate kinase-​like Carbamate kinase-​like α/β 1.59 0.964 0.03 3.5 1.0 0.25
146 d1o14a_ Putative sugar kinase TM0828 Ribokinase-​like Ribokinase-​like α/β 1.58 0.836 0.01 3.2 1.4 0.25
147 d1ls1a2 GTPase domain of the signal sequence recognition protein Ffh P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.58 0.654 0.06 4.5 2.2 0.22
148 d1eqca_ Exo-​beta-​(1,​3)-​glucanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.57 0.697 0.07 2.3 1.6 0.26
149 d1ub3a_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.57 0.698 0.04 3.6 2.1 0.25
150 d1jkxa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 1.57 1.473 0.01 4.5 1.4 0.17
151 d1r6wa1 O-​succinylbenzoate synthase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.56 0.695 0.04 2.7 1.4 0.24
152 d1ihua2 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.56 0.605 0.10 2.6 0.8 0.23
153 d1jyka_ CTP:phosphocholine cytidylytransferase LicC Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.56 0.839 0.01 3.9 1.0 0.14
154 d1a0ca_ D-​xylose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.56 0.696 0.01 2.7 1.8 0.28
155 d1jaka1 beta-​N-​acetylhexosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.55 0.694 0.01 2.4 1.4 0.30
156 d1npya1 Shikimate 5-​dehydrogenase-​like protein HI0607 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.54 1.184 0.10 5.3 0.9 0.16
157 d1rjwa2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.54 1.198 0.01 4.5 2.0 0.17
158 d1d8wa_ L-​rhamnose isomerase Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.54 0.695 0.01 2.8 1.4 0.31
159 d1nyta1 Shikimate 5-​dehydrogenase AroE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.54 0.672 0.04 4.5 1.2 0.17
160 d1saya1 L-​alanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.54 0.963 0.02 5.2 1.3 0.18
161 d1odza_ Mannanase A,​ ManA (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.54 0.623 0.02 2.9 1.0 0.29
162 d1p0ka_ Isopentenyl-​diphosphate delta-​isomerase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.53 0.697 0.01 2.6 2.2 0.27
163 d1lw7a1 Transcriptional regulator NadR,​ NMN-​adenylyltransferase domain Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.52 0.957 0.01 5.0 1.2 0.11
164 d1jz7a5 beta-​Galactosidase,​ domain 3 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.52 0.694 0.02 2.6 1.3 0.28
165 d1pbga_ 6-​phospho-​beta-​D-​galactosidase,​ PGAL (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.52 0.696 0.01 3.0 1.8 0.28
166 d1t8qa_ Glycerophosphodiester phosphodiesterase GlpQ PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.52 0.700 0.01 1.9 1.0 0.26
167 d1o94a1 Trimethylamine dehydrogenase,​ N-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.51 0.701 0.02 2.3 1.4 0.30
168 d1tqja_ D-​ribulose-​5-​phosphate 3-​epimerase Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.51 0.711 0.02 2.8 1.9 0.26
169 d1m7ja3 N-​acyl-​D-​aminoacid amidohydrolase,​ catalytic domain Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.51 0.694 0.01 2.2 1.3 0.31
170 d1lu9a1 Methylene-​tetrahydromethanopterin dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.51 0.966 0.15 4.7 2.0 0.19
171 d1j9ja_ SurE homolog TM1662 SurE-​like SurE-​like α/β 1.51 0.837 0.02 4.4 0.8 0.22
172 d1edta_ Endo-​beta-​N-​acetylglucosaminidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.50 0.616 0.02 1.8 1.8 0.26
173 d1efpa1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 1.50 1.516 0.04 5.4 1.0 0.17
174 d1tyga_ Thiazole biosynthesis protein ThiG ThiG-​like (Pfam 05690) TIM beta/​alpha-​barrel α/β 1.49 0.699 0.02 3.1 1.4 0.26
175 d1m6ia2 Apoptosis-​inducing factor (AIF) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.49 0.607 0.02 4.6 2.1 0.15
176 d1p1xa_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.49 0.699 0.02 3.3 2.0 0.26
177 d1h7wa2 Dihydropyrimidine dehydrogenase,​ domain 4 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.49 0.699 0.02 2.5 1.8 0.28
178 d1qama_ rRNA adenine dimethylase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.48 0.941 0.01 4.8 0.8 0.20
179 d1pqwa_ Putative enoyl reductase domain of polyketide synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.47 0.836 0.01 4.1 1.7 0.18
180 d1cp2a_ Nitrogenase iron protein P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.46 1.074 0.01 3.3 0.9 0.22
181 d1uoka2 Oligo-​1,​6,​ glucosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.46 0.698 0.01 1.9 1.2 0.30
182 d1i60a_ Hypothetical protein IolI Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.46 0.695 0.19 3.5 1.2 0.27
183 d7taaa2 Fungal alpha-​amylases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.46 0.694 0.03 1.8 1.5 0.29
184 d1ltqa1 Polynucleotide kinase,​ phosphatase domain HAD-​like HAD-​like α/β 1.45 0.840 0.02 3.7 1.6 0.16
185 d1qasa3 Phospholipase C isozyme D1 (PLC-​D1) PLC-​like phosphodiesterases TIM beta/​alpha-​barrel α/β 1.45 0.694 0.01 2.2 1.1 0.26
186 d1a9xa3 Carbamoyl phosphate synthetase (CPS),​ large subunit PreATP-​grasp domains PreATP-​grasp domain PreATP-​grasp domain α/β 1.45 1.506 0.03 5.3 1.5 0.13
187 d1ezwa_ Coenzyme F420 dependent tetrahydromethanopterin reductase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.44 0.696 0.03 2.7 1.2 0.22
188 d1meoa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 1.44 1.474 0.01 3.8 0.8 0.19
189 d1q45a_ 12-​oxophytodienoate reductase (OPR,​ OYE homolog) FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.44 0.700 0.02 2.8 1.7 0.27
190 d1mxga2 Bacterial alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.42 0.697 0.02 1.8 1.5 0.30
191 d1gvea_ Aflatoxin aldehyde reductase (akr7a1) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.42 0.695 0.01 2.2 1.2 0.30
192 d1us0a_ Aldose reductase (aldehyde reductase) NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.42 0.699 0.01 2.8 0.8 0.26
193 d1gsoa2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.42 1.687 0.03 6.0 1.8 0.14
194 d1lssa_ Ktn Mja218 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.42 0.943 0.12 5.8 2.0 0.16
195 d1luca_ Bacterial luciferase alpha chain,​ LuxA Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.42 0.696 0.11 1.8 2.1 0.22
196 d1u1ja1 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.42 0.695 0.02 2.4 1.2 0.28
197 d1ogsa2 Glucosylceramidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.41 0.696 0.01 2.1 2.0 0.30
198 d1mv8a3 GDP-​mannose 6-​dehydrogenase,​ GDP-​binding domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.41 0.731 0.02 3.6 1.6 0.13
199 d1ohla_ 5-​aminolaevulinate dehydratase,​ ALAD (porphobilinogen synthase) Aldolase TIM beta/​alpha-​barrel α/β 1.40 0.708 0.06 3.1 1.5 0.25
200 d1jyea_ Lac-​repressor (lacR) core (C-​terminal domain) Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.39 0.841 0.03 4.5 2.0 0.17
201 d1dv1a2 Biotin carboxylase (BC),​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.39 1.755 0.02 5.7 1.4 0.12
202 d1rhca_ Coenzyme F420 dependent secondary alcohol dehydrogenase Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 1.39 0.694 0.10 3.0 1.1 0.22
203 d1p4ca_ Membrane-​associated (S)-​mandelate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.38 0.696 0.01 1.7 1.1 0.27
204 d1e8ca2 UDP-​N-​acetylmuramyl tripeptide synthetase MurE MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.38 1.000 0.03 4.0 1.7 0.16
205 d1tx2a_ Dihydropteroate synthetase Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 1.37 0.687 0.05 2.9 1.2 0.25
206 d1heta2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.37 0.702 0.01 4.9 1.9 0.17
207 d1r5ja_ Putative phosphotransacetylase SPy1128 Isocitrate/​Isopropylmalate dehydrogenase-​like Isocitrate/​Isopropylmalate dehydrogenase-​like α/β 1.37 0.616 0.03 4.2 1.0 0.25
208 d1itua_ Renal dipeptidase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.36 0.695 0.03 2.1 1.1 0.28
209 d1k77a_ Hypothetical protein YgbM (EC1530) Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.36 0.696 0.05 2.6 1.4 0.26
210 d1nksa_ Adenylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.36 0.646 0.01 3.1 2.0 0.16
211 d1uufa2 Hypothetical protein YahK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.36 0.832 0.01 4.9 1.9 0.16
212 d1q1na2 Cinnamyl alcohol dehydrogenase,​ ADH6 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.35 1.323 0.01 4.6 1.2 0.18
213 d1vlja_ NADH-​dependent butanol dehydrogenase A (TM0820) Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 1.35 0.719 0.03 3.2 1.0 0.28
214 d1rifa_ DNA helicase UvsW P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.35 0.649 0.03 3.1 1.2 0.17
215 d1gqna_ Type I 3-​dehydroquinate dehydratase Aldolase TIM beta/​alpha-​barrel α/β 1.34 0.711 0.03 4.4 2.4 0.25
216 d1kbla1 Pyruvate phosphate dikinase,​ C-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.34 0.697 0.01 2.6 1.3 0.24
217 d1pz1a_ Putative oxidoreductase YhdN NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.34 0.697 0.01 2.2 1.3 0.28
218 d1itxa1 Chitinase A1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.33 0.695 0.01 3.1 1.1 0.30
219 d1aq0a_ Plant beta-​glucanases (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.33 0.636 0.01 2.4 1.5 0.24
220 d1o7ja_ Asparaginase type II Glutaminase/​Asparaginase Glutaminase/​Asparaginase α/β 1.32 -0.783 0.93 3.7 1.2 0.24
221 d1uana_ Hypothetical protein TT1542 LmbE-​like LmbE-​like α/β 1.32 0.837 0.02 4.1 1.0 0.20
222 d1o54a_ Hypothetical protein TM0748 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.32 0.648 0.01 4.2 1.2 0.20
223 d1f0ka_ Peptidoglycan biosynthesis glycosyltransferase MurG UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.31 0.836 0.02 5.0 1.0 0.25
224 d1jr1a1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 1.31 0.702 0.01 1.8 1.3 0.24
225 d1pvoa3 Transcription termination factor Rho,​ ATPase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.31 0.662 0.01 2.5 1.9 0.21
226 d1h1da_ Catechol O-​methyltransferase,​ COMT S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.31 1.132 0.01 4.4 1.4 0.20
227 d1qyra_ High level kasugamycin resistance protein KsgA S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.31 0.617 0.03 4.6 0.7 0.19
228 d1hl2a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 1.30 0.702 0.05 3.3 1.9 0.31
229 d6ldha1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.30 0.841 0.09 4.5 2.1 0.16
230 d1o5za1 Folylpolyglutamate synthetase,​ C-​terminal domain MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.30 0.843 0.05 4.0 1.5 0.15
231 d1okkd2 GTPase domain of the signal recognition particle receptor FtsY P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.30 0.645 0.04 4.9 1.1 0.21
232 d1oywa2 RecQ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.30 0.656 0.01 2.9 1.2 0.20
233 d1w3ia_ 2-​keto-​3-​deoxy gluconate aldolase Eda Aldolase TIM beta/​alpha-​barrel α/β 1.29 0.705 0.09 3.3 1.7 0.28
234 d1uuqa_ Exomannosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.29 0.696 0.02 2.6 1.3 0.30
235 d1nfga2 D-​hydantoinase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.28 0.695 0.01 2.2 1.1 0.26
236 d1fyea_ Aspartyl dipeptidase PepE Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 1.28 0.608 0.02 1.8 1.3 0.20
237 d1d2ka1 Chitinase 1 (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.28 0.669 0.01 2.2 1.1 0.27
238 d1u1ja2 5-​methyltetrahydropteroyltriglutamate-​-​homocysteine methyltransferase MetE UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.27 0.699 0.03 2.0 1.5 0.28
239 d1hl9a2 Putative alpha-​L-​fucosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.27 0.667 0.02 2.7 1.2 0.25
240 d1nf9a_ Phenazine biosynthesis protein PhzD Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.27 0.837 0.02 3.2 1.5 0.19
241 d1t1ra2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.26 1.042 0.06 4.4 1.7 0.14
242 d1i1wa_ Xylanase A,​ catalytic core (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.26 0.618 0.02 3.4 1.6 0.27
243 d1w0jd3 Central domain of beta subunit of F1 ATP synthase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.26 0.661 0.01 2.1 1.8 0.20
244 d1ccwb_ Glutamate mutase,​ large subunit Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 1.26 0.704 0.02 2.3 1.4 0.25
245 d1dlja3 UDP-​glucose dehydrogenase (UDPGDH),​ C-​terminal (UDP-​binding) domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.25 0.632 0.01 4.1 1.7 0.12
246 d1im8a_ Hypothetical protein HI0319 (YecO) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.24 1.050 0.01 3.5 0.7 0.22
247 d1tf7a1 Circadian clock protein KaiC P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.24 0.638 0.02 3.2 1.9 0.21
248 d1q0ua_ Probable DEAD box RNA helicase YqfR P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.24 0.613 0.01 2.6 1.7 0.20
249 d1jv1a_ UDP-​N-​acetylglucosamine pyrophosphorylase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.24 0.725 0.01 1.8 0.7 0.24
250 d1puia_ Probable GTPase EngB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.23 0.887 0.01 4.8 1.1 0.18
251 d1f8fa2 Benzyl alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.23 1.310 0.01 4.8 2.1 0.17
252 d1h7wa3 Dihydropyrimidine dehydrogenase,​ domain 3 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.23 0.742 0.04 3.6 1.0 0.15
253 d1hdoa_ Biliverdin IX beta reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.23 0.860 0.04 4.2 1.2 0.19
254 d1drka_ D-​ribose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.23 0.841 0.05 4.0 1.9 0.17
255 d1byka_ Trehalose repressor,​ C-​terminal domain Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.22 0.842 0.03 4.1 1.1 0.16
256 d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.22 0.998 0.02 3.2 1.2 0.16
257 d1muca1 Muconate-​lactonizing enzyme Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.22 0.706 0.03 2.7 1.7 0.25
258 d1id1a_ Rck domain from putative potassium channel Kch NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.22 1.345 0.06 5.4 1.6 0.16
259 d1gkub1 Helicase-​like ​(​domain​(​ of reverse gyrase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.21 0.646 0.02 1.7 0.9 0.21
260 d1miob_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 1.21 0.893 0.03 3.9 1.1 0.26
261 d1lwha2 4-​alpha-​glucanotransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.20 0.697 0.01 1.2 1.5 0.30
262 d1qnra_ Beta-​mannanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.20 0.696 0.03 2.9 1.2 0.26
263 d1f61a_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.20 0.695 0.03 2.7 0.9 0.29
264 d1ojxa_ Archaeal fructose 1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.20 0.696 0.05 2.2 1.4 0.25
265 d1v93a_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.20 -0.982 0.92 2.6 2.3 0.28
266 d1enya_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.19 0.838 0.03 3.0 1.0 0.23
267 d1dbqa_ Purine repressor (PurR),​ C-​terminal domain Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.19 0.775 0.05 3.1 1.8 0.18
268 d1thfd_ Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.18 0.707 0.05 5.0 2.3 0.28
269 d1vfsa2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.18 0.700 0.01 2.7 1.0 0.18
270 d1a4ma_ Adenosine deaminase (ADA) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.18 0.694 0.03 2.5 1.4 0.30
271 d1uwsa_ beta-​Glycosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.17 0.698 0.01 2.3 1.5 0.24
272 d1r0ka2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.17 1.237 0.03 4.8 1.3 0.15
273 d1tjya_ AI-​2 receptor LsrB Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.17 0.605 0.05 3.5 1.3 0.20
274 d1qhoa4 Cyclodextrin glycosyltransferase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.17 0.696 0.03 1.7 1.6 0.28
275 d3grsa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.16 0.841 0.01 4.0 1.1 0.13
276 d1jw9b_ Molybdenum cofactor biosynthesis protein MoeB Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 1.15 0.788 0.03 4.5 1.7 0.20
277 d1l5xa_ SurE homolog PAE2908 (SurE-​alpha) SurE-​like SurE-​like α/β 1.15 0.835 0.01 3.4 0.8 0.20
278 d1vdca2 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.15 0.775 0.08 4.1 1.0 0.13
279 d1gvfa_ Tagatose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 1.15 0.701 0.06 1.9 1.0 0.24
280 d1vhna_ Putative flavin oxidoreducatase TM0096 FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.14 0.696 0.01 2.5 1.5 0.28
281 d1hyea1 MJ0490,​ lactate/​malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.13 0.835 0.08 4.4 1.3 0.16
282 d2uaga1 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.13 1.186 0.01 5.4 1.1 0.13
283 d1qtwa_ Endonuclease IV Xylose isomerase-​like TIM beta/​alpha-​barrel α/β 1.13 0.699 0.04 3.7 1.2 0.27
284 d1m1nb_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 1.13 0.851 0.02 5.3 0.7 0.26
285 d1nhpa2 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.12 1.150 0.02 4.5 1.0 0.14
286 d1pfka_ ATP-​dependent phosphofructokinase Phosphofructokinase Phosphofructokinase α/β 1.12 0.845 0.05 2.2 1.7 0.26
287 d1w0ja3 Central domain of alpha subunit of F1 ATP synthase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.12 0.661 0.01 2.5 1.9 0.20
288 d1fmta2 Methionyl-​tRNAfmet formyltransferase Formyltransferase Formyltransferase α/β 1.12 0.957 0.02 5.0 1.0 0.19
289 d1of8a_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 1.12 0.697 0.03 3.2 1.7 0.29
290 d1g41a_ HslU P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.12 0.646 0.01 2.3 0.7 0.20
291 d1gm5a3 RecG helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.11 0.657 0.04 1.9 0.8 0.19
292 d1ep3a_ Dihydroorotate dehydrogenase FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 1.11 0.698 0.02 1.6 1.7 0.28
293 d1vl0a_ DTDP-​4-​dehydrorhamnose reductase RfbD NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.11 1.026 0.01 2.3 1.5 0.20
294 d1vkza2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.11 0.603 0.01 4.7 1.8 0.12
295 d1xeaa1 Putative oxidoreductase VCA1048 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.11 0.842 0.02 4.5 1.5 0.19
296 d1f74a_ N-​acetylneuraminate lyase Aldolase TIM beta/​alpha-​barrel α/β 1.10 0.706 0.08 3.7 1.7 0.20
297 d1hv8a1 Putative DEAD box RNA helicase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.10 0.655 0.01 2.7 1.4 0.19
298 d1nu0a_ Hypothetical protein YqgF (RuvX) Ribonuclease H-​like Ribonuclease H-​like motif α/β 1.10 0.957 0.02 3.8 2.1 0.13
299 d1i24a_ Sulfolipid biosynthesis protein SQD1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.09 0.839 0.01 2.4 1.0 0.30
300 d1f2t.1 Rad50 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.09 0.652 0.02 3.1 0.6 0.19
301 d1i0da_ Phosphotriesterase (parathion hydrolase,​ PTE) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.09 0.699 0.02 3.4 1.5 0.29
302 d1b93a_ Methylglyoxal synthase,​ MgsA Methylglyoxal synthase-​like Methylglyoxal synthase-​like α/β 1.09 0.748 0.02 3.8 1.6 0.14
303 d1on3a2 Methylmalonyl-​CoA carboxyltransferase (transcarboxylase 12S) ClpP/​crotonase ClpP/​crotonase α/β 1.09 0.600 0.06 2.2 1.4 0.20
304 d1a4ia2 Tetrahydrofolate dehydrogenase/​cyclohydrolase Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 1.08 0.843 0.02 3.5 2.1 0.11
305 d1l8qa2 Chromosomal replication initiation factor DnaA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.08 0.661 0.03 2.0 1.1 0.17
306 d1ig3a2 Thiamin pyrophosphokinase,​ catalytic domain Thiamin pyrophosphokinase,​ catalytic domain Thiamin pyrophosphokinase,​ catalytic domain α/β 1.08 0.659 0.02 2.6 1.2 0.18
307 d1a53a_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.08 0.700 0.02 1.9 1.1 0.25
308 d1gcia_ Subtilisin Subtilisin-​like Subtilisin-​like α/β 1.07 0.724 0.03 2.0 1.3 0.23
309 d1xi3a_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 1.07 0.858 0.07 3.9 2.3 0.25
310 d1x7fa2 Outer surface protein,​ N-​terminal domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.07 0.702 0.01 2.7 2.2 0.26
311 d1m6ya2 TM0872,​ methyltransferase domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.07 0.638 0.01 3.8 1.4 0.19
312 d1gg4a1 UDP-​murNac-​tripeptide D-​alanyl-​D-​alanine-​adding enzyme MurF MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.07 0.653 0.01 2.7 2.0 0.15
313 d1kjqa2 Glycinamide ribonucleotide transformylase PurT,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.07 1.625 0.04 3.5 2.2 0.14
314 d1byra_ Nuclease Nuc Phospholipase D/​nuclease Phospholipase D/​nuclease α+β 1.07 1.007 0.03 3.7 0.9 0.15
315 d1s2wa_ Phosphoenolpyruvate mutase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 1.07 0.701 0.04 2.9 2.1 0.26
316 d1jfxa_ Streptomyces lysozyme (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.07 0.694 0.04 2.0 1.3 0.19
317 d1piia2 N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 1.07 0.700 0.02 2.3 1.4 0.22
318 d1bf6a_ Phosphotriesterase homology protein Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.07 0.696 0.02 3.7 1.4 0.27
319 d1r0ma1 N-​acylamino acid racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 1.06 0.707 0.02 3.9 1.6 0.27
320 d1veca_ DEAD box RNA helicase rck/​p54 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.06 0.650 0.01 2.6 1.0 0.20
321 d1eh9a3 Glycosyltrehalose trehalohydrolase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.06 0.697 0.04 2.9 1.2 0.31
322 d8abpa_ L-​arabinose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.06 0.762 0.06 3.6 1.7 0.18
323 d1rzma_ 3-​deoxy-​D-​arabino-​heptulosonate-​7-​phosphate synthase (DAHP synthase,​ AroG) Aldolase TIM beta/​alpha-​barrel α/β 1.06 0.706 0.02 3.3 1.5 0.25
324 d1ct5a_ ​(​Hypothetical​(​ protein ybl036c PLP-​binding barrel TIM beta/​alpha-​barrel α/β 1.06 0.694 0.02 2.2 2.0 0.20
325 d1q1ra2 Putidaredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.05 1.179 0.01 4.4 1.2 0.14
326 d1n5da_ Carbonyl reductase/​20beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.05 0.661 0.04 4.5 0.6 0.22
327 d1ur1a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.05 0.698 0.02 1.9 1.7 0.28
328 d1lk5a1 D-​ribose-​5-​phosphate isomerase (RpiA),​ catalytic domain NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.05 0.800 0.02 3.8 2.5 0.19
329 d1pyfa_ Putative oxidoreductase IolS NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.05 0.701 0.02 2.1 1.3 0.29
330 d1nhpa1 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.04 0.835 0.01 3.5 0.6 0.17
331 d2tpsa_ Thiamin phosphate synthase Thiamin phosphate synthase TIM beta/​alpha-​barrel α/β 1.04 0.710 0.03 2.7 1.9 0.25
332 d1vhta_ Dephospho-​CoA kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.04 0.646 0.05 2.1 1.4 0.17
333 d1gkpa2 D-​hydantoinase Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 1.04 0.694 0.01 2.1 1.4 0.27
334 d1d2na_ Hexamerization domain of N-​ethylmalemide-​sensitive fusion (NSF) protein P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.04 0.659 0.08 2.4 1.8 0.19
335 d1mrza2 FMN adenylyltransferase domain of bifunctional FAD synthetase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.03 0.838 0.01 3.8 0.9 0.17
336 d1sr9a2 2-​isopropylmalate synthase LeuA,​ catalytic domain Aldolase TIM beta/​alpha-​barrel α/β 1.03 0.704 0.01 1.9 1.7 0.25
337 d1o6za1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.03 0.837 0.06 4.4 1.2 0.15
338 d1j23a_ Putative ATP-​dependent RNA helicase Hef,​ nuclease domain Restriction endonuclease-​like Restriction endonuclease-​like α/β 1.03 0.648 0.01 3.8 1.9 0.13
339 d1e4mm_ Plant beta-​glucosidase (myrosinase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.03 0.687 0.01 1.4 1.2 0.26
340 d1qw9a2 Alpha-​L-​arabinofuranosidase,​ catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 1.02 0.694 0.01 1.7 1.1 0.25
341 d1c4oa1 Nucleotide excision repair enzyme UvrB P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.02 0.650 0.11 3.3 0.6 0.20
342 d1oi7a2 Succinyl-​CoA synthetase,​ alpha-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 1.02 1.031 0.03 3.0 2.0 0.16
343 d1usga_ Leucine-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.01 0.975 0.03 2.8 1.6 0.25
344 d1d3va_ Arginase Arginase/​deacetylase Arginase/​deacetylase α/β 1.01 0.604 0.02 1.4 1.7 0.24
345 d1pvna1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 1.01 0.699 0.01 1.8 1.4 0.28
346 d4tmka_ Thymidylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.01 0.646 0.07 1.6 1.6 0.18
347 d1exba_ Voltage-​dependent K+ channel beta subunit NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.01 0.699 0.01 1.9 1.4 0.30
348 d1j93a_ Uroporphyrinogen decarboxylase,​ UROD UROD/​MetE-​like TIM beta/​alpha-​barrel α/β 1.00 0.699 0.08 2.8 1.4 0.27
349 d1n7ka_ Deoxyribose-​phosphate aldolase DeoC Aldolase TIM beta/​alpha-​barrel α/β 1.00 0.695 0.08 2.8 1.8 0.25
350 d1mvla_ 4'​-​phosphopantothenoylcysteine decarboxylase (PPC decarboxylase,​ halotolerance protein Hal3a) Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.00 0.860 0.09 2.9 1.5 0.16
351 d1ml4a2 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.00 0.633 0.01 3.2 1.2 0.16
352 d1nvmb1 Acetaldehyde dehydrogenase (acylating) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 1.321 0.02 4.7 1.5 0.16
353 d1b8pa1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 0.837 0.09 4.6 1.2 0.17
354 d1qora2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.99 1.467 0.01 4.0 1.2 0.17
355 d1nlfa_ Hexameric replicative helicase repA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.99 0.659 0.03 2.7 1.3 0.21
356 d1iz0a2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.99 1.084 0.01 4.3 1.8 0.17
357 d1v3ua2 Leukotriene b4 12-​hydroxydehydrogenase/​prostaglandin 15-​keto reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.98 1.633 0.01 3.8 0.7 0.18
358 d1ps9a3 2,​4-​dienoyl-​CoA reductase,​ middle domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 0.98 0.836 0.01 3.1 1.0 0.13
359 d1j18a2 Bacterial beta-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.98 0.698 0.01 2.4 1.2 0.29
360 d1hw6a_ 2,​5-​diketo-​D-​gluconic acid reductase A NAD(P)-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 0.98 0.700 0.01 1.9 1.3 0.26
361 d1qwga_ (2r)-​phospho-​3-​sulfolactate synthase ComA (2r)-​phospho-​3-​sulfolactate synthase ComA TIM beta/​alpha-​barrel α/β 0.98 0.701 0.01 2.9 1.7 0.23
362 d1t6na_ Spliceosome RNA helicase BAT1 (UAP56) P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.98 0.655 0.01 2.8 1.1 0.20
363 d1kbza_ dTDP-​6-​deoxy-​L-​lyxo-​4-​hexulose reductase (RmlD) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.98 0.613 0.01 2.0 1.1 0.25
364 d1knqa_ Gluconate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.98 0.657 0.02 2.5 1.0 0.16
365 d1b74a1 Glutamate racemase Aspartate/​glutamate racemase ATC-​like α/β 0.98 1.448 0.02 4.1 1.5 0.12
366 d1lnqa1 Potassium channel-​related protein MthK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.98 1.478 0.01 4.8 1.2 0.17
367 d1u94a1 RecA protein,​ ATPase-​domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.98 0.658 0.10 2.6 1.3 0.21
368 d1dbta_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.98 0.706 0.03 2.2 1.7 0.23
369 d1rrma_ Lactaldehyde reductase FucO Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 0.97 0.608 0.02 3.6 0.9 0.28
370 d1m66a2 Glycerol-​3-​ phosphate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.97 1.081 0.03 2.2 1.0 0.19
371 d1a1va1 HCV helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.97 0.646 0.01 2.5 1.5 0.15
372 d1geqa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.97 0.708 0.02 2.6 2.2 0.27
373 d1muma_ 2-​methylisocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 0.96 0.699 0.04 2.7 1.6 0.28
374 d1vlpa2 Nicotinate phosphoribosyltransferase,​ C-​terminal domain Nicotinate/​Quinolinate PRTase C-​terminal domain-​like alpha/​beta-​Hammerhead α+β 0.96 0.667 0.03 3.3 1.3 0.24
375 d1pjqa1 Siroheme synthase CysG,​ domain 1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.96 0.837 0.01 3.6 2.4 0.15
376 d1l7vc_ ABC transporter involved in vitamin B12 uptake,​ BtuD P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.96 0.662 0.07 2.7 0.9 0.18
377 d1piia1 Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.95 0.703 0.01 1.8 1.4 0.25
378 d1m7xa3 1,​4-​alpha-​glucan branching enzyme,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.95 0.696 0.02 1.7 1.3 0.25
379 d1bf2a3 Isoamylase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.95 0.696 0.02 1.0 1.1 0.24
380 d1nsja_ N-​(5'​phosphoribosyl)antranilate isomerase,​ PRAI Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.95 0.701 0.01 2.2 2.1 0.24
381 d1db3a_ GDP-​mannose 4,​6-​dehydratase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.95 0.760 0.03 2.6 1.3 0.22
382 d1xyza_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.94 -1.227 0.90 1.7 0.9 0.27
383 d1spva_ Hypothetical protein YmbD Macro domain-​like Macro domain-​like α/β 0.94 0.930 0.05 3.5 1.4 0.15
384 d1ccwa_ Glutamate mutase,​ small subunit Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.94 1.575 0.13 3.3 2.2 0.16
385 d1lvla2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.94 0.836 0.01 4.0 1.1 0.13
386 d1jbka_ ClpB,​ AAA+ modules P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.94 0.653 0.02 1.5 1.5 0.19
387 d1p3da1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 0.93 1.492 0.04 5.1 1.9 0.10
388 d1eucb1 Succinyl-​CoA synthetase,​ beta-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.93 0.958 0.21 2.3 1.7 0.15
389 d1qopa_ Trp synthase alpha-​subunit Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.93 0.709 0.02 2.4 2.0 0.27
390 d1jg1a_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.93 0.800 0.02 3.8 1.2 0.19
391 d1knwa2 Diaminopimelate decarboxylase LysA PLP-​binding barrel TIM beta/​alpha-​barrel α/β 0.92 0.695 0.01 3.7 1.4 0.20
392 d1bd0a2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 0.92 0.699 0.01 2.8 1.1 0.18
393 d1sxja2 Replication factor C1 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.92 0.659 0.01 2.2 0.8 0.17
394 d1kkoa1 beta-​Methylaspartase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 0.92 0.700 0.02 3.4 1.9 0.28
395 d1jpma1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 0.92 0.709 0.08 4.1 1.9 0.26
396 d1kbia1 Flavocytochrome b2,​ C-​terminal domain FMN-​linked oxidoreductases TIM beta/​alpha-​barrel α/β 0.92 0.668 0.01 1.0 1.0 0.28
397 d1nqua_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 0.92 0.841 0.06 3.7 1.9 0.14
398 d5ruba1 Ribulose 1,​5-​bisphosphate carboxylase-​oxygenase RuBisCo,​ C-​terminal domain TIM beta/​alpha-​barrel α/β 0.92 0.677 0.02 3.0 1.9 0.27
399 d1hx0a2 Animal alpha-​amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.91 0.699 0.02 1.3 1.2 0.29
400 d1vhqa_ Putative sigma cross-​reacting protein 27A (SCRP-​27A,​ EllB) Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.91 0.859 0.01 3.2 1.6 0.21
401 d1jx7a_ Hypothetical protein YchN YchN-​like YchN-​like α/β 0.91 0.963 0.01 4.1 1.1 0.13
402 d1vhca_ Hypothetical protein HI0047 Aldolase TIM beta/​alpha-​barrel α/β 0.90 0.713 0.05 2.6 2.1 0.21
403 d1uasa2 Melibiase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.90 0.696 0.01 1.8 1.3 0.28
404 d1fq0a_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 0.90 0.708 0.04 2.3 2.1 0.21
405 d1j6ua1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 0.90 1.116 0.03 5.2 1.9 0.09
406 d1jpdx1 L-​Ala-​D/​L-​Glu epimerase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 0.89 0.707 0.05 2.5 1.8 0.22
407 d1ml4a1 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.89 0.603 0.01 2.3 1.7 0.14
408 d1nqka_ Alkanesulfonate monooxygenase SsuD Bacterial luciferase-​like TIM beta/​alpha-​barrel α/β 0.88 0.695 0.06 1.7 1.2 0.27
409 d1izca_ Macrophomate synthase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 0.88 0.699 0.01 1.8 1.6 0.24
410 d1dosa_ Fructose-​bisphosphate aldolase (FBP aldolase) Aldolase TIM beta/​alpha-​barrel α/β 0.88 0.698 0.05 2.5 1.4 0.28
411 d1ji0a_ Branched chain aminoacid ABC transporter P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.88 0.659 0.16 2.3 0.7 0.18
412 d1fc6a4 Photosystem II D1 C-​terminal processing protease ClpP/​crotonase ClpP/​crotonase α/β 0.88 1.149 0.02 2.7 1.0 0.19
413 d1j6ua2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 0.87 0.735 0.01 2.7 0.9 0.14
414 d1twda_ Copper homeostasis protein CutC CutC-​like (Pfam 03932) TIM beta/​alpha-​barrel α/β 0.87 0.703 0.09 3.8 1.5 0.23
415 d2mnra1 Mandelate racemase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 0.87 0.710 0.02 4.2 2.3 0.27
416 d1nata_ Sporulation response regulator Spo0F CheY-​like Flavodoxin-​like α/β 0.87 0.737 0.03 3.6 1.9 0.12
417 d1cr1a_ Gene 4 protein (g4p,​ DNA primase),​ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.87 1.019 0.04 3.0 1.1 0.20
418 d1mf7a_ Integrin alpha M (CR3,​ CD11b/​CD18,​ Mac-​1 alpha subunit) vWA-​like vWA-​like α/β 0.87 0.651 0.05 2.3 1.1 0.18
419 d1r85a_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.87 0.696 0.03 1.8 1.1 0.28
420 d1g5ta_ ATP:corrinoid adenosyltransferase CobA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.87 0.663 0.02 3.1 1.3 0.17
421 d1p3y1_ MrsD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 0.87 0.836 0.06 2.7 1.4 0.19
422 d1elua_ Cystine C-​S lyase C-​des PLP-​dependent transferases PLP-​dependent transferases α/β 0.87 0.834 0.01 0.9 0.7 0.25
423 d1o2da_ Alcohol dehydrogenase TM0920 Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 0.86 0.838 0.02 3.2 0.9 0.27
424 d1kcxa2 Dihydropyrimidinase related protein-​1 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 0.86 0.694 0.02 2.0 1.1 0.27
425 d1tf7a2 Circadian clock protein KaiC P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.86 1.004 0.04 2.5 1.0 0.18
426 d1shux_ Capillary morphogenesis protein 2 domain vWA-​like vWA-​like α/β 0.86 0.691 0.02 2.6 1.6 0.18
427 d1t2da1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.86 0.609 0.04 3.0 1.8 0.15
428 d1dlja2 UDP-​glucose dehydrogenase (UDPGDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.86 0.837 0.01 2.7 1.0 0.17
429 d1to6a_ Glycerate kinase GlxK Glycerate kinase I (Pfam 02595) Glycerate kinase I (Pfam 02595) α/β 0.86 0.841 0.03 3.3 0.8 0.20
430 d1o1xa_ Putative sugar-​phosphate isomerase Ribose/​Galactose isomerase RpiB/​AlsB Ribose/​Galactose isomerase RpiB/​AlsB α/β 0.86 1.488 0.02 2.8 1.1 0.15
431 d1nn5a_ Thymidylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.85 0.647 0.01 2.1 1.5 0.18
432 d7reqb1 Methylmalonyl-​CoA mutase beta subunit,​ domain 1 Cobalamin (vitamin B12)-​dependent enzymes TIM beta/​alpha-​barrel α/β 0.85 0.697 0.02 1.7 1.2 0.31
433 d1iq8a1 Archaeosine tRNA-​guanine transglycosylase,​ N-​terminal domain tRNA-​guanine transglycosylase TIM beta/​alpha-​barrel α/β 0.85 0.698 0.01 3.2 1.7 0.29
434 d1kgda_ Guanylate kinase-​like domain of Cask P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.84 0.646 0.01 3.0 0.6 0.18
435 d1h3ga3 Cyclomaltodextrinase,​ central domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.84 0.696 0.02 1.7 1.0 0.22
436 d7reqa2 Methylmalonyl-​CoA mutase alpha subunit,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.84 0.799 0.15 2.8 1.5 0.14
437 d1g6ha_ MJ1267 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.84 0.663 0.08 2.1 0.8 0.21
438 d2uaga2 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 0.83 0.649 0.02 2.7 1.1 0.14
439 d1onfa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.83 1.063 0.03 3.3 1.1 0.13
440 d1uuya_ Plant CNX1 G domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.83 0.719 0.04 2.9 1.6 0.15
441 d1vlwa_ KDPG aldolase Aldolase TIM beta/​alpha-​barrel α/β 0.83 0.708 0.03 2.7 2.0 0.21
442 d1gcaa_ Galactose/​glucose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.82 0.836 0.03 2.8 1.4 0.22
443 d1js1x2 Transcarbamylase-​like protein Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.82 0.796 0.01 3.0 0.7 0.15
444 d1qcza_ N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) Flavodoxin-​like α/β 0.82 0.845 0.04 3.1 1.4 0.16
445 d1qdea_ Initiation factor 4a P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.81 0.650 0.01 2.5 1.1 0.18
446 d1cnva_ Seed storage protein (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.81 0.696 0.01 1.5 1.4 0.27
447 d1gcya2 G4-​amylase (1,​4-​alpha-​D-​glucan maltotetrahydrolase) (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.79 0.695 0.02 2.2 1.6 0.30
448 d1zfja1 Inosine monophosphate dehydrogenase (IMPDH) Inosine monophosphate dehydrogenase (IMPDH) TIM beta/​alpha-​barrel α/β 0.78 0.696 0.01 2.3 1.5 0.24
449 d1gqia1 alpha-​D-​glucuronidase catalytic domain (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.78 0.696 0.01 3.4 0.8 0.38
450 d1sqsa_ Hypothetical protein SP1951 Flavoproteins Flavodoxin-​like α/β 0.78 0.752 0.02 1.5 1.6 0.18
451 d1bmta2 Methionine synthase,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.78 1.374 0.03 2.9 1.9 0.14
452 d1vhua_ Hypothetical protein AF1521 Macro domain-​like Macro domain-​like α/β 0.78 0.805 0.03 2.6 1.2 0.16
453 d1v3ha_ beta-​Amylase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.78 0.697 0.01 1.7 1.2 0.32
454 d1a49a2 Pyruvate kinase,​ N-​terminal domain Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 0.78 0.707 0.02 4.2 1.5 0.25
455 d1nrza_ Sorbose permease subunit IIb ,​ EIIb-​sor PTS IIb component PTS IIb component α/β 0.77 0.686 0.02 2.0 1.2 0.16
456 d1nowa1 beta-​hexosaminidase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.77 0.697 0.01 1.6 1.9 0.26
457 d1g6oa_ Hexameric traffic ATPase,​ HP0525 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.77 0.656 0.02 2.4 0.7 0.18
458 d1n25a_ Papillomavirus large T antigen helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.77 0.647 0.01 2.3 0.4 0.21
459 d1dxea_ 2-​dehydro-​3-​deoxy-​galactarate aldolase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 0.76 0.700 0.01 1.9 2.1 0.26
460 d1e69a_ Smc head domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.76 0.650 0.01 2.3 0.7 0.19
461 d1sgwa_ Putative ABC transporter PF0895 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.75 0.661 0.03 2.4 0.7 0.17
462 d1di0a_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 0.75 0.837 0.04 3.5 1.5 0.13
463 d1viaa_ Shikimate kinase (AroK) P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.75 0.612 0.02 1.1 1.3 0.16
464 d1w0ma_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 0.74 0.697 0.03 2.0 1.8 0.26
465 d1iqpa2 Replication factor C P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.74 0.662 0.02 2.2 0.9 0.17
466 d1lv7a_ AAA domain of cell division protein FtsH P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.74 0.659 0.08 2.0 0.6 0.18
467 d1hkka1 Chitotriosidase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.74 0.694 0.01 2.3 1.4 0.26
468 d1adoa_ Fructose-​1,​6-​bisphosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 0.74 0.697 0.01 2.0 1.0 0.24
469 d1ewqa2 DNA repair protein MutS,​ the C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.73 0.654 0.01 2.1 0.8 0.15
470 d1us3a2 Xylanase 10c (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.73 0.696 0.03 3.0 1.6 0.27
471 d1iv8a2 Maltooligosyl trehalose synthase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.73 0.695 0.02 3.8 1.0 0.30
472 d1l2ta_ MJ0796 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.72 0.659 0.20 1.8 0.5 0.18
473 d1k68a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 0.71 0.733 0.01 3.2 1.7 0.15
474 d1pdoa_ IIA domain of mannose transporter,​ IIA-​Man IIA domain of mannose transporter,​ IIA-​Man IIA domain of mannose transporter,​ IIA-​Man α/β 0.71 0.650 0.13 2.6 1.3 0.13
475 d1q0pa_ Complement factor B domain vWA-​like vWA-​like α/β 0.71 0.837 0.06 2.2 1.2 0.18
476 d1b0ua_ ATP-​binding subunit of the histidine permease P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.71 0.657 0.12 1.7 0.6 0.18
477 d1jeha2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.69 0.995 0.01 3.5 1.1 0.13
478 d1l6wa_ Fructose-​6-​phosphate aldolase Aldolase TIM beta/​alpha-​barrel α/β 0.67 0.701 0.02 3.9 1.8 0.24
479 d1h05a_ Type II 3-​dehydroquinate dehydratase Type II 3-​dehydroquinate dehydratase Flavodoxin-​like α/β 0.67 0.603 0.01 2.2 1.7 0.16
480 d1f6ya_ corrinoid/​iron-​sulfur protein methyltransferase MetR Dihydropteroate synthetase-​like TIM beta/​alpha-​barrel α/β 0.66 0.707 0.17 3.6 1.7 0.23
481 d1rcqa2 Alanine racemase PLP-​binding barrel TIM beta/​alpha-​barrel α/β 0.66 0.699 0.01 2.5 1.6 0.21
482 d1jj7a_ Peptide transporter Tap1,​ C-​terminal ABC domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.65 0.655 0.13 1.6 0.4 0.17
483 d1q3qa2 Thermosome,​ A-​domain GroEL apical domain-​like The ​(​swivelling​(​ beta/​beta/​alpha domain α/β 0.65 1.375 0.06 2.2 1.1 0.12
484 d1km4a_ Orotidine 5'​-​monophosphate decarboxylase (OMP decarboxylase) Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.65 0.706 0.02 3.5 2.1 0.22
485 d1j6oa_ Hypothetical protein TM0667 Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 0.64 0.696 0.01 1.9 1.0 0.26
486 d1n55a_ Triosephosphate isomerase Triosephosphate isomerase (TIM) TIM beta/​alpha-​barrel α/β 0.63 0.706 0.04 2.5 1.2 0.21
487 d1e4ea1 D-​alanine:D-​lactate ligase VanA,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.63 0.853 0.01 2.2 1.0 0.13
488 d1qo2a_ Phosphoribosylformimino-​5-​aminoimidazole carboxamide ribotite isomerase HisA Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.63 0.707 0.01 3.7 1.6 0.21
489 d1xfia_ Hypothetical protein At2g17340 Hypothetical protein At2g17340 Hypothetical protein At2g17340 multi 0.62 0.963 0.01 1.9 1.0 0.20
490 d1mt0a_ Haemolysin B ATP-​binding protein P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.62 0.660 0.09 1.6 0.6 0.20
491 d1duvg1 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.61 0.603 0.01 2.1 1.6 0.14
492 d1i4na_ Indole-​3-​glycerophosphate synthase,​ IPGS Ribulose-​phoshate binding barrel TIM beta/​alpha-​barrel α/β 0.60 0.701 0.04 2.0 1.8 0.25
493 d1kfwa1 Psychrophilic chitinase B (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.60 0.694 0.01 1.9 1.1 0.23
494 d1o08a_ beta-​Phosphoglucomutase HAD-​like HAD-​like α/β 0.59 0.837 0.01 2.1 0.9 0.19
495 d1jvba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.58 1.363 0.02 5.2 2.2 0.17
496 d1jwqa_ N-​acetylmuramoyl-​L-​alanine amidase CwlV Zn-​dependent exopeptidases Phosphorylase/​hydrolase-​like α/β 0.58 0.842 0.02 2.4 1.3 0.15
497 d1onea1 Enolase Enolase C-​terminal domain-​like TIM beta/​alpha-​barrel α/β 0.58 0.699 0.01 1.8 1.0 0.26
498 d1gsia_ Thymidylate kinase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.58 0.625 0.01 1.2 1.3 0.18
499 d1dqua_ Isocitrate lyase Phosphoenolpyruvate/​pyruvate domain TIM beta/​alpha-​barrel α/β 0.55 0.696 0.02 2.1 0.9 0.27
500 d1di6a_ MogA Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.55 1.164 0.03 2.4 1.3 0.16
501 d1eswa_ Amylomaltase MalQ (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.54 0.695 0.03 0.9 0.8 0.25
502 d1j7xa_ Interphotoreceptor retinoid-​binding protein IRBP ClpP/​crotonase ClpP/​crotonase α/β 0.52 0.859 0.01 1.9 0.5 0.17
503 d1vl6a2 Malate oxidoreductase (malic enzyme) Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 0.50 0.612 0.01 3.0 1.3 0.11
504 d1js1x1 Transcarbamylase-​like protein Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.50 0.600 0.01 2.1 1.3 0.16
505 d1ejba_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 0.49 0.846 0.03 3.1 1.4 0.15
506 d1ldna1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.49 0.840 0.08 4.4 1.2 0.15
507 d1iowa1 D-​Ala-​D-​Ala ligase,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.49 1.459 0.02 2.9 0.8 0.11
508 d1uz5a3 MoeA,​ central domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.46 0.608 0.03 3.2 1.2 0.13
509 d1vh0a_ Hypothetical protein SAV0024/​SA0023 alpha/​beta knot alpha/​beta knot α/β 0.45 0.774 0.02 1.9 0.8 0.15
510 d1t3ea3 Gephyrin,​ domain 5 Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.44 0.609 0.03 2.3 0.7 0.13
511 d1jkea_ D-​Tyr tRNAtyr deacylase,​ DTD DTD-​like (Pfam 02580) DTD-​like (Pfam 02580) α/β 0.39 0.837 0.01 2.5 1.4 0.15
512 d1iiba_ Enzyme IIB-​cellobiose PTS system,​ Lactose/​Cellobiose specific IIB subunit (Pfam 02302) Phosphotyrosine protein phosphatases I-​like α/β 0.38 1.065 0.01 2.2 1.2 0.09
513 d1d8ca_ Malate synthase G Malate synthase G TIM beta/​alpha-​barrel α/β 0.36 0.695 0.01 3.1 0.5 0.30
514 d1r5ya_ Queosine tRNA-​guanine transglycosylase tRNA-​guanine transglycosylase TIM beta/​alpha-​barrel α/β 0.35 0.704 0.01 2.6 0.8 0.28
515 d1vkfa_ Glycerol uptake operon antiterminator-​related protein TM1436 GlpP-​like TIM beta/​alpha-​barrel α/β 0.24 0.701 0.01 2.9 1.6 0.12
SCOP domains with score worse than the threshold
516 d1pl7a2 Ketose reductase (sorbitol dehydrogenase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.99 0.456 0.05 5.9 2.4 0.20
517 d1onra_ Transaldolase Aldolase TIM beta/​alpha-​barrel α/β 1.97 0.416 0.01 2.9 2.0 0.26
518 d1vl1a_ 6-​phosphogluconolactonase NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.96 -0.851 0.11 3.8 2.6 0.24
519 d1e5xa_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.92 -1.158 0.03 3.5 2.1 0.29
520 d1ne7a_ Glucosamine 6-​phosphate deaminase/​isomerase NagB NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.91 0.151 0.30 3.2 0.6 0.23
521 d1t8ha_ Hypothetical protein YlmD CNF1/​YfiH-​like putative cysteine hydrolases CNF1/​YfiH-​like putative cysteine hydrolases α+β 1.90 -0.451 0.01 2.3 1.3 0.23
522 d1xfja_ Hypothetical protein CC0490 CNF1/​YfiH-​like putative cysteine hydrolases CNF1/​YfiH-​like putative cysteine hydrolases α+β 1.90 -0.330 0.02 2.7 1.4 0.22
523 d1fo8a_ N-​acetylglucosaminyltransferase I Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.90 0.452 0.01 4.4 0.4 0.24
524 d1nupa_ Cytosolic NMN/​NAMN adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.89 -0.872 0.01 4.4 2.0 0.21
525 d1f2da_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.85 -0.712 0.08 3.9 1.4 0.26


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1j31a_ Hypothetical protein PH0642 (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.81  Contact: 3462
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.25 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.17
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.65 gdtts:0.73 tmscore:0.87 rmsd:0.87 AHM:0.75 LBcontacta:0.62 LBcontactb:0.74 LHM:0.48
id:0.15 blosum:0.23 compass:0.58 pearson:0.55

hit structure      alignment
DALI alignment (Z-score: 28.1 Raw score:2714.30)
Query          1 slQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED--LALR     58
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESreEVFD     58

Query         59 ssFVEA--sRTALRELAARLAeegFGELPVLVGYLDRSEsaqpkygqpaGAPRNAAAVLH    116
d1j31a_       59 --VAQQipeGETTTFLMELAR---ELGLYIVAGTAEKSG----------NYLYNSAVVVG    103

Query        117 RGRVALTFAKHHLPnygvFDEFRYFVPGD-TMPIVRLHGVDIALAICEDLWQDgGRVPAA    175
d1j31a_      104 PRGYIGKYRKIHLF----YREKVFFEPGDlGFKVFDIGFAKVGVMICFDWFFP-ESARTL    158

Query        176 RSAGAGLLLSVNASPYErdkddTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVV    235
d1j31a_      159 ALKGAEIIAHPANLVMP-----YAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIA    213

Query        236 DRDGEVVARAPQFSEGCVVLDLDLPaaeaepptgvvddglridrlviseeplpayeaela    295
d1j31a_      214 SPKAEVLSIASETEEEIGVVEIDLN-----------------------------------    238

Query        296 ggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvy    355
d1j31a_      239 ------------------------------------------------------------    239

Query        356 gvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrg    415
d1j31a_      239 ------------------------------------------------------------    239

Query        416 ttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraa    475
d1j31a_      239 ------------------------------------------------------------    239

Query        476 aergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtae    535
d1j31a_      239 ------------------------------------------------------------    239

Query        536 ykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1j31a_      239 ---------larnkrlndmndifkdrreeyyfr    262


hit structure      alignment
FAST alignment (Normalized score: 14.79 Raw score:5705.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV--EDLALR     58
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEV--     56

Query         59 SSFV---------EASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA-GAP    108
d1j31a_       57 ----FDVAQQIPEGETTTFLMELARE------LGLYIVAGTAEKS-----------GNYL     95

Query        109 RNAAAVLHR--GRVALTFAKHHLPNYGV-FDEFRYFVPGD-TMPIVRLHGVDIALAICED    164
d1j31a_       96 YNSAVVV--GPRGYIGKYRKIHL-----FYREKVFFEPGDLGFKVFDIGFAKVGVMICFD    148

Query        165 LWQDGGRVPAARSAGAGLLLSVNASPYERDKD-DTRLELVRKRAQEAGCTTAYLAMIGGQ    223
d1j31a_      149 WFFP-ESARTLALKGAEIIAHPANLV------MPYAPRAMPIRALENRVYTITADRVGEE    201

Query        224 DELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVIS    283
d1j31a_      202 RGLKFIGKSLIASPKAEVLSIASETEEEIGVVEID-------------------------    236

Query        284 EEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAA    343
d1j31a_      237 ------------------------------------------------------------    237

Query        344 IACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTG    403
d1j31a_      237 ------------------------------------------------------------    237

Query        404 LAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTS    463
d1j31a_      237 ------------------------------------------------------------    237

Query        464 IFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDREL    523
d1j31a_      237 ------------------------------------------------------------    237

Query        524 VVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH---------------    568
d1j31a_      237 ---------------------------------------------LNLARNKRLNDMNDI    251

Query        569 -----------    569
d1j31a_      252 FKDRREEYYFR    262


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:223.49)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1j31a_        1 --MVKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEVFD     58

Query         61 FVEAS-RTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGR    119
d1j31a_       59 VAQQIPEGETTTFLMELAR-EL-GLYIVAGTAEKSG----------NYLYNSAVVVGPRG    106

Query        120 VALTFAKHHLPNYGVFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQDGGRVPAARSA    178
d1j31a_      107 YIGKYRKIHLF----YREKVFFEPGDLGFKVFDIGFAKVGVMICFDWFFPE-SARTLALK    161

Query        179 GAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRD    238
d1j31a_      162 GAEIIAHPANLVMP-----YAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIASPK    216

Query        239 GEVVARAPQFSEGCVVLDLDLP-AAE--------------AEPPTGVVD-----DGLRID    278
d1j31a_      217 AEVLSIASETEEEIGVVEIDLNLARNKRLNDMNDIFKDRR--------EEYYFR------    262

Query        279 RLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDS    338
d1j31a_      263 ------------------------------------------------------------    263

Query        339 ALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMAS    398
d1j31a_      263 ------------------------------------------------------------    263

Query        399 LGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKD    458
d1j31a_      263 ------------------------------------------------------------    263

Query        459 VYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAG    518
d1j31a_      263 ------------------------------------------------------------    263

Query        519 YDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1j31a_      263 --------------------------------------------------    263


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ***************************************************....  ***
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVE     63
d1j31a_        2 VKVGYIQMEPKILELDKNYSKAEKLIKEASKEGAKLVVLPELFDTGYNFESREEVFDVAQ     61

DALI match       *      ..........      **************          *************
Query         64 A-----SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG    118
d1j31a_       62 QIPEGETTTFLMELARE------LGLYIVAGTAEKSG----------NYLYNSAVVVGPR    105

DALI match       ************    ***********. **********************. *******
Query        119 RVALTFAKHHLPNYGVFDEFRYFVPGDT-MPIVRLHGVDIALAICEDLWQDGGRVPAARS    177
d1j31a_      106 GYIGKYRKIHLF----YREKVFFEPGDLGFKVFDIGFAKVGVMICFDWFFPE-SARTLAL    160

DALI match       *************       ****************************************
Query        178 AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDR    237
d1j31a_      161 KGAEIIAHPANLV-----MPYAPRAMPIRALENRVYTITADRVGEERGLKFIGKSLIASP    215

DALI match       ***********************                    
Query        238 DGEVVARAPQFSEGCVVLDLDLPAAEAEPP--TGVVDDGLRID    278
d1j31a_      216 KAEVLSIASETEEEIGVVEIDLNLARNKRLNDMNDIFKDRREE    258



top
2: d1f89a_ hypothetical protein yl85 (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.83  Contact: 3294
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.12
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.64 gdtts:0.72 tmscore:0.87 rmsd:0.87 AHM:0.79 LBcontacta:0.60 LBcontactb:0.71 LHM:0.59
id:0.15 blosum:0.23 compass:0.53 pearson:0.49

hit structure      alignment
DALI alignment (Z-score: 26.4 Raw score:2649.90)
Query          1 ------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQG--AHLVAFPEMALTGYpV     52
d1f89a_        1 saskilSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQpdTKLVVLPECFNSPY-S     59

Query         53 EDLALRssFVEASR----TALRELAARLAeeGFGELPVLV-GYLDRSESaqpkygqpAGA    107
d1f89a_       60 TDQFRK--YSEVINpkepSTSVQFLSNLA--NKFKIILVGgTIPELDPK--------TDK    107

Query        108 PRNAAAVLH-RGRVALTFAKHHLpnygvfDEFRYFVPGDTMPIVRLHGVDIALAICEDLW    166
d1f89a_      108 IYNTSIIFNeDGKLIDKHRKVHL-----fHESETLSPGEKSTTIDTKYGKFGVGICYDMR    162

Query        167 QDgGRVPAARSAGAGLLLSVNASPYErdkDDTRLELVRKRAQEAGCTTAYLAMIGGQ-DE    225
d1f89a_      163 FP-ELAMLSARKGAFAMIYPSAFNTV-tgPLHWHLLARSRAVDNQVYVMLCSPARNLqSS    220

Query        226 LVFDGDSIVVDRDGEVVARAPqFSEGCVVLDLDLPaaeaepptgvvddglridrlvisee    285
d1f89a_      221 YHAYGHSIVVDPRGKIVAEAG-EGEEIIYAELDPE-------------------------    254

Query        286 plpayeaelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaia    345
d1f89a_      255 ------------------------------------------------------------    255

Query        346 cdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltgla    405
d1f89a_      255 ------------------------------------------------------------    255

Query        406 eenlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsif    465
d1f89a_      255 ------------------------------------------------------------    255

Query        466 rlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvv    525
d1f89a_      255 ------------------------------------------------------------    255

Query        526 ktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1f89a_      255 --------------------------viesfrqavpltkqrrf    271


hit structure      alignment
FAST alignment (Normalized score: 13.47 Raw score:5287.00)
Query          1 ------SLQLRLALNQIDST--VGDIAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGY     50
d1f89a_        1 SASKILSQKIKVALVQLS--GSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPY     58

Query         51 PVEDLALRSSFV------------EASRTALRELAARLAEEGFGELPVL-VGYLDRSESA     97
d1f89a_       59 -STDQF------RKYSEVINPKEPSTSVQFLSNLANK------FKIILVGGTIPELDP--    103

Query         98 QPKYGQP-AGAPRNAAAV-LHRGRVALTFAKHHLPNYGVF--DEFRYFVPGDTMPIVRLH    153
d1f89a_      104 -------KTDKIYNTSIIFNEDGKLIDKHRKVH-------LFHESETLSPGEKSTTIDTK    149

Query        154 GVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----DTRLELVRKRAQ    208
d1f89a_      150 YGKFGVGICYDMRFP-ELAMLSARKGAFAMIYPSAFN------TVTGPLHWHLLARSRAV    202

Query        209 EAGCTTAYLAMIGGQ-----DELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE    263
d1f89a_      203 DNQVYVMLCSP----ARNLQSSYHAYGHSIVVDPRGKIVAEA-GEGEEIIYAELD-----    252

Query        264 AEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKN    323
d1f89a_      253 ------------------------------------------------------------    253

Query        324 GFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNF    383
d1f89a_      253 ------------------------------------------------------------    253

Query        384 RTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYS    443
d1f89a_      253 ------------------------------------------------------------    253

Query        444 TLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILEL    503
d1f89a_      253 ------------------------------------------------------------    253

Query        504 YVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNR    563
d1f89a_      253 ------------------------------------------------------------    253

Query        564 WREGH-------------------    568
d1f89a_      253 -----PEVIESFRQAVPLTKQRRF    271


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:224.72)
Query          1 S------LQLRLALNQIDSTVGDIAGNAEAILRWTRHSAE-Q-GAHLVAFPEMALTGYPV     52
d1f89a_        1 SASKILSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYS-     59

Query         53 EDLALRSSFVEASR----TALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPAGA    107
d1f89a_       60 TDQFRK--YSEVINPKEPSTSVQFLSNLAN-KF-KIILVGGTIPELDPK--------TDK    107

Query        108 PRNAAAVLH-RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLW    166
d1f89a_      108 IYNTSIIFNEDGKLIDKHRKVHL-----FHESETLSPGEKSTTIDTKYGKFGVGICYDMR    162

Query        167 QDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDE    225
d1f89a_      163 FPE-LAMLSARKGAFAMIYPSAFNTVTG-PLHWHLLARSRAVDNQVYVMLCSPARNLQSS    220

Query        226 LVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDL--PA--------------AEAEPPTG    269
d1f89a_      221 YHAYGHSIVVDPRGKIVAEAG-EGEEIIYAELDPEVIESFRQAVPLTKQRRF--------    271

Query        270 VVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVL    329
d1f89a_      272 ------------------------------------------------------------    272

Query        330 IGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIE    389
d1f89a_      272 ------------------------------------------------------------    272

Query        390 PMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDS    449
d1f89a_      272 ------------------------------------------------------------    272

Query        450 VGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDT    509
d1f89a_      272 ------------------------------------------------------------    272

Query        510 GADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1f89a_      272 -----------------------------------------------------------    272


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ***********************************  .**************........
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ--GAHLVAFPEMALTGYPVEDLALR     58
d1f89a_        7 SQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYSTDQFRKY     66

DALI match         ...        .........      *******.......         *********
Query         59 SSFVE-----ASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAA    113
d1f89a_       67 SEVINPKEPSTSVQFLSNLANK------FKIILVGGTIPELD-------PKTDKIYNTSI    113

DALI match       *** *************      *********************************. **
Query        114 VLH-RGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRV    172
d1f89a_      114 IFNEDGKLIDKHRKVHL-----FHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPE-LA    167

DALI match       ********************   *************************** .********
Query        173 PAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDELVFDGD    231
d1f89a_      168 MLSARKGAFAMIYPSAFNTVTG-PLHWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGH    226

DALI match       ***************. ************                 
Query        232 SIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRI    277
d1f89a_      227 SIVVDPRGKIVAEAGE-GEEIIYAELDPEVIESFRQAVPLTKQRRF    271



top
3: d1uf5a_ N-​carbamoyl-​D-​aminoacid amidohydrolase (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.68  Contact: 3444
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.30 AHM:0.34 LBcontacta:1.00 LBcontactb:1.00 LHM:0.13
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.59 gdtts:0.63 tmscore:0.82 rmsd:0.85 AHM:0.73 LBcontacta:0.57 LBcontactb:0.71 LHM:0.54
id:0.15 blosum:0.24 compass:0.54 pearson:0.45

hit structure      alignment
DALI alignment (Z-score: 24.9 Raw score:2592.30)
Query          1 SLQLRLALNQIDSTV--GDIAGNAEAILRWTRHSAEQGAHLVAFPEMALtGYPVE-----     53
d1uf5a_        1 TRQMILAVGQQGPIAraETREQVVVRLLDMLTKAASRGANFIVFPELAL-TTFFPrwhft     59

Query         54 --dLALRssFVEASRT-ALRELAARLAeegFGELPVLVGYLDRSESAqpkygqPAGAPRN    110
d1uf5a_       60 deaELDS-fYETEMPGpVVRPLFEKAA---ELGIGFNLGYAELVVEG------GVKRRFN    109

Query        111 AAAVLH-RGRVALTFAKHHLPNY--------gVFDEFRYFVPGD-TMPIVRLHGVDIALA    160
d1uf5a_      110 TSILVDkSGKIVGKYRKIHLPGHkeyeayrpfQHLEKRYFEPGDlGFPVYDVDAAKMGMF    169

Query        161 ICEDLWQDgGRVPAARSAGAGLLLSVNASPYE------RDKD--DTRLELVRKRAQEAGC    212
d1uf5a_      170 IANDRRWP-EAWRVMGLRGAEIICGGYNTPTHnppvpqHDHLtsFHHLLSMQAGSYQNGA    228

Query        213 TTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPaaeaepptgvvd    272
d1uf5a_      229 WSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLD------------    276

Query        273 dglridrlviseeplpayeaelaggyadrldadeevysalvvglrayvakngfrsvligl    332
d1uf5a_      277 ------------------------------------------------------------    277

Query        333 sggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmf    392
d1uf5a_      277 ------------------------------------------------------------    277

Query        393 daymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvga    452
d1uf5a_      277 ------------------------------------------------------------    277

Query        453 ygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgad    512
d1uf5a_      277 ------------------------------------------------------------    277

Query        513 aivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1uf5a_      277 -----------------------------rcrelrehifnfkqhrqpqhygliael    303


hit structure      alignment
FAST alignment (Normalized score: 13.16 Raw score:5458.00)
Query          1 SLQLRLALNQ-IDSTVG-DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL-     57
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTT--------F     52

Query         58 -----------RSSFVEAS------RTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d1uf5a_       53 FPRWHFTDEAELDSF----YETEMPGPVVRPLFEKAAE---LGIGFNLGYAELV------     99

Query        101 YGQP----AGAPRNAAAV-LHRGRVALTFAKHHLPNYG------------VFDEFRYFVP    143
d1uf5a_      100 ----VEGGVKRRFNTSILVDKSGKIVGKYRKIHL----PGHKEYEAYRPFQHLEKRYFEP    151

Query        144 GD-TMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD------    196
d1uf5a_      152 GDLGFPVYDVDAAKMGMFIANDRRWP-EAWRVMGLRGAEIICGGYNTP------THNPPV    204

Query        197 --------DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQF    248
d1uf5a_      205 PQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTL    264

Query        249 SEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEV    308
d1uf5a_      265 EDEVITAAVD--------------------------------------------------    274

Query        309 YSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHS    368
d1uf5a_      275 ------------------------------------------------------------    275

Query        369 KGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHI    428
d1uf5a_      275 ------------------------------------------------------------    275

Query        429 VLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEAS    488
d1uf5a_      275 ------------------------------------------------------------    275

Query        489 ITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKIS    548
d1uf5a_      275 ------------------------------------------------------------    275

Query        549 AKGFGKDRRLPITNRWREGH-----------------------------    568
d1uf5a_      275 --------------------LDRCRELREHIFNFKQHRQPQHYGLIAEL    303


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:233.10)
Query          1 SLQLRLALNQID-STVGD-IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV-E-DLA     56
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTD     60

Query         57 LR-SSFVEASRTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQPAGAPRNAAAV    114
d1uf5a_       61 EAELDSFY-ETEMPGPVVRPLFEKAAELGIGFNLGYAELVVEG------GVKRRFNTSIL    113

Query        115 LH-RGRVALTFAKHHLPNYG--------VFDEFRYFVPGDT-MPIVRLHGVDIALAICED    164
d1uf5a_      114 VDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFIAND    173

Query        165 LWQDGGRVPAARSAGAGLLLSVNASPYE-------RDKD-DTRLELVRKRAQEAGCTTAY    216
d1uf5a_      174 RRWPE-AWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWSAA    232

Query        217 LAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE-------------    263
d1uf5a_      233 AGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQHR    292

Query        264 -------AEPPTGVVDDG-LRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVG    315
d1uf5a_      293 QPQHYGL--------IAEL-----------------------------------------    303

Query        316 LRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAEL    375
d1uf5a_      304 ------------------------------------------------------------    304

Query        376 ARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNK    435
d1uf5a_      304 ------------------------------------------------------------    304

Query        436 SELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYP    495
d1uf5a_      304 ------------------------------------------------------------    304

Query        496 VLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKD    555
d1uf5a_      304 ------------------------------------------------------------    304

Query        556 RRLPITNRWREGH    568
d1uf5a_      304 -------------    304


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **************  .********************************......     
Query          1 SLQLRLALNQIDST--VGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1uf5a_        1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTD     60

DALI match                      **********.    **************       *********
Query         59 SSFVEASRT------ALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAA    112
d1uf5a_       61 EAELDSFYETEMPGPVVRPLFEKAAEL---GIGFNLGYAELVVE------GGVKRRFNTS    111

DALI match       ****. ***************            *********. ****************
Query        113 AVLHR-GRVALTFAKHHLPNYGVFD--------EFRYFVPGDT-MPIVRLHGVDIALAIC    162
d1uf5a_      112 ILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFIA    171

DALI match       ******. **********************              ****************
Query        163 EDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDT--------RLELVRKRAQEAGCTT    214
d1uf5a_      172 NDRRWPE-AWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWS    230

DALI match       **********************************************              
Query        215 AYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDG    274
d1uf5a_      231 AAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQ    290

DALI match                                              
Query        275 LRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALV    313
d1uf5a_      291 HRQP----------------------------QHYGLIA    301



top
4: d1emsa2 NIT-​FHIT fusion protein,​ N-​terminal domain (hh: 1.000)

SCOP Superfamily: Carbon-​nitrogen hydrolase  |  SCOP Fold: Carbon-​nitrogen hydrolase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.79  Contact: 3351
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.27 AHM:0.30 LBcontacta:1.00 LBcontactb:1.00 LHM:0.12
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.61 gdtts:0.66 tmscore:0.85 rmsd:0.86 AHM:0.77 LBcontacta:0.58 LBcontactb:0.71 LHM:0.59
id:0.17 blosum:0.23 compass:0.54 pearson:0.48

hit structure      alignment
DALI alignment (Z-score: 25.8 Raw score:2601.40)
Query          1 --SLQLRLALNQIDSTvGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGyPVED-LAL     57
d1emsa2        1 maTGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFI-GLNKnEQI     58

Query         58 RssFVEASR-TALRELAARLAeegFGELPVLV-GYLDRSEsaqpkygqPAGA-PRNAAAV    114
d1emsa2       59 D--LAMATDcEYMEKYRELAR---KHNIWLSLgGLHHKDP--------SDAAhPWNTHLI    105

Query        115 LH-RGRVALTFAKHHLPNY-----gvFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQ    167
d1emsa2      106 IDsDGVTRAEYNKLHLFDLeipgkvrLMESEFSKAGtEMIPPVDTPIGRLGLSICYDVRF    165

Query        168 DGgRVPAARSAGAGLLLSVNASPYErdkdDTRLELVRKRAQEAGCTTAYLAMIGG-QDEL    226
d1emsa2      166 PE-LSLWNRKRGAQLLSFPSAFTLN-tglAHWETLLRARAIENQCYVVAAAQTGAhNPKR    223

Query        227 VFDGDSIVVDRDGEVVARAPQfSEGCVVLDLDLPaaeaepptgvvddglridrlviseep    286
d1emsa2      224 QSYGHSMVVDPWGAVVAQCSE-RVDMCFAEIDLS--------------------------    256

Query        287 lpayeaelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiac    346
d1emsa2      257 ------------------------------------------------------------    257

Query        347 dalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglae    406
d1emsa2      257 ------------------------------------------------------------    257

Query        407 enlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifr    466
d1emsa2      257 ------------------------------------------------------------    257

Query        467 laewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvk    526
d1emsa2      257 ------------------------------------------------------------    257

Query        527 tlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1emsa2      257 ---------------------------yvdtlremqpvfshr    271


hit structure      alignment
FAST alignment (Normalized score: 13.47 Raw score:5286.00)
Query          1 --SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL-     57
d1emsa2        1 MATGRHFIAVCQMTS-DNDLEKNFQAAKNMIERAGEKKCEMVFLPECFD----------F     49

Query         58 -------RSSFVEASR-TALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPA---    105
d1emsa2       50 IGLNKNEQIDLAMATDCEYMEKYRELARK---HNIWLSLGGLHHKDP----------SDA     96

Query        106 GAPRNAAAVL-HRGRVALTFAKHHLPNYGV---------FDEFRYFVPGDTM-PIVRLHG    154
d1emsa2       97 AHPWNTHLIIDSDGVTRAEYNKLHLF----DLEIPGKVRLMESEFSKAGTEMIPPVDT--    150

Query        155 --VDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----DTRLELVRKRA    207
d1emsa2      151 PIGRLGLSICYDVRFP-ELSLWNRKRGAQLLSFPSAFT------LNTGLAHWETLLRARA    203

Query        208 QEAGCTTAYLAMIGG-QDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEP    266
d1emsa2      204 IENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGAVVAQCS-ERVDMCFAEID--------    254

Query        267 PTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFR    326
d1emsa2      255 ------------------------------------------------------------    255

Query        327 SVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTV    386
d1emsa2      255 ------------------------------------------------------------    255

Query        387 SIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLY    446
d1emsa2      255 ------------------------------------------------------------    255

Query        447 GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVD    506
d1emsa2      255 ------------------------------------------------------------    255

Query        507 RDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE    566
d1emsa2      255 ------------------------------------------------------------    255

Query        567 GH-----------------    568
d1emsa2      255 --LSYVDTLREMQPVFSHR    271


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:226.65)
Query          1 --SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1emsa2        1 MATGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFI-GLNKNEQI     58

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLV-GYLDRSESAQPKYGQPAG-APRNAAAVLH    116
d1emsa2       59 -DLAMATDCEYMEKYRELAR-KH-NIWLSLGGLHHKDPS--------DAAHPWNTHLIID    107

Query        117 -RGRVALTFAKHHLPNY-----GVFDEFRYFVPG-DTMPIVRLHGVDIALAICEDLWQDG    169
d1emsa2      108 SDGVTRAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPE    167

Query        170 GRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQ-DELVF    228
d1emsa2      168 L-SLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGAHNPKRQS    225

Query        229 DGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAE------------AEPPTGVVDDGLR    276
d1emsa2      226 YGHSMVVDPWGAVVAQCS-ERVDMCFAEIDLSYVDTLREMQPVFSHR-------------    271

Query        277 IDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGI    336
d1emsa2      272 ------------------------------------------------------------    272

Query        337 DSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYM    396
d1emsa2      272 ------------------------------------------------------------    272

Query        397 ASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPI    456
d1emsa2      272 ------------------------------------------------------------    272

Query        457 KDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVA    516
d1emsa2      272 ------------------------------------------------------------    272

Query        517 AGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1emsa2      272 ----------------------------------------------------    272


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ************** **********************************.....****. 
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1emsa2        3 TGRHFIAVCQMTSD-NDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLA     61

DALI match       ...  ............      *******.......       .....******** .*
Query         61 FVE--ASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVL-HR    117
d1emsa2       62 MATDCEYMEKYRELARK------HNIWLSLGGLHHKDP------SDAAHPWNTHLIIDSD    109

DALI match       ************          **********... ********************** *
Query        118 GRVALTFAKHHL-----PNYGVFDEFRYFVPGDTM-PIVRLHGVDIALAICEDLWQDGGR    171
d1emsa2      110 GVTRAEYNKLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPE-L    168

DALI match       *********************    ************************** ********
Query        172 VPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGG-QDELVFDG    230
d1emsa2      169 SLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYG    227

DALI match       ***************** ************               
Query        231 DSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGL    275
d1emsa2      228 HSMVVDPWGAVVAQCSE-RVDMCFAEIDLSYVDTLREMQPVFSHR    271



top
5: d1kqpa_ NH3-​dependent NAD+-​synthetase (hh: 1.000)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.75  Contact: 2428
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.24 AHM:0.29 LBcontacta:1.00 LBcontactb:1.00 LHM:0.21
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.86 daliz:0.71 gdtts:0.81 tmscore:0.91 rmsd:0.91 AHM:0.82 LBcontacta:0.59 LBcontactb:0.72 LHM:0.47
id:0.19 blosum:0.27 compass:0.66 pearson:0.59

hit structure      alignment
DALI alignment (Z-score: 22.5 Raw score:2205.80)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1kqpa_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1kqpa_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1kqpa_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1kqpa_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1kqpa_        1 -----------------------------------------------smqekimrelhvk     13

Query        301 rldADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG-------aqN    353
d1kqpa_       14 psiDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVEsireeggdaQ     73

Query        354 VYGVSMPSKySSDHsKGDAAELARRTGL-NFRTVSIEPMFDAYMASL------GLTGLAE    406
d1kqpa_       74 FIAVRLPHG-TQQD-EDDAQLALKFIKPdKSWKFDIKSTVSAFSDQYqqetgdQLTDFNK    131

Query        407 ENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTlYGDSVGAYGPIKDVYKTSIFR    466
d1kqpa_      132 GNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTkYGDGGADLLPLTGLTKRQGRT    191

Query        467 LAEWRNraaaergqtppIPEASITK--------------------PDYPVLDAILELyvd    506
d1kqpa_      192 LLKELG-----------APERLYLKeptadlldekpqqsdetelgISYDEIDDYLEG---    237

Query        507 rdtgadaivaaGYDRELVVKTLRMVDTAEYKRRQyppgtkisakgfgkdrrlPITNrwre    566
d1kqpa_      238 ----------kEVSAKVSEALEKRYSMTEHKRQV------------pasmfdDWWK----    271

Query        567 gh    568
d1kqpa_      272 --    272


hit structure      alignment
FAST alignment (Normalized score: 11.56 Raw score:4537.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1kqpa_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1kqpa_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1kqpa_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1kqpa_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1kqpa_        1 ------------------------------------------------------------      1

Query        301 RLD----------------ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAI    344
d1kqpa_        1 ---SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRL     57

Query        345 ACDALGAQ-----------NVYGVSMPSKYSSDH-SKGDAAELARRTG-LNFRTVSIEPM    391
d1kqpa_       58 AQLA----VESIREEGGDAQFIAVRLPHGTQ---QDEDDAQLALKFIKPDKSWKFDIKST    110

Query        392 FDAYMAS------LGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTL    445
d1kqpa_      111 VSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTG----    166

Query        446 Y-----GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTP-PIPEASITK--------    491
d1kqpa_      167 -FFTKYGDGGADLLPLTGLTKRQGRTLLKE------------LGAPERLYL-KEPTADLL    212

Query        492 -------------PDYPVLDAILELYVDRDTGADAIVA--AGYDRELVVKTLRMVDTAEY    536
d1kqpa_      213 DEKPQQSDETELGISYDEIDDYL---------------EGKEVSAKVSEALEKRYSMTEH    257

Query        537 KRRQYPPGTKISAKGFGKDRRLPITNRWREGH------------    568
d1kqpa_      258 KR------------------------------QVPASMFDDWWK    271


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:209.57)
Query          1 -------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1kqpa_        1 SMQEKIM-----------------------------------------------------      7

Query         54 DLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAA    113
d1kqpa_        8 ------------------------------------------------------------      8

Query        114 VLHRGRVALTFAKHHLPNYGV--FDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGR    171
d1kqpa_        8 --------------------REL-------------------------------------     10

Query        172 VPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGD    231
d1kqpa_       11 -------------------HVKPS------------------------------------     15

Query        232 SIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYE    291
d1kqpa_       16 ------------------------------------------------------------     16

Query        292 AELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGA    351
d1kqpa_       16 -----------IDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVES     64

Query        352 -------QNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMASL----    399
d1kqpa_       65 IREEGGDAQFIAVRLPHGTQQ-D-EDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQET    122

Query        400 --GLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIK    457
d1kqpa_      123 GDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLT    182

Query        458 DVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK--------------------PDYPVL    497
d1kqpa_      183 GLTKRQGRTLLKELG-----------APERLYLKEPTADLLDEKPQQSDETELGISYDEI    231

Query        498 DAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQY----PPGTKISAKGFG    553
d1kqpa_      232 DDYLEG----------K--E-VSAKVSEALEKRYSMTEHKRQVPASMF------------    266

Query        554 KDRRLPITNRWREGH    568
d1kqpa_      267 ---DDWWK-------    271


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match             ...... ****************************************       
Query        297 GYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDAL-------    349
d1kqpa_       11 HVKPSIDPKQEI-EDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEG     69

DALI match          ********  ..... *************... ***************        *
Query        350 GAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFR-TVSIEPMFDAYMASLGL------T    402
d1kqpa_       70 GDAQFIAVRLP--HGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLT    127

DALI match       ****************************************** *****************
Query        403 GLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKT    462
d1kqpa_      128 DFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKR    187

DALI match       ********* .                            ************         
Query        463 SIFRLAEWRNRAAAERGQTPPIPEASI---TK-------PDYPVLDAILELYVDRDTGAD    512
d1kqpa_      188 QGRTLLKEL-GAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEG---------    237

DALI match            ********************* .     
Query        513 AIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGT    545
d1kqpa_      238 ----KEVSAKVSEALEKRYSMTEHKR-QVPASM    265



hit structures. 
top
6: d1gpma1 GMP synthetase,​ central domain (hh: 1.000)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.86  Contact: 1655
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.31 AHM:0.34 LBcontacta:1.00 LBcontactb:0.99 LHM:0.23
id:1.00 blosum:0.98 compass:0.81 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.58 gdtts:0.59 tmscore:0.76 rmsd:0.85 AHM:0.75 LBcontacta:0.52 LBcontactb:0.67 LHM:0.43
id:0.11 blosum:0.20 compass:0.35 pearson:0.34

hit structure      alignment
DALI alignment (Z-score: 17.0 Raw score:1263.90)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1gpma1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1gpma1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1gpma1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1gpma1        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1gpma1        1 ------------------------------------------------------------      1

Query        301 rlDADEEVYSALVVGLRAYVAkngFRSVLIGLSGGIDSALVAAIACDALGaQNVYGVSMP    360
d1gpma1        1 --WTPAKIIDDAVARIREQVG---DDKVILGLSGGVDSSVTAMLLHRAIG-KNLTCVFVD     54

Query        361 SKYSS-DHSKGDAAELARRTGLNFRTVSIEPMFDAYMAsLGLTGLAEENLQSRLRGTTLM    419
d1gpma1       55 NGLLRlNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALA-GENDPEAKRKIIGRVFVEVFD    113

Query        420 AISNQE--GHIVLAPGNKSELAVGystlygdsvgAYGPIKDVYKTSIFRLAEWRNraaae    477
d1gpma1      114 EEALKLedVKWLAQGTIYPDVIES-----aakmgLVEPLKELFKDEVRKIGLELG-----    163

Query        478 rgqtppIPEASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeyk    537
d1gpma1      164 ------LPYDMLYR----------------------------------------------    171

Query        538 rrqyppgtkisakgfgkdrrlpitnrwregh    568
d1gpma1      172 ---------------------------hpfp    175


hit structure      alignment
FAST alignment (Normalized score: 8.89 Raw score:2802.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1gpma1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1gpma1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1gpma1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1gpma1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1gpma1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGF---RSVLIGLSGGIDSALVAAIACDALGAQNVYGV    357
d1gpma1        1 --WTPAKIIDDAVARIREQ------VGDDKVILGLSGGVDSSVTAMLLHRA-IGKNLTCV     51

Query        358 SMPSKYSSDHSKGDAA-ELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGT    416
d1gpma1       52 FVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGE-NDPEAKRKIIGRVFVE    110

Query        417 TLMAISNQEG----HIVLAPGNKSELAVGYSTLYGDSVG-------AYGPIKDVYKTSIF    465
d1gpma1      111 VFDEEALK--LEDVKWLAQGTIYPDVI------------ESAAKMGLVEPLKELFKDEVR    156

Query        466 RLAEWRNRAAAERGQTP-PIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELV    524
d1gpma1      157 KIGLE------------LGLPYDMLY----------------------------------    170

Query        525 VKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-----    568
d1gpma1      171 --------------------------------------------RHPFP    175


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:151.12)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1gpma1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1gpma1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1gpma1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1gpma1        1 --------------W---------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1gpma1        2 ------------------------------------------------------------      2

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP    360
d1gpma1        2 ---TPAKIIDDAVARIREQVG--DD-KVILGLSGGVDSSVTAMLLHRAIG-KNLTCVFVD     54

Query        361 SKYSSDHSKGDAA-ELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLM    419
d1gpma1       55 NGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALA-GENDPEAKRKIIGRVFVEVFD    113

Query        420 AISNQEG-H-IVLAPGNKSELAVG---YSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRA    474
d1gpma1      114 EEALKLEDVKWLAQGTIYPDVIESAAK--------MGLVEPLKELFKDEVRKIGLELG--    163

Query        475 AAERGQTPPIPEASITKPDY--PVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVD    532
d1gpma1      164 ---------LPYDMLYR-HPFP--------------------------------------    175

Query        533 TAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1gpma1      176 ------------------------------------    176


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ****************.   *************************...............
Query        306 EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSS    365
d1gpma1        4 AKIIDDAVARIREQVGD---DKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRL     60

DALI match       ********************************... ************************
Query        366 DHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQE    425
d1gpma1       61 NEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGEN-DPEAKRKIIGRVFVEVFDEEALKL    119

DALI match       ... .............      .    ******************* .           
Query        426 GHI-VLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPI    484
d1gpma1      120 EDVKWLAQGTIYPDVIESAAKMGL----VEPLKELFKDEVRKIGLEL-GLPYDMLYRHPF    174

DALI match        
Query        485 P    485
d1gpma1      175 P    175



top
7: d1ni5a1 Putative cell cycle protein MesJ,​ N-​terminal domain (hh: 0.999)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.58  Contact: 1599
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.98 tmscore:0.99 rmsd:0.54 AHM:0.63 LBcontacta:1.00 LBcontactb:0.99 LHM:0.21
id:0.97 blosum:0.56 compass:0.48 pearson:1.00
Scaled scores:
dali:0.78 daliz:0.55 gdtts:0.44 tmscore:0.60 rmsd:0.72 AHM:0.61 LBcontacta:0.44 LBcontactb:0.63 LHM:0.42
id:0.03 blosum:0.12 compass:0.30 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 13.9 Raw score:1146.20)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1ni5a1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1ni5a1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1ni5a1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1ni5a1        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1ni5a1        1 ------------------------------------------------------------      1

Query        301 rldadeevysALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALG---aQNVYGV    357
d1ni5a1        1 ----------SMTLTLNRQLL--TSRQILVAFSGGLDSTVLLHQLVQWRTenpgVALRAI     48

Query        358 SMPSKYS--SDHSKGDAAELARRTGLNFRTVSIEpmFDAYMaslgltglAEEN-LQSRLR    414
d1ni5a1       49 HVHHGLSanADAWVTHCENVCQQWQVPLVVERVQ--LAQEG--------LGIEaQARQAR     98

Query        415 GTTLMAISNqEGHIVLAPGNKSELAVG-----------------ystlygdsvgAYGPIK    457
d1ni5a1       99 YQAFARTLL-PGEVLVTAQHLDDQCETfllalkrgsgpaglsamaevsefagtrLIRPLL    157

Query        458 DVYKTSIFRLAEWRNraaaergqtppIPEAS------------------------itkPD    493
d1ni5a1      158 ARTRGELVQWARQYD-----------LRWIEdesnqddsydrnflrlrvvpllqqrwpHF    206

Query        494 YPVLDAIlELYVdRDTGadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfg    553
d1ni5a1      207 AEATARSaALCA-EQES-------------------------------------------    222

Query        554 kdrrlpitnrwregh    568
d1ni5a1      223 ----------lldel    227


hit structure      alignment
FAST alignment (Normalized score: 6.05 Raw score:2174.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ni5a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ni5a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1ni5a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1ni5a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1ni5a1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSA-LVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ-------    352
d1ni5a1        1 -----------SMTLTLNRQL--LTSRQILVAFSGGLDSTVLLHQLVQW----RTENPGV     43

Query        353 NVYGVSMPSKYS--SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAE----    406
d1ni5a1       44 ALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERV------------------QLAQ     85

Query        407 -----ENLQSRLRGTTLMAISNQ--EGHIVLAPGNKSELAVGYSTLYGDSVG--------    451
d1ni5a1       86 EGLGIEAQARQARYQAFART---LLPGEVLVTAQHLDDQC------------ETFLLALK    130

Query        452 ---------------------AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASIT    490
d1ni5a1      131 RGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQ--------------------    170

Query        491 KP-----------------------------------DYPVLDAILELYVDRDTGADAIV    515
d1ni5a1      171 --YDLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAE---------    219

Query        516 AAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------    568
d1ni5a1      220 -----------------------------------------------------QESLLDE    226

Query        569 -    569
d1ni5a1      227 L    227


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:157.99)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ni5a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ni5a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1ni5a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1ni5a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1ni5a1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--A-QNVYGV    357
d1ni5a1        1 ----------SMTLTLNRQLL-T-SRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAI     48

Query        358 SMPSKYS--SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE-NLQSRLR    414
d1ni5a1       49 HVHHGLSANADAWVTHCENVCQQWQVPLVVERVQ--L---A----QEG-LGIEAQARQAR     98

Query        415 GTTLMAISNQEGHIVLAPGNKSELAVG-YS-----------------TLYGDS-V---GA    452
d1ni5a1       99 YQAFARTL-LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEV-----SEFAGTRL    152

Query        453 YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK-------------PD-YPVLD    498
d1ni5a1      153 IRPLLARTRGELVQWARQYD-----------L-RWIEDESNQDDSYDRNFLRLRVVPLLQ    200

Query        499 AILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRL    558
d1ni5a1      201 QRWPHFAE-A----------------------T------------------ARSAALCAE    219

Query        559 P-------ITNRWREGH    568
d1ni5a1      220 QESLLDEL---------    227


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ************************* .   ************.  ***************
Query        326 RSVLIGLSGGIDSALVAAIACDALGAQ---NVYGVSMPSKYSS--DHSKGDAAELARRTG    380
d1ni5a1       14 RQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQ     73

DALI match       *********              .....***************........         
Query        381 LNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLA---------    431
d1ni5a1       74 VPLVVERVQ---------LAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCET    124

DALI match                                 ... ******************
Query        432 ------PGNKSELAVGYSTLYGDSVGAYG-PIKDVYKTSIFRLAEWRN    472
d1ni5a1      125 FLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYD    172



top
8: d1q15a1 beta-​Lactam synthetase (hh: 0.990)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 1597
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.47 AHM:0.56 LBcontacta:0.99 LBcontactb:0.99 LHM:0.33
id:1.00 blosum:0.51 compass:0.59 pearson:1.00
Scaled scores:
dali:0.78 daliz:0.55 gdtts:0.54 tmscore:0.68 rmsd:0.77 AHM:0.66 LBcontacta:0.43 LBcontactb:0.64 LHM:0.31
id:0.08 blosum:0.12 compass:0.18 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 13.1 Raw score:1153.70)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1q15a1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1q15a1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnYGVFdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1q15a1        1 -----------PASN---------------------------------------------      4

Query        181 glllsvnaspyerDKDDtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1q15a1        5 -----------qlLALP-------------------------------------------     10

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1q15a1       11 ------------------------------------------------------------     11

Query        301 rLDADEEVYSALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMP    360
d1q15a1       11 rEPLLALIDRYLNAPLEDLAP--RFDTVGIPLSGGLDSSLVTALASRHFK--KLNTYSIG     66

Query        361 SKYSSdhSKGDAAELARRTGLNFRTVSIEP-MFDA--ymaslgltgLAEENLQSRLRGTT    417
d1q15a1       67 TELSN--EFEFSQQVADALGTHHQMKILSEtEVINgiiesiyyneiFDGLSAEIQSGLFN    124

Query        418 LMAISNQEGHIVLAPG-NKSE--------------------lAVGY--------stlygd    448
d1q15a1      125 VYRQAQGQVSCMLTGYgSDLLfggilkpgaqydnpnqllaeqVYRTrwtgefathgascy    184

Query        449 svgAYGPIKD-------------------vyKTSIFRLAEWRNraaaergqtpPIPEASI    489
d1q15a1      185 gidIRHPFWShslislchalhpdykifdnevKNILREYADSLQ----------LLPKDIV    234

Query        490 Tkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisa    549
d1q15a1      235 W--------------------------rsvnqafanvlgstvdnyqtksrftyrvyqafl    268

Query        550 kgfgkdrrlpitnrwregh    568
d1q15a1      269 rgrlsitdvtpsqlkdlik    287


hit structure      alignment
FAST alignment (Normalized score: 5.06 Raw score:2043.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1q15a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1q15a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1q15a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1q15a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1q15a1        1 ------------------------------------------------------------      1

Query        301 RL------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDA    348
d1q15a1        1 --PASNQLLALPREPLLALIDRYLNAPLEDLA--PRFDTVGIPLSGGLDSSLVTALASRH     56

Query        349 LGAQNVYGVSMPSKYSSDH---SKGDAAELARRTGLNFRTVS-IEPMFDAYMASLGLTGL    404
d1q15a1       57 F--KKLNTYSIGTE-----LSNEFEFSQQVADALGTHHQMKILSETEVINGI--------    101

Query        405 ----------AEENLQSRLRGTTLMAISNQEG--HIVLAPGN------KSELAVGYSTLY    446
d1q15a1      102 IESIYYNEIFDGLSAEIQSGLFNVYRQAQG--QVSCMLTG--YGSDLLFGGI--------    149

Query        447 GDSVG--------------------------------------AYGPIKDVY--------    460
d1q15a1      150 -----LKPGAQYDNPNQLLAEQVYRTRWTGEFATHGASCYGIDIRHPF----WSHSLISL    200

Query        461 ---------------KTSIFRLAEWRNRAAAERGQT-PPIPEASITKPDYPVLDAILELY    504
d1q15a1      201 CHALHPDYKIFDNEVKNILREYADS-----------LQLLPKDI----------------    233

Query        505 VDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRW    564
d1q15a1      234 ------------------------------------------------------------    234

Query        565 REGH------------------------------------------------------    568
d1q15a1      234 ----VWRSVNQAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLSITDVTPSQLKDLIK    287


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:146.63)
Query          1 --------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPV     52
d1q15a1        1 PASNQLLA----------------------------------------------------      8

Query         53 EDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAA    112
d1q15a1        9 ------------------------------------------------------------      9

Query        113 AVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRV    172
d1q15a1        9 ------------------------------------------------------------      9

Query        173 PAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDS    232
d1q15a1        9 ---------------------LPR------------------------------------     11

Query        233 IVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEA    292
d1q15a1       12 ------------------------------------------------------------     12

Query        293 ELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ    352
d1q15a1       12 ---------EPLLALIDRYLNAPLEDLAP--RFDTVGIPLSGGLDSSLVTALASRHFK--     58

Query        353 NVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYM-AS---------LGLT    402
d1q15a1       59 KLNTYSIGTELSN--EFEFSQQVADALGTHHQMKILSETEVINGI-IESIYYNEIF----    111

Query        403 GLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSEL------------------AVGY-S    443
d1q15a1      112 -DG-LSAEIQSGLFNVYRQAQGQVSCMLTGYGSDLLFGGILKPGAQYDNPNQLLAEQVYR    169

Query        444 T---LYGDS-V--G------AYGPIK---DV--Y--------------KTSIFRLAEWRN    472
d1q15a1      170 TRWT--GEFATHGASCYGIDIRHPFWSHSLISLCHALHPDYKIFDNEVKNILREYADSLQ    227

Query        473 RAAAERGQTPPIPEASITK-----------------------------------------    491
d1q15a1      228 ----------LLPKDIVWRSVNQAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLSITDV    277

Query        492 ----------PDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQY    541
d1q15a1      278 TPSQLKDLIK--------------------------------------------------    287

Query        542 PPGTKISAKGFGKDRRLPITNRWREGH    568
d1q15a1      288 ---------------------------    288


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match              ....................  .........  ******************. 
Query        295 AGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGL--SGGIDSALVAAIACDALGAQ    352
d1q15a1        1 PASNQLLALPREPLLALIDRYLNAPLEDLAPRFDTVGIPLSGGLDSSLVTALASRHFKKL     60

DALI match       ..........    .****************  ...........         . *****
Query        353 NVYGVSMPSKYSSDHSKGDAAELARRTGLNF--RTVSIEPMFDAYMASLGLTGL-AEENL    409
d1q15a1       61 NTYSIGTELS----NEFEFSQQVADALGTHHQMKILSETEVINGIIESIYYNEIFDGLSA    116

DALI match       ************************....      
Query        410 QSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYS    443
d1q15a1      117 EIQSGLFNVYRQAQGQVSCMLTGYGSDLLFGGIL    150



top
9: d1jgta1 beta-​Lactam synthetase (hh: 0.991)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 1652
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.43 AHM:0.50 LBcontacta:0.99 LBcontactb:0.99 LHM:0.23
id:1.00 blosum:0.95 compass:0.66 pearson:1.00
Scaled scores:
dali:0.76 daliz:0.50 gdtts:0.55 tmscore:0.68 rmsd:0.77 AHM:0.68 LBcontacta:0.42 LBcontactb:0.59 LHM:0.38
id:0.16 blosum:0.18 compass:0.19 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 10.8 Raw score:1056.50)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1jgta1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1jgta1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1jgta1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerDKDDtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1jgta1        1 ---------pglsRRIL-------------------------------------------      8

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1jgta1        9 -----------------------------------------------------------p      9

Query        301 rLDADEEVYSALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMP    360
d1jgta1       10 eGEAVAAVRAALEKAVAQRVT--PGDTPLVVLSGGIDSSGVAACAHRAAG--ELDTVSMG     65

Query        361 SKYSSdhSKGDAAELARRTGLNFRTVSIE-PMFDAYMA------slglTGLAEENLQSRL    413
d1jgta1       66 TDTSN--EFREARAVVDHLRTRHREITIPtTELLAQLPyavwasesvdPDIIEYLLPLTA    123

Query        414 RGTTLmaISNQegHIVLAPG-NKSE-----------------------lavGYST----l    445
d1jgta1      124 LYRAL--DGPE--RRILTGYgADIPlggmhredrlpaldtvlahdmatfdgLNEMspvls    179

Query        446 ygdsVGAYGPIKD-------------------vyKTSIFRLAEWRnraaaergqtppIPE    486
d1jgta1      180 tlagHWTTHPYWDrevldllvsleaglkrrhgrdKWVLRAAMADA------------LPA    227

Query        487 ASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtk    546
d1jgta1      228 ETVNR-------------------pklssfsrllldhgvaedrvheakrqvvrelfdltv    268

Query        547 isakgfgkdrrlpitnrwregh    568
d1jgta1      269 gggrhpsevdtddvvrsvadrt    290


hit structure      alignment
FAST alignment (Normalized score: 5.02 Raw score:2039.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1jgta1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1jgta1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1jgta1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1jgta1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1jgta1        1 ------------------------------------------------------------      1

Query        301 RL-----------DADEEVYSALVVGLRAYVAKNGF--RSVLIGLSGGIDSALVAAIACD    347
d1jgta1        1 --PGLSRRILPEGEAVAAVRAALEKAVAQRVT----PGDTPLVVLSGGIDSSGVAACAHR     54

Query        348 ALGAQ-NVYGVSMPSKYSSDH---SKGDAAELARRTGLNFRTVS-IEPMFDAYMASLGL-    401
d1jgta1       55 AA---GELDTVSMGTD-----TSNEFREARAVVDHLRTRHREITIPTTELLAQ------L    100

Query        402 -----------TGLAEENLQSRLRGTTLMAISN--QEGHIVLAPGNKSELAVGYSTLYGD    448
d1jgta1      101 PYAVWASESVDPDIIEYLLPLTALYRA------LDGPERRILTG----------------    138

Query        449 SVG-----------------------------------------------AYGPIKDVY-    460
d1jgta1      139 ---YGADIPLGGMHREDRLPALDTVLAHDMATFDGLNEMSPVLSTLAGHWTTHPY----W    191

Query        461 ----------------------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLD    498
d1jgta1      192 DREVLDLLVSLEAGLKRRHGRDKWVLRAAMA------------DALPAETVN--------    231

Query        499 AILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRL    558
d1jgta1      232 ------------------------------------------------------------    232

Query        559 PITNRWREGH--------------------------------------------------    568
d1jgta1      232 ----------RPKLSSFSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGGGRHPSEVDTDD    281

Query        569 ---------    569
d1jgta1      282 VVRSVADRT    290


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:147.96)
Query          1 -SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1jgta1        1 P-----------------------------------------------------------      1

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGR    119
d1jgta1        2 ------------------------------------------------------------      2

Query        120 VALTFAKHHLPNYG--VFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARS    177
d1jgta1        2 -------------GLS--------------------------------------------      4

Query        178 AGAGLLLSVNASPYERDKD-DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVD    236
d1jgta1        5 --------------RRILPE----------------------------------------     10

Query        237 RDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAG    296
d1jgta1       11 ------------------------------------------------------------     11

Query        297 GYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYG    356
d1jgta1       11 -----GEAVAAVRAALEKAVAQRVT--PGDTPLVVLSGGIDSSGVAACAHRAAG-E-LDT     61

Query        357 VSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASL--------GLTGLAEEN    408
d1jgta1       62 VSMGTDTSN--EFREARAVVDHLRTRHREITIPTTELLAQLPYAVWASESV----DPDII    115

Query        409 LQSRLRGTTLMAISNQEGHIVLAPGN--KSEL-------------A--VG-YS---TLYG    447
d1jgta1      116 EYLLPLTALYRALDGPERRILTGYGADIPLGGMHREDRLPALDTVLAHDMATFDGL---N    172

Query        448 DSVG---------AYGPIK----D--VY------KT----SIFRLAEWRNRAAAERGQTP    482
d1jgta1      173 EMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHGRDKWVLRAAMA-D-------A    224

Query        483 PIPEASITKPDY------------------------------------------------    494
d1jgta1      225 LPAETVNRP-KLSSFSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGGGRHPSEVDTDDVV    283

Query        495 -------PVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKI    547
d1jgta1      284 RSVADRT-----------------------------------------------------    290

Query        548 SAKGFGKDRRLPITNRWREGH    568
d1jgta1      291 ---------------------    291


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match             ....................    *************************  . *
Query        296 GGYADRLDADEEVYSALVVGLRAYVAK--NGFRSVLIGLSGGIDSALVAAIACDALGAQN    353
d1jgta1        1 PGLSRRILPEGEAVAAVRAALEKAVAQRVTPGDTPLVVLSGGIDSSGVAACAHRA--AGE     58

DALI match       ************.  ********************  .........        ......
Query        354 VYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSI--EPMFDAYMASLGLTGL-AEENLQ    410
d1jgta1       59 LDTVSMGTDTSNE--FREARAVVDHLRTRHREITIPTTELLAQLPYAVWASESVDPDIIE    116

DALI match       ........  ....  *******....     
Query        411 SRLRGTTLMAISNQEGHIVLAPGNKSELAVGY    442
d1jgta1      117 YLLPLTALYRALDGPERRILTGYGADIPLGGM    148



top
10: d1sura_ Phosphoadenylyl sulphate (PAPS) reductase (hh: 0.997)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.61  Contact: 1420
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.35 AHM:0.33 LBcontacta:0.99 LBcontactb:0.98 LHM:0.20
id:0.99 blosum:0.30 compass:0.24 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.47 gdtts:0.53 tmscore:0.70 rmsd:0.81 AHM:0.75 LBcontacta:0.40 LBcontactb:0.56 LHM:0.47
id:0.05 blosum:0.10 compass:0.26 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 11.1 Raw score:952.40)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1sura_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1sura_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1sura_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1sura_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1sura_        1 ----------------------------------------skldlnalnelpkvdrilal     20

Query        301 rldadeevysALVVGLRAYVAKNGFrSVLIGLSGGIDSALVAAIACDALGAqnVYGVSMP    360
d1sura_       21 aetnaeleklDAEGRVAWALDNLPG-EYVLSSSFGIQAAVSLHLVNQIRPD--IPVILTD     77

Query        361 SKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGL---TGLAEENLQSR-LRGT    416
d1sura_       78 TGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKlweQGVEGIEKYNDiNKVE    137

Query        417 TLMAISNQEGH-IVLAPGNKSElAVGY----stlygdsvgAYGPIKDVYKTSIFRLAEWR    471
d1sura_      138 PMNRALKELNAqTWFAGLRREQ-SGSRanlpvlaiqrgvfKVLPIIDWDNRTIYQYLQKH    196

Query        472 NraaaergqtppipEASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmv    531
d1sura_      197 G------------lKYHPLW----------------------------------------    204

Query        532 dtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1sura_      205 --------------------------degylsvgdth    215


hit structure      alignment
FAST alignment (Normalized score: 5.43 Raw score:1897.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1sura_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1sura_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1sura_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1sura_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1sura_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYS------------------------------ALVVGLRAYVAKNGFRSVLI    330
d1sura_        1 ----------SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNL-PGEYVL     49

Query        331 GLSGGIDSALVAAIACDALGAQ-NVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIE    389
d1sura_       50 SSSFGIQAAVSLHLVNQIR---PDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYR--    104

Query        390 P---MFDAYMASLGL-----TGLAEENLQSR-LRGTTLMAISNQEG-HIVLAPGNKSELA    439
d1sura_      105 -ATESAAWQEARY--GKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRR----    157

Query        440 VGYSTLYGDSVG-------------------AYGPIKDVYKTSIFRLAEWRNRAAAERGQ    480
d1sura_      158 ------------EQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQK----------    195

Query        481 TP---PIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYK    537
d1sura_      196 --HGLKYHP---------------------------------------------------    202

Query        538 RRQYPPGTKISAKGFGKDRRLPITNRWREGH-------------    568
d1sura_      203 -------------------------------LWDEGYLSVGDTH    215


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:151.47)
Query          1 SLQLRLALNQIDSTVGD---------------IAGNAEAILRWTRHSAEQGAHLVAFPEM     45
d1sura_        1 ---------------SKLDLNALNELPKVDRI----------------------------     17

Query         46 ALTGYPVED-LALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQP    104
d1sura_       18 -------LAL--------------------------------------------------     20

Query        105 AGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICED    164
d1sura_       21 -----------------------------AE-----------------------------     22

Query        165 LWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQD    224
d1sura_       23 ----------------------------------------------------------TN     24

Query        225 ELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISE    284
d1sura_       25 AELEK------------------L------------------------------------     30

Query        285 EPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAI    344
d1sura_       31 --------------------------DAEGRVAWALDNLPGEYVLS-SSFGIQAAVSLHL     63

Query        345 ACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMF-DAYMASLGL--    401
d1sura_       64 VNQIR-PD-IPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWE    121

Query        402 TGLAEENLQSR-LRGTTLMAISNQEGH-IVLAPGNKS--E-LAVG-----YSTLYGDSV-    450
d1sura_      122 QGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAI-------QRG    174

Query        451 GAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK---PDY------PVLDAIL    501
d1sura_      175 VFKVLPIIDW--D-NRTIYQYLQKH------G-LKYHPLWDEGY--LSVGDTH-------    215

Query        502 ELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPIT    561
d1sura_      216 ------------------------------------------------------------    216

Query        562 NRWREGH    568
d1sura_      216 -------    216


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match             ............... **********************  .  ***********
Query        305 DEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYS    364
d1sura_       24 NAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQI--RPDIPVILTDTGYL     81

DALI match       ************************************      ..................
Query        365 SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG-----LTGLAEENLQSRLRGTTLM    419
d1sura_       82 FPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNR    141

DALI match       ........**********.....         ...   ******************
Query        420 AISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYG---PIKDVYKTSIFRLAEWRN    472
d1sura_      142 ALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHG    197



hit structures. 
top
11: d1ct9a1 Asparagine synthetase B,​ C-​terminal domain (hh: 0.993)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 1622
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:1.00 tmscore:1.00 rmsd:0.37 AHM:0.39 LBcontacta:0.99 LBcontactb:0.98 LHM:0.16
id:1.00 blosum:0.81 compass:0.39 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.45 gdtts:0.57 tmscore:0.70 rmsd:0.80 AHM:0.71 LBcontacta:0.39 LBcontactb:0.53 LHM:0.46
id:0.09 blosum:0.14 compass:0.26 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 10.0 Raw score:992.90)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1ct9a1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1ct9a1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1ct9a1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1ct9a1        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1ct9a1        1 -------------------------------------------------rdwfdydavkd     11

Query        301 rlDADEEVYSALVVGLRAYVAkNGFRSvLIGLSGGIDSALVAAIACDALgaqnVYGVSMP    360
d1ct9a1       12 nvTDKNELRQALEDSVKSHLM-SDVPY-GVLLSGGLDSSIISAITKKYA----LHSFAVG     65

Query        361 SkySSDHSKGDAAELARRTGLNFRTVSIEP-MFDAYMA---slgltGLAEENLQSRLRGT    416
d1ct9a1       66 L--PGSPDLKAAQEVANHLGTVHHEIHFTVqEGLDAIRdviyhietYDVTTIRASTPMYL    123

Query        417 TLMAISNQEGHIVLAPG-NKSE----------------------lAVGY--stlyGDSV-    450
d1ct9a1      124 MSRKIKAMGIKMVLSGEgSDEVfggylyfhkapnakelheetvrkLLALhmydcaRANKa    183

Query        451 ------GAYGPIKD------------------vyKTSIFRLAEWrnraaaergqtpPIPE    486
d1ct9a1      184 msawgvEARVPFLDkkfldvamrinpqdkmckmeKHILRECFEA------------YLPA    231

Query        487 ASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtk    546
d1ct9a1      232 SVAWR--------qkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskea    283

Query        547 isakgfgkdrrlpitnrwregh    568
d1ct9a1      284 ylyreifeelfplpsaaecvpg    305


hit structure      alignment
FAST alignment (Normalized score: 4.66 Raw score:1939.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ct9a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ct9a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1ct9a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1ct9a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1ct9a1        1 ------------------------------------------------------------      1

Query        301 RL-------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD    347
d1ct9a1        1 --RDWFDYDAVKDNVTDKNELRQALEDSVKSH-LMSD-VPYGVLLSGGLDSSIISAITKK     56

Query        348 ALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVS-IEPMFDAYMASLG------    400
d1ct9a1       57 Y----ALHSFAVGLPG--SPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIR---DVIYHI    107

Query        401 ---LTGLAEENLQSRLRGTTLMAISNQEG---HIVLAPGNK-------------------    435
d1ct9a1      108 ETYDVTTIRASTPMYLMSRKIKA------MGIKMVLSG---EGSDEVFGGYLYFHKAPNA    158

Query        436 --------SELAVGYSTLYGDSVG--------------------AYGPIKDVY-------    460
d1ct9a1      159 KELHEETVRKLL------------ALHMYDCARANKAMSAWGVEARVPF----LDKKFLD    202

Query        461 ---------------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYV    505
d1ct9a1      203 VAMRINPQDKMCKMEKHILRECFEA------------YLPASVAW---------------    235

Query        506 DRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWR    565
d1ct9a1      236 ------------------------------------------------------------    236

Query        566 EGH---------------------------------------------------------    568
d1ct9a1      236 ---RQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEE    292

Query        569 -------------    569
d1ct9a1      293 LFPLPSAAECVPG    305


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:151.32)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ct9a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ct9a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYG------VFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPA    174
d1ct9a1        1 -----------RDWFDYDA-----------------------------------------      8

Query        175 ARSAGAGLLLSVNASPYE-RDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSI    233
d1ct9a1        9 -----------------VK-DNV-------------------------------------     13

Query        234 VVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAE    293
d1ct9a1       14 ------------------------------------------------------------     14

Query        294 LAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQN    353
d1ct9a1       14 ---------TDKNELRQALEDSVKSHLM-SDV-PYGVLLSGGLDSSIISAITKKYA----     58

Query        354 VYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASL-GL-----TGL-AE    406
d1ct9a1       59 LHSFAVGLP-GS-PDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDV-IYHIETYDVTTI    115

Query        407 E-NLQSRLRGTTLMAISNQEGHIVLAPGNK-S-----------------------ELAVG    441
d1ct9a1      116 RASTPMYLMSRKIKAM--GI-KMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLAL    172

Query        442 -YSTLYGDS--V-----GAYGPIK----D--VY---K--T----SIFRLAEWRNRAAAER    478
d1ct9a1      173 HMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQDKMCKMEKHILRECFE-AY---    228

Query        479 GQTPPIPEASITK-PD--------------------------------------------    493
d1ct9a1      229 ---LPASVAWRQKE-QFSDGVGYSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAY    284

Query        494 ---------------YPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKR    538
d1ct9a1      285 LYREIFEELFPLPSA---------------------------------------------    299

Query        539 RQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1ct9a1      300 ---------------------AECVPG---    305


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match              *******************..  .. ********************    .**
Query        296 GGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVY    355
d1ct9a1        7 DAVKDNVTDKNELRQALEDSVKSHLMSD--VPYGVLLSGGLDSSIISAITKKY----ALH     60

DALI match       ******. ...  *******************  ..........     . .........
Query        356 GVSMPSKYSSDHSKGDAAELARRTGLNFRTVS--IEPMFDAYMASLGLTG-LAEENLQSR    412
d1ct9a1       61 SFAVGLPGSPD--LKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRAS    118

DALI match       .............. *******....     
Query        413 LRGTTLMAISNQEG-HIVLAPGNKSELAVGY    442
d1ct9a1      119 TPMYLMSRKIKAMGIKMVLSGEGSDEVFGGY    149



top
12: d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain (hh: 0.999)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.70  Contact: 1374
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:0.99 rmsd:0.29 AHM:0.29 LBcontacta:0.99 LBcontactb:0.97 LHM:0.19
id:1.00 blosum:0.88 compass:0.36 pearson:0.99
Scaled scores:
dali:0.78 daliz:0.56 gdtts:0.65 tmscore:0.77 rmsd:0.84 AHM:0.76 LBcontacta:0.48 LBcontactb:0.61 LHM:0.45
id:0.11 blosum:0.16 compass:0.25 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 12.4 Raw score:948.50)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1vl2a1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1vl2a1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1vl2a1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1vl2a1        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1vl2a1        1 ------------------------------------------------------------      1

Query        301 rldadeevysalvvglrayvakngFRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMP    360
d1vl2a1        1 ------------------------KEKVVLAYSGGLDTSVILKWLCEKGF--DVIAYVAN     34

Query        361 SKySSDHsKGDAAELARRTGL-NFRTVSIEPMFDAY-MASLG-------ltGLAEENLQS    411
d1vl2a1       35 VG-QKDD-FVAIKEKALKTGAsKVYVEDLRREFVTDyIFTALlgnamyegrYLLGTAIAR     92

Query        412 RLRGTTLMAISNQEGH-IVLAPGNKselavGYST-lyGDSV--------gAYGPIK----    457
d1vl2a1       93 PLIAKRQVEIAEKEGAqYVAHGATG-----KGNDqvrFELTyaalnpnlkVISPWKdpef    147

Query        458 DVYK-TSIFRLAEWRnraaaergqtPPIPeasitkpdypvldailelyvdrdtgadaiva    516
d1vl2a1      148 LAKFkTDLINYAMEK----------GIPI-------------------------------    166

Query        517 agydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1vl2a1      167 ----------------------------------------------------    167


hit structure      alignment
FAST alignment (Normalized score: 5.35 Raw score:1644.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1vl2a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1vl2a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1vl2a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1vl2a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1vl2a1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGF-RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSM    359
d1vl2a1        1 -------------------------KEKVVLAYSGGLDTSVILKWLCE-KGF-DVIAYVA     33

Query        360 PS-KYS-SDHSKGDAAELARRTG---LNFRTVSIEPMFD-AYMA---SLGLTGL------    404
d1vl2a1       34 NVGQKDDFVAIKEKALK------TGASKVYVEDLRREFVTDYIFTALLGNA---MYEGRY     84

Query        405 -AEENLQSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY------GDSVG-----    451
d1vl2a1       85 LLGTAIARPLIAKRQVEIAEKEGAQYVAHGATGK----------GNDQVRFELT-YAALN    133

Query        452 ----AYGPIKDVY----------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVL    497
d1vl2a1      134 PNLKVISP-----WKDPEFLAKFKTDLINYAME---------------------------    161

Query        498 DAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRR    557
d1vl2a1      162 ------------------------------------------------------------    162

Query        558 LPITNRWREGH-----    568
d1vl2a1      162 -----------KGIPI    166


hit structure      alignment
TMalign alignment (TM-score: 0.23 Raw score:131.95)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1vl2a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1vl2a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1vl2a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1vl2a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1vl2a1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP    360
d1vl2a1        1 ------------------------KEKVVLAYSGGLDTSVILKWLCEKGF--DVIAYVAN     34

Query        361 SKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAY-MASLG---LT----GLAEENLQS    411
d1vl2a1       35 VG-QKDD-FVAIKEKALKTGASKVYVEDLRREFVTDYIFTALLGNAMYEGRYLLGTAIAR     92

Query        412 RLRGTTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDS-VG--------AYGPIK-D--    458
d1vl2a1       93 PLIAKRQVEIAEKEGAQYVAHGATG--K---GNDQVRFELTYAALNPNLKVISPWKDPEF    147

Query        459 VYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAG    518
d1vl2a1      148 LA-KFKTDLINYAME-K------G-IPI--------------------------------    166

Query        519 YDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1vl2a1      167 --------------------------------------------------    167


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ***********************  . ********  ..... ************* ***
Query        326 RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFR    384
d1vl2a1        2 EKVVLAYSGGLDTSVILKWLCEK--GFDVIAYVAN--VGQKDDFVAIKEKALKTGASKVY     57

DALI match       ***********.              *************************......   
Query        385 TVSIEPMFDAYM--------ASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPG---    433
d1vl2a1       58 VEDLRREFVTDYIFTALLGNAMYEGRYLLGTAIARPLIAKRQVEIAEKEGAQYVAHGATG    117

DALI match                            ****       ....********** 
Query        434 ---NKSELAVGYSTLYGDSVGAYGP-----IKDVYKTSIFRLAEWRN    472
d1vl2a1      118 KGNDQVRFELTYAALNPN-LKVISPWKDPEFLAKFKTDLINYAMEKG    163



top
13: d1k92a1 Argininosuccinate synthetase,​ N-​terminal domain (hh: 0.998)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.60  Contact: 1334
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:0.99 rmsd:0.33 AHM:0.35 LBcontacta:0.99 LBcontactb:0.98 LHM:0.18
id:0.99 blosum:0.65 compass:0.36 pearson:0.99
Scaled scores:
dali:0.75 daliz:0.50 gdtts:0.60 tmscore:0.74 rmsd:0.82 AHM:0.73 LBcontacta:0.45 LBcontactb:0.64 LHM:0.42
id:0.08 blosum:0.13 compass:0.22 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 11.0 Raw score:898.40)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1k92a1        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1k92a1        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1k92a1        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1k92a1        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1k92a1        1 ------------------------------------------------------------      1

Query        301 rldadeevysalvvGLRAyvakngfRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMP    360
d1k92a1        1 ---------ttilkHLPV------gQRIGIAFSGGLDTSAALLWMRQKGA--VPYAYTAN     43

Query        361 SKY-SSDHsKGDAAELARRTGL-NFRTVSIEPMFDAYMASLG-----------ltGLAEE    407
d1k92a1       44 LGQpDEED-YDAIPRRAMEYGAeNARLIDCRKQLVAEGIAAIqcgafhnttggltYFNTT    102

Query        408 NLQSRLRGTTLMAISNQEGH-IVLAPGnkselaVGYST-lyGDSV--------gAYGPIK    457
d1k92a1      103 PLGRAVTGTMLVAAMKEDGVnIWGDGS-----tYKGNDierFYRYglltnaelqIYKPWL    157

Query        458 -------dVYKTSIFRLAEWRNRaaaergqtppipeasITKPDypvldailelyvdrdtg    510
d1k92a1      158 dtdfidelGGRHEMSEFMIACGF-------------dyKMSVE-----------------    187

Query        511 adaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1k92a1      188 ---------------------------------------------------------k    188


hit structure      alignment
FAST alignment (Normalized score: 4.46 Raw score:1458.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1k92a1        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1k92a1        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1k92a1        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1k92a1        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1k92a1        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGF----------RSVLIGLSGGIDSALVAAIACDALG    350
d1k92a1        1 -------------------------TTILKHLPVGQRIGIAFSGGLDTSAALLWMRQ---     32

Query        351 AQ---NVYGVSMPSKYSSDH------SKGDAAELARRTGL-NFRTVSIEPMFDAYMASLG    400
d1k92a1       33 --KGAVPYAYTANL------GQPDEEDYDAIPRRAMEYGAENARLIDCRKQLVAEGIA--     82

Query        401 LTG----------------LAEENLQSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYS    443
d1k92a1       83 ---AIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYK-------    132

Query        444 TLY------GDSVG---------AYGPIKDVYKTS-----------IFRLAEWRNRAAAE    477
d1k92a1      133 ---GNDIERFYRY-GLLTNAELQIYKP--------WLDTDFIDELGGRHEMSEFMIA---    177

Query        478 RGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYK    537
d1k92a1      178 ------------------------------------------------------------    178

Query        538 RRQYPPGTKISAKGFGKDRRLPITNRWREGH-----------    568
d1k92a1      178 -------------------------------CGFDYKMSVEK    188


hit structure      alignment
TMalign alignment (TM-score: 0.25 Raw score:141.19)
Query          1 ---SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1k92a1        1 TTI---------------------------------------------------------      3

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHR    117
d1k92a1        4 ------------------------------------------------------------      4

Query        118 GRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARS    177
d1k92a1        4 ------------------------------------------------------------      4

Query        178 AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDR    237
d1k92a1        4 ----------------------------------------------LK------------      5

Query        238 DGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG    297
d1k92a1        6 ------------------------------------------------------------      6

Query        298 YADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGV    357
d1k92a1        6 -----------------HL--PVG----QRIGIAFSGGLDTSAALLWMRQKGA--VPYAY     40

Query        358 SMPSKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMASLG---LT--------GLA    405
d1k92a1       41 TANLGQPDEEDYDAIPRRAMEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFN    100

Query        406 EENLQSRLRGTTLMAISNQEGH-IVLAPGNKSELAVGYSTL-YGDS--V-------GAYG    454
d1k92a1      101 TTPLGRAVTGTMLVAAMKEDGVNIWGDGS---TY--KGNDIE-RFYRYGLLTNAELQIYK    154

Query        455 PIKD---VY-KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTG    510
d1k92a1      155 PWLDTDFIDE-LGGRHEMSEFMIACG-----F-DYK--MSV-EK----------------    188

Query        511 ADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1k92a1      189 ----------------------------------------------------------    189


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ***********************  . ***********.... ************* ***
Query        326 RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFR    384
d1k92a1       11 QRIGIAFSGGLDTSAALLWMRQK--GAVPYAYTANLGQPDEEDYDAIPRRAMEYGAENAR     68

DALI match       ****************                       ***************......
Query        385 TVSIEPMFDAYMASLGLTGLAEENLQSR-----------LRGTTLMAISNQEGHIVLAPG    433
d1k92a1       69 LIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDG    128

DALI match                               ******          ************
Query        434 ------NKSELAVGYSTLYGDSVGAYGPIKDVY-------KTSIFRLAEWRN    472
d1k92a1      129 STYKGNDIERFYRYGLLTNAE-LQIYKPWLDTDFIDELGGRHEMSEFMIACG    179



top
14: d1ii7a_ Mre11 (svm: 1.211)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.38  Contact: 1496
Modified z-scores:
dali:1.00 daliz:0.98 gdtts:0.99 tmscore:1.00 rmsd:0.44 AHM:0.43 LBcontacta:0.99 LBcontactb:0.98 LHM:0.15
id:0.98 blosum:0.10 compass:0.32 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.35 gdtts:0.45 tmscore:0.61 rmsd:0.75 AHM:0.66 LBcontacta:0.38 LBcontactb:0.52 LHM:0.46
id:0.04 blosum:0.08 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 7.2 Raw score:832.10)
Query          1 slqLRLALNQIDS-TVGD------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTgypve     53
d1ii7a_        1 ---MKFAHLADIHlGYEQfhkpqrEEEFAEAFKNALEIAVQENVDFILIAGDLFH-----     52

Query         54 dlalrssFVEASRTALRELAARLAeegFGELPVLV---gyLDRSesaqpkygqpaGAPRN    110
d1ii7a_       53 ----ssrPSPGTLKKAIALLQIPK---EHSIPVFAiegnhDRTQ-----------RGPSV     94

Query        111 AaavlhrgRVALTfakhhlpnygvfdefryfvpgDTMPIVRLHGVDIALAICE----dlw    166
d1ii7a_       95 L-nlledfGLVYVigmrkekveneyltserlgngEYLVKGVYKDLEIHGMKYMssawfea    153

Query        167 QDGGRVPAARsagaGLLLSV---naspyERDKDDTrleLVRKRAqEAGCT-TAYLAMIgg    222
d1ii7a_      154 NKEILKRLFRptdnAILMLHqgvrevseARGEDYF--eIGLGDL-PEGYLyYALGHIH--    208

Query        223 qdelvfDGDSivvdrDGEVVARA--------------------------pqFSEGCVVLD    256
d1ii7a_      209 ------KRYE---tsYSGSPVVYpgslerwdfgdyevryewdgikfkerygVNKGFYIVE    259

Query        257 LdlpaaeaepptgvvddglridrlviseeplpayeaeLAGGyadrldadeevysalvvgl    316
d1ii7a_      260 D------------------------------------FKPR-------------------    264

Query        317 rayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaela    376
d1ii7a_      265 ------------------------------------------------------------    265

Query        377 rrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnks    436
d1ii7a_      265 ------------------------------------------------------------    265

Query        437 elavgystlygdsvgaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypv    496
d1ii7a_      265 ------------------------------------------------------------    265

Query        497 ldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdr    556
d1ii7a_      265 ---fveikvrpfidvkikgseeeirkaikrliplipknayvrlnigwrkpfdlteikell    321

Query        557 rlpitnrwregh    568
d1ii7a_      322 nveylkidtwri    333


hit structure      alignment
FAST alignment (Normalized score: 2.90 Raw score:1260.00)
Query          1 SLQLRLALNQIDSTVG--------------DIAGNAEAILRWTRHSAEQGAHLVAFPEMA     46
d1ii7a_        1 ---MKFAHL-------ADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDL     50

Query         47 LTGYPVEDLALRSSF------VEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPK    100
d1ii7a_       51 ---------------FHSSRPSPGTLKKAIALLQIPKE---HSIPVFA------------     80

Query        101 YGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG----------------    144
d1ii7a_       81 --------------------------------------------IEGNHDRTQRGPSVLN     96

Query        145 -------------------------------DTMPIVRLHGVDIALAICEDLW-------    166
d1ii7a_       97 LLEDFGLVYVIGMRKEKVENEYLTSERLGNGEYLVKGVYKDLEIHGMK-----YMSSAWF    151

Query        167 --QDGGRVPAARSAGA------GLLLSVNASPYERDKDDT--------------RLELVR    204
d1ii7a_      152 EANKEILKRL------FRPTDNAILMLHQGV---------REVSEARGEDYFEIGLGD--    194

Query        205 KRAQEA----GCTTAYLAMIGGQDELVFD---GDSIVVDRDGEVVARAPQ----------    247
d1ii7a_      195 ------LPEGYLYYAL-------------GHIHKRYET------------SYSGSPVVYP    223

Query        248 ---------------------------FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRL    280
d1ii7a_      224 GSLERWDFGDYEVRYEWDGIKFKERYGVNKGFYIV-------------------------    258

Query        281 VISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSAL    340
d1ii7a_      259 ------------------------------------------------------------    259

Query        341 VAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG    400
d1ii7a_      259 ------------------------------------------------------------    259

Query        401 LTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVY    460
d1ii7a_      259 ------------------------------------------------------------    259

Query        461 KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYD    520
d1ii7a_      259 ------------------------------------------------------------    259

Query        521 RELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH------------    568
d1ii7a_      259 ------------------------------------------------EDFKPRFVEIKV    270

Query        569 ------------------------------------------------------------    569
d1ii7a_      271 RPFIDVKIKGSEEEIRKAIKRLIPLIPKNAYVRLNIGWRKPFDLTEIKELLNVEYLKIDT    330

Query        569 ---    569
d1ii7a_      331 WRI    333


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:198.57)
Query          1 SLQLRLALNQIDSTVGD-------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVE     53
d1ii7a_        1 ---MKFAHLADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDL-FH--S-     53

Query         54 DLALRSSFVEASRTALRELAARLAEEGFGELPVLVGY---LDRSESAQPKYGQPAGAPRN    110
d1ii7a_       54 --S-R--PSPGTLKKAIALLQIPK--EH-SIPVFAIEGNHDRT---------Q---RGPS     93

Query        111 AAAVLHRGRVALTFAKH----------------HLPNYGVFDEFRYFVPGDTMPIVRLHG    154
d1ii7a_       94 VLNLLEDFGLVYVIGMRKEKVENEYLTSERLGN----------------GEYLVKGVYKD    137

Query        155 VDIALAICEDL--W--QDGGRVPAARSAGAGLLLSVNASP--YERDKDDT-R-LELVRKR    206
d1ii7a_      138 LEIHGMKYMSSAWFEANKEILKRLFRP-TDNAILMLHQGVREVSEARGEDYFE-IGLGDL    195

Query        207 AQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ-------------------    247
d1ii7a_      196 PE--GYLYYALGHI-------HKRYETSY---SGSPVVYPGSLERWDFGDYEVRYEWDGI    243

Query        248 -------FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA-    299
d1ii7a_      244 KFKERYGVNKGFYIVEDF------------------------------------KPRFVE    267

Query        300 --DRLDADEEVYSALVV-GLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYG    356
d1ii7a_      268 IK--------------VR-PFI---------D-----------VKIK-------------    279

Query        357 VSMPSKYSSDHSKGDAAELARRTGLN--------------FRTVSIEPMFDAYMASLGLT    402
d1ii7a_      280 ----------GSEEEIRKAIKRLIPLIPKNAYVRLNIGWR--------------------    309

Query        403 GLAEENLQSRLRGTTLMAISNQ-E-GHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVY    460
d1ii7a_      310 -------KP--F--DLTEIKELLNVEYLKIDTW----------RI---------------    333

Query        461 KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYD    520
d1ii7a_      334 ------------------------------------------------------------    334

Query        521 RELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1ii7a_      334 ------------------------------------------------    334


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.06)
DALI match       ************************
Query         19 AGNAEAILRWTRHSAEQGAHLVAF     42
d1ii7a_       23 EEFAEAFKNALEIAVQENVDFILI     46



top
15: d1uf3a_ Hypothetical protein TT1561 (hh: 0.935)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.52  Contact: 1490
Modified z-scores:
dali:0.99 daliz:0.96 gdtts:0.99 tmscore:0.99 rmsd:0.38 AHM:0.39 LBcontacta:0.98 LBcontactb:0.97 LHM:0.25
id:0.97 blosum:0.17 compass:0.63 pearson:0.99
Scaled scores:
dali:0.66 daliz:0.32 gdtts:0.50 tmscore:0.65 rmsd:0.77 AHM:0.70 LBcontacta:0.36 LBcontactb:0.50 LHM:0.36
id:0.02 blosum:0.08 compass:0.05 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 6.8 Raw score:781.90)
Query          1 --sLQLRLALNQIDStvgdiagNAEAILRWTRHSAEQGAHLVAFPEMAltGYPVedlalr     58
d1uf3a_        1 mrrTVRYILATSNPM------gDLEALEKFVKLAPDTGADAIALIGNL--MPKA------     46

Query         59 ssFVEASRTALRELAARLaeegfgELPVLV---gyLDRSesaqpkygqpagaPRNA--aa    113
d1uf3a_       47 --AKSRDYAAFFRILSEA------HLPTAYvpgpqDAPI-------------WEYLreaa     85

Query        114 vlHRGRV-ALTFakhhlpnygvfdefryfvpgdtMPIVRLH-GVDIALAICED-------    164
d1uf3a_       86 nvELVHPeMRNV---------------------hETFTFWRgPYLVAGVGGEIadegepe    124

Query        165 -----lWQDGGRVPAARSAG----aGLLLSVNaspyerdkdDTRLELVRKRAQEAGCTTA    215
d1uf3a_      125 ehealrYPAWVAEYRLKALWelkdyPKIFLFHtmpyhkglnEQGSHEVAHLIKTHNPLLV    184

Query        216 YLAMiggqdelvFDGDsivvdrDGEVVARA--pqfSEGCVVLDLdlpaaeaepptgvvdd    273
d1uf3a_      185 LVAG--------KGQK---hemLGASWVVVpgdlsEGEYSLLDL----------------    217

Query        274 glridrlviseeplpayeAELAGgyadrldadeevysalvvglrayvakngfrsvligls    333
d1uf3a_      218 ------------------RARKL-------------------------------------    222

Query        334 ggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfd    393
d1uf3a_      223 ------------------------------------------------------------    223

Query        394 aymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgay    453
d1uf3a_      223 ------------------------------------------------------------    223

Query        454 gpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgada    513
d1uf3a_      223 ------------------------------------------------------------    223

Query        514 ivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1uf3a_      223 -------------------------------------------------etgnvr    228


hit structure      alignment
FAST alignment (Normalized score: 3.66 Raw score:1316.00)
Query          1 SLQ-----LRLALNQIDSTVGDIAG-----NAEAILRWTRHSAEQGAHLVAFPEMALTGY     50
d1uf3a_        1 ---MRRTVRYILAT-----------SNPMGDLEALEKFVKLAPDTGADAIALIGN-----     41

Query         51 PVEDLALRSSFVEA------SRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQP    104
d1uf3a_       42 --------------LMPKAAKSRDYAAFFRILSE---AHLPTAY----------------     68

Query        105 AGAPRNAAAVLHRGRV-------------------------ALTFAKHHLPNYGVFDEFR    139
d1uf3a_       69 ----------------VPGPQDAPIWEYLREAANVELVHPEMRNV---------------     97

Query        140 YFVPGDT-MPIVRL-HGVDIALAICEDLWQDG----------------------GRVPAA    175
d1uf3a_       98 -------HETFTFWRGPYLVAGVGG-------EIADEGEPEEHEALRYPAWVAEYRLKAL    143

Query        176 RS-AGAGLLLSVNASPYERDKDD-----------TRLELVRKRAQEAGCTTAYLAMIGGQ    223
d1uf3a_      144 WELKDY-PKIFLF----------HTMPYHKGLNEQGSHEVAHLIKTHNP-LLVLVA----    187

Query        224 DELVFD-GDSIVVDRDGEV------VARAPQF----SEGCVVLDLDLPAAEAEPPTGVVD    272
d1uf3a_      188 ------GKGQKHE------MLGASWVVVP---GDLSEGEYSLLD----------------    216

Query        273 DGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGL    332
d1uf3a_      217 ------------------------------------------------------------    217

Query        333 SGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMF    392
d1uf3a_      217 ------------------------------------------------------------    217

Query        393 DAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGA    452
d1uf3a_      217 ------------------------------------------------------------    217

Query        453 YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGAD    512
d1uf3a_      217 ------------------------------------------------------------    217

Query        513 AIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH----    568
d1uf3a_      217 --------------------------------------------------------LRAR    220

Query        569 --------    569
d1uf3a_      221 KLETGNVR    228


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:161.07)
Query          1 ---SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1uf3a_        1 MRR-TVRYILATSNPMG------DLEALEKFVKLAPDTGADAIALIGNL-MP--K--AA-     47

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVGY---LDRSESAQPKYGQPAGAPRNA-AA    113
d1uf3a_       48 ---KS-RDYAAFFRILS-E----AH-LPTAYVPGPQDAP-------------IWEYLREA     84

Query        114 V-LHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDL-------    165
d1uf3a_       85 ANVELVHPEMRNVH-------------------ETFTFWRGPYLVAGVGGEIADEGEPEE    125

Query        166 ------WQD--GGRVPAARSAG-AGLLLSVNAS-----PYERDKDDTRLELVRKRAQEAG    211
d1uf3a_      126 HEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKG-----LNEQGSHEVAHLIKTHN    180

Query        212 CTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ-FSEGCVVLDLDLPAAEAEPPTGV    270
d1uf3a_      181 PLLVLVAGK---------GQKHEML-GASWVVVPGDLSEGEYSLLDLR------------    218

Query        271 VDDGLRIDRLVISEEPLPAYEAELAGGY----ADRLDADEEVYSALVVGLRAYVAKNGFR    326
d1uf3a_      219 ---------------------A-RKLETGNVR----------------------------    228

Query        327 SVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTV    386
d1uf3a_      229 ------------------------------------------------------------    229

Query        387 SIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLY    446
d1uf3a_      229 ------------------------------------------------------------    229

Query        447 GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVD    506
d1uf3a_      229 ------------------------------------------------------------    229

Query        507 RDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE    566
d1uf3a_      229 ------------------------------------------------------------    229

Query        567 GH    568
d1uf3a_      229 --    229


hit structure      alignment
HHsearch alignment (Probability: 0.21 E-value:0.00)
DALI match             **********************
Query         15 VGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1uf3a_       11 TSNPMGDLEALEKFVKLAPDTGADAIAL     38



hit structures. 
top
16: d1hp1a2 5'​-​nucleotidase (syn. UDP-​sugar hydrolase),​ N-​terminal domain (svm: 1.234)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.48  Contact: 1730
Modified z-scores:
dali:1.00 daliz:0.97 gdtts:0.99 tmscore:1.00 rmsd:0.43 AHM:0.49 LBcontacta:0.99 LBcontactb:0.98 LHM:0.19
id:0.87 blosum:0.07 compass:0.19 pearson:0.99
Scaled scores:
dali:0.66 daliz:0.30 gdtts:0.44 tmscore:0.62 rmsd:0.75 AHM:0.64 LBcontacta:0.35 LBcontactb:0.50 LHM:0.40
id:-0.01 blosum:0.08 compass:0.23 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:833.40)
Query          1 ---SLQLRLALNQIDSTVGDIA-------GNAEAILRWTRHSAEQG---AHLVAFPEMal     47
d1hp1a2        1 yeqDKTYKITVLHTNDHHGHFWrneygeyGLAAQKTLVDGIRKEVAaegGSVLLLSGG--     58

Query         48 tgYPVEDL-alRSSFVEASRTALRELAarlaeegfgelpVLVGyldrsesaqpkygqPAG    106
d1hp1a2       59 --DINTGVpesDLQDAEPDFRGMNLVG------------YDAM-----aignhefdnPLT     99

Query        107 APrnaaavlhrgrVALTFAKHHLPNYgvfdefryfvPGDTMPIVRLHGVDIALAICE---    163
d1hp1a2      100 VL-----rqqekwAKFPLLSANIYQK-----stgerLFKPWALFKRQDLKIAVIGLTtdd    149

Query        164 ----------------dLWQD-GGRVPAAR-SAGAGLLLSVNASPYE---RDKD--dTRL    200
d1hp1a2      150 takignpeyftdiefrkPADEaKLVIQELQqTEKPDIIIAATHMGHYdngEHGSnapGDV    209

Query        201 ELVRKRAQeagCTTAYLAMiggqdelVFDGD----------------sivvdrdGEVV--    242
d1hp1a2      210 EMARALPA--gSLAMIVGG------hSQDPVcmaaenkkqvdyvpgtpckpdqqNGIWiv    261

Query        243 -arapqfSEGCVVLDLDLPaaeaepptgvvddglridrlviseeplpayeaeLAGGyadr    301
d1hp1a2      262 qahewgkYVGRADFEFRNG------------------------------emkMVNY----    287

Query        302 ldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmps    361
d1hp1a2      288 ------------------------------------------------------------    288

Query        362 kyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlmai    421
d1hp1a2      288 ------------------------------------------------------------    288

Query        422 snqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaergqt    481
d1hp1a2      288 ------------------------------------------------------------    288

Query        482 ppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqy    541
d1hp1a2      288 ----------------------------------------------qlipvnlkkkrvly    301

Query        542 ppgtkisakgfgkdrrlpitnrwregh    568
d1hp1a2      302 tpeiaenqqmisllspfqnkgkaqlev    328


hit structure      alignment
FAST alignment (Normalized score: 2.66 Raw score:1149.00)
Query          1 ---SLQLRLALNQIDSTVG----------------DIAGNAEAILRWTRHSAEQGAHLVA     41
d1hp1a2        1 YEQDKTYKITVLH------TNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEG-GSVL     53

Query         42 FPEMALTGYPVEDLAL-----------------RSSFVEASRTALRELAARLAEEGFGEL     84
d1hp1a2       54 L---------------LSGGDINTGVPESDLQDAEPDFRGMNL-----------------     81

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTF--------------------    124
d1hp1a2       82 ----------------------------------------VGYDAMAIGNHEFDNPLTVL    101

Query        125 -----------AKHHLPNYGVFDEFRYFVPGD----------TMPIVRLHGVDIALAICE    163
d1hp1a2      102 RQQEKWAKFPLLSANIY---------------QKSTGERLFKPWALFKRQDLKIAVIG--    144

Query        164 DLWQDG----------------------------GRVPAAR-SAGAGLLLSVNASPYERD    194
d1hp1a2      145 ------LTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHY--    196

Query        195 KDD----------TRLELVRKRAQEAGCT------TAYLAMIGGQDELVFDGDSIVVDRD    238
d1hp1a2      197 ---DNGEHGSNAPGDVEMARA--------LPAGSLAMIVG--------------------    225

Query        239 GEVVARAPQ------------------------------------------FSEGCVVLD    256
d1hp1a2      226 ---------GHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFE    276

Query        257 LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGL    316
d1hp1a2      277 F-----------------------------------------------------------    277

Query        317 RAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELA    376
d1hp1a2      278 ------------------------------------------------------------    278

Query        377 RRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKS    436
d1hp1a2      278 ------------------------------------------------------------    278

Query        437 ELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPV    496
d1hp1a2      278 ------------------------------------------------------------    278

Query        497 LDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDR    556
d1hp1a2      278 ------------------------------------------------------------    278

Query        557 RLPITNRWREGH------------------------------------------------    568
d1hp1a2      278 ------------RNGEMKMVNYQLIPVNLKKKRVLYTPEIAENQQMISLLSPFQNKGKAQ    325

Query        569 ---    569
d1hp1a2      326 LEV    328


hit structure      alignment
TMalign alignment (TM-score: 0.31 Raw score:173.99)
Query          1 --S-LQLRLALNQIDSTVGDIA-------GNAEAILRWTRHSAEQ--G-AHLVAFPEMAL     47
d1hp1a2        1 YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGD-     59

Query         48 TGYPVEDL-ALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLD-----RSESAQPKY    101
d1hp1a2       60 IN--TGVPE-SDLQDAEPDFRGMNLVG------------YDAMAIGNHEFD---------     95

Query        102 GQPAGAPRNAAA-VLHRGRVALTFAKHHLP------NYGVFDEFRYFVPGDTMPIVRLHG    154
d1hp1a2       96 -NPLTVLRQQEKW-A----K-FPLLSANIYQKSTGE-----------RLFKPWALFKRQD    137

Query        155 VDIALAICE-------------------DLWQD-GGRVPAARS-AGAGLLLSVNASPYER    193
d1hp1a2      138 LKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD    197

Query        194 DKDD-----TRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGD-----------------    231
d1hp1a2      198 NGEHGSNAPGDVEMARALPA--GSLAMIVGG---H--SQDPVCMAAENKKQVDYVPGTPC    250

Query        232 -SIVVDRDGEVVARAPQF---SE-GCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEP    286
d1hp1a2      251 KPDQQ---NGI-WIVQAHEWGKYVGRADFEFRNGE-------------------------    281

Query        287 LPAYEAELAGGYA----DRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVA    342
d1hp1a2      282 -----M-KMVNYQLIPV---------------------NL---K----------------    295

Query        343 AIACDALG------------------------------AQNVYGVSMPSKYSSDHSKGDA    372
d1hp1a2      296 -----KKRVLYTPEIAENQQMISLLSPFQNKGKAQLEV----------------------    328

Query        373 AELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAP    432
d1hp1a2      329 ------------------------------------------------------------    329

Query        433 GNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP    492
d1hp1a2      329 ------------------------------------------------------------    329

Query        493 DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGF    552
d1hp1a2      329 ------------------------------------------------------------    329

Query        553 GKDRRLPITNRWREGH    568
d1hp1a2      329 ----------------    329


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.07)
DALI match                             
Query         22 AEAILRWTRHSAE-QGAHLVAF     42
d1hp1a2      168 ADEAKLVIQELQQTEKPDIIIA    189



top
17: d4kbpa2 Plant purple acid phosphatase,​ catalytic domain (svm: 1.317)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.40  Contact: 1450
Modified z-scores:
dali:1.00 daliz:0.96 gdtts:0.98 tmscore:0.99 rmsd:0.45 AHM:0.45 LBcontacta:0.99 LBcontactb:0.98 LHM:0.22
id:0.97 blosum:0.09 compass:0.23 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.41 tmscore:0.57 rmsd:0.74 AHM:0.65 LBcontacta:0.39 LBcontactb:0.54 LHM:0.34
id:0.03 blosum:0.08 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 6.0 Raw score:795.50)
Query          1 ----SLQLRLALNQIdstvgdiagNAEAILRWTRHSAEQ--GAHLVAFPEMALTgypved     54
d4kbpa2        1 qtglDVPYTFGLIGD-------lgQSFDSNTTLSHYELSpkKGQTVLFVGDLSY-----a     48

Query         55 lalRSSFvEASRTALRELAARLaeegFGELPVLV---gyLDRSesaqpkygqPAGAPRna    111
d4kbpa2       49 dryPNHD-NVRWDTWGRFTERS----VAYQPWIWtagnhEIEF-----apeiNETEPF--     96

Query        112 aavlhrgrVALT-------FAKHhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICE-    163
d4kbpa2       97 --kpfsyrYHVPyeasqstSPFW--------------------YSIKRASAHIIVLSSYs    134

Query        164 ----dlwQDGGRvPAARSAG-----aGLLLSVNAS------PYERdkddtrLELVRKRAQ    208
d4kbpa2      135 aygrgtpQYTWL-KKELRKVkrsetpWLIVLMHSPlynsynHHFM-egeamRTKFEAWFV    192

Query        209 EAGCTTAYLAMIGgqdelvfdGDSI------------------vvdrDGEV---------    241
d4kbpa2      193 KYKVDVVFAGHVH--------AYERservsniaykitdglctpvkdqSAPVyitigdagn    244

Query        242 --------------varaPQFSEGCVVLDLDLPaaeaepptgvvddglridrlviseepl    287
d4kbpa2      245 ygvidsnmiqpqpeysafREASFGHGMFDIKNR---------------------------    277

Query        288 payeaeLAGGyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacd    347
d4kbpa2      278 ---thaHFSW--------------------------------------------------    284

Query        348 algaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaee    407
d4kbpa2      285 ------------------------------------------------------------    285

Query        408 nlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrl    467
d4kbpa2      285 ------------------------------------------------------------    285

Query        468 aewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvkt    527
d4kbpa2      285 ------------------------------------------------------------    285

Query        528 lrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d4kbpa2      285 -------------nrnqdgvaveadsvwffnrhwypvddst    312


hit structure      alignment
FAST alignment (Normalized score: 2.48 Raw score:1043.00)
Query          1 ----SLQLRLALNQIDSTVGDIAGN-----AEAILRWTRHSA--EQGAHLVAFPEMALTG     49
d4kbpa2        1 QTGLDVPYTFGLI------------GDLGQSFDSNTTLSHYELSPKKGQTVLFVGDL---     45

Query         50 YPVEDLA--------LRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKY    101
d4kbpa2       46 -------SYADRYPNHDNVRWDTWGRFTERSV--------AYQPWIW-------------     77

Query        102 GQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTM--------------    147
d4kbpa2       78 ----------------------------------------------TAGNHEIEFAPEIN     91

Query        148 --------------------------PIVRLHG---------------------------    154
d4kbpa2       92 ETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELR    151

Query        155 --------VDIALAI---------------CEDLWQDGGRVPAARSAGAGLLLSVNASPY    191
d4kbpa2      152 KVKRSETPWLIVLM-HSPLYNSYNHHFMEGEAMR---TKFEAWFVKYKVDVVFAG-----    202

Query        192 ERDKDDTRLELVRKRAQEA------------------------------GCTTAYLAMIG    221
d4kbpa2      203 -------------------HVHAYERSERVSNIAYKITDGLCTPVKDQSAPVYITI----    239

Query        222 GQDELVFDGDSIVVDRDG-------------------EVVARAPQFSEGCVVL-------    255
d4kbpa2      240 ------------------GDAGNYGVIDSNMIQPQPEYSAFR--EASFGHGMFDIKNRTH    279

Query        256 -----------------DLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGY    298
d4kbpa2      280 AHFSWNRNQDGVAVEADSVWFFNR------------------------------------    303

Query        299 ADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVS    358
d4kbpa2      304 ------------------------------------------------------------    304

Query        359 MPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTL    418
d4kbpa2      304 ------------------------------------------------------------    304

Query        419 MAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAER    478
d4kbpa2      304 ------------------------------------------------------------    304

Query        479 GQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKR    538
d4kbpa2      304 ------------------------------------------------------------    304

Query        539 RQYPPGTKISAKGFGKDRRLPITNRWREGH---------    568
d4kbpa2      304 ------------------------------HWYPVDDST    312


hit structure      alignment
TMalign alignment (TM-score: 0.29 Raw score:165.21)
Query          1 ---SL-QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d4kbpa2        1 QTGLDVPYTFGLIGD-LG---QSFDSNTTLSHYELS-PKKGQTVLFVGDLSYA--DRYP-     52

Query         57 LRSSFVEASRTALRELAARLAEEGFGELPVLV-GY-LDRS-----ESAQPKYGQPAGAPR    109
d4kbpa2       53 -N-HD-NVRWDTWGRFTERSVA---Y-QPWIWTAGNHEIEFAPEI---------NETEPF     96

Query        110 NAAA-VLHRGRVALTF-----AKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICE    163
d4kbpa2       97 KPFSY-----RYHVPYEASQS------------------TSPFWYSIKRASAHIIVLSSY    133

Query        164 DLWQDG---G-RVPAARSAGA-----GLLLSVNAS--P-YERDKD-DTR-LEL--VRKRA    207
d4kbpa2      134 SAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFME-GEA-MRTKFEAWF    191

Query        208 QEAGCTTAYLAMIGGQDELVFDGDSIVVD-----------------RDGEVVA-------    243
d4kbpa2      192 VKYKVDVVFAGHVH-------AYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGN    244

Query        244 ----------------RAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPL    287
d4kbpa2      245 YGVIDSNMIQPQPEYSAFREASFGHGMFDIKNR---------------------------    277

Query        288 PAYEAELAG-------------GYA-------------DRLDADEEVYSALVVGLRAYVA    321
d4kbpa2      278 ---THAHFSWNRNQDGVAVEADSVWFFNRHWYPVDDST----------------------    312

Query        322 KNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGL    381
d4kbpa2      313 ------------------------------------------------------------    313

Query        382 NFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVG    441
d4kbpa2      313 ------------------------------------------------------------    313

Query        442 YSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAIL    501
d4kbpa2      313 ------------------------------------------------------------    313

Query        502 ELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPIT    561
d4kbpa2      313 ------------------------------------------------------------    313

Query        562 NRWREGH    568
d4kbpa2      313 -------    313


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.95)
DALI match                                           
Query        182 LLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYL    217
d4kbpa2      128 IVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIV    163



top
18: d1utea_ Mammalian purple acid phosphatase (svm: 1.230)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.33  Contact: 1532
Modified z-scores:
dali:1.00 daliz:0.96 gdtts:0.98 tmscore:0.99 rmsd:0.50 AHM:0.47 LBcontacta:0.99 LBcontactb:0.99 LHM:0.18
id:0.99 blosum:0.05 compass:0.12 pearson:0.98
Scaled scores:
dali:0.65 daliz:0.29 gdtts:0.37 tmscore:0.54 rmsd:0.73 AHM:0.66 LBcontacta:0.37 LBcontactb:0.53 LHM:0.45
id:0.04 blosum:0.08 compass:0.15 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 6.2 Raw score:776.70)
Query          1 -SLQLRLALNQIDSTVG--DIAG-nAEAILRWTRHSAE-QGAHLVAFPEMAlTGYPVedl     55
d1utea_        1 pTPILRFVAVGDWGGVPnaPFHTarEMANAKAIATTVKtLGADFILSLGDN-FYFTG--v     57

Query         56 ALRSsfvEASRTA-LRELaaRLAEeGFGELPVLVgyldrsesaqpkygqpagaPRNAaav    114
d1utea_       58 HDAK---DKRFQEtFEDV--FSDP-SLRNVPWHV--------lagnhdhlgnvSAQI-ay    102

Query        115 lhrgRVALTFAKhhlpnygvfdefryfvpgdtMPIVRLH------GVDIALAICEDLW--    166
d1utea_      103 skisKRWNFPSP--------------------YYRLRFKiprsnvSVAIFMLDTVTLCgn    142

Query        167 -----------------QDGGrVPAARSAG------aGLLLSV-naspYERDkddTRLEL    202
d1utea_      143 sddfvsqqperprnlalARTQ-LAWIKKQLaaakedyVLVAGHypvwsIAEH---GPTHC    198

Query        203 VRK-RAQEAG---CTTAYLAMiggqdelvFDGDsivvdrdgEVVAR--------------    244
d1utea_      199 LVKqLLPLLTthkVTAYLCGH-------dHNLQ--ylqdenGLGFVlsgagnfmdpskkh    249

Query        245 ---------aPQFS-----EGCVVLDLDlpaaeaepptgvvddglridrlviseeplpay    290
d1utea_      250 lrkvpngylrFHFGaenslGGFAYVEIT-------------------------------p    278

Query        291 eaeLAGGyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalg    350
d1utea_      279 kemSVTY-----------------------------------------------------    285

Query        351 aqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlq    410
d1utea_      286 ------------------------------------------------------------    286

Query        411 srlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaew    470
d1utea_      286 ------------------------------------------------------------    286

Query        471 rnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrm    530
d1utea_      286 ------------------------------------------------------------    286

Query        531 vdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1utea_      286 ---------------------ieasgkslfktklprra    302


hit structure      alignment
FAST alignment (Normalized score: 2.48 Raw score:1029.00)
Query          1 S--LQLRLALNQIDSTVGD------------IAGNAEAILRWTRHSAEQGAHLVAFPEMA     46
d1utea_        1 -PTPILRFVAV--------GDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLG--     49

Query         47 LTGYPVEDL-------ALRSSF-VEASRTALRELAARLAE--EGFGELPVLVGYLDRSES     96
d1utea_       50 ---------DNFYFTGVHDA--KDKRFQETFEDVF-----SDPSLRNVPWHV--------     85

Query         97 AQPKYGQPAGAPRNAAAVLHRGRV-----------------------ALTFAKHHLPNYG    133
d1utea_       86 ------------------------LAGNHDHLGNVSAQIAYSKISKRWNFP---------    112

Query        134 VFDEFRYFVPG--DTMPIVRL--HGVDIALAICEDLWQDG--------------------    169
d1utea_      113 -----------SPYYRLRFKIPRSNVSVAIF---------MLDTVTLCGNSDDFVSQQPE    152

Query        170 ----------------GRVPAARSAGAGLLLSVNASPYERDKD-------------DTRL    200
d1utea_      153 RPRNLALARTQLAWIKKQLAA---AKEDYVLVAG---------HYPVWSIAEHGPTHCLV    200

Query        201 ELVRKRAQEAGCTTAYLAMIGGQDELVFD---GDSIVVDRDGEVVARAPQFS--------    249
d1utea_      201 KQLLPLLTTHKV-TAYLC-----------GHDHNLQYL--------------QDENGLGF    234

Query        250 ----------------------------------EGCVVLDLDLPAAEAEPPTGVVDDGL    275
d1utea_      235 VLSGAGNFMDPSKKHLRKVPNGYLRFHFGAENSLGGFAYVE-------------------    275

Query        276 RIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGG    335
d1utea_      276 ------------------------------------------------------------    276

Query        336 IDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAY    395
d1utea_      276 ------------------------------------------------------------    276

Query        396 MASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGP    455
d1utea_      276 ------------------------------------------------------------    276

Query        456 IKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIV    515
d1utea_      276 ------------------------------------------------------------    276

Query        516 AAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------    568
d1utea_      276 -----------------------------------------------------ITPKEMS    282

Query        569 --------------------    569
d1utea_      283 VTYIEASGKSLFKTKLPRRA    302


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:169.59)
Query          1 -SLQLRLALNQIDSTVGD-IAGN--AEAILRWTRHSA-EQGAHLVAFPEMALTGYPVEDL     55
d1utea_        1 PTPILRFVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDN-FY--F--T     55

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLVGY--LDR-SESAQPKYGQPAGAPRN-A    111
d1utea_       56 G-VHDAKDKRFQETFEDVFSD--PSLRNVPWHVLAGNHDHL-------------GNVSAQ     99

Query        112 AAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH-----GVDIALAICEDLW    166
d1utea_      100 IAYSKISKRWNFPS------------------P-YYRLRFKIPRSNVSVAIFMLDTVTLC    140

Query        167 -------------------QD--GGRVPAAR-SAGA-GLLLSVNAS----PYERDKDDTR    199
d1utea_      141 GNSDDFVSQQPERPRNLALARTQLAWIKKQLAAAKEDYVLVAGHYPVWSIAEHGP--THC    198

Query        200 LEL-VRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVA---------------    243
d1utea_      199 LVKQLLPLLTTHKVTAYLCGH--------DHNLQYLQDENGLGFVLSGAGNFMDPSKKHL    250

Query        244 --------RAPQFS----EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYE    291
d1utea_      251 RKVPNGYLRFHFGAENSLGGFAYVEITP-------------------------------K    279

Query        292 AELAGG-------YAD-------RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGID    337
d1utea_      280 EMSVTYIEASGKSLFKTKLPRRA-------------------------------------    302

Query        338 SALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMA    397
d1utea_      303 ------------------------------------------------------------    303

Query        398 SLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIK    457
d1utea_      303 ------------------------------------------------------------    303

Query        458 DVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAA    517
d1utea_      303 ------------------------------------------------------------    303

Query        518 GYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1utea_      303 ---------------------------------------------------    303


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.30)
DALI match                              
Query        308 VYSALVVGLRAYVAKNGFRSVLI    330
d1utea_      159 LARTQLAWIKKQLAAAKEDYVLV    181



top
19: d1ntfa_ Salivary nitrophorin (svm: 1.260)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.31  Contact: 1045
Modified z-scores:
dali:0.99 daliz:0.95 gdtts:0.98 tmscore:0.99 rmsd:0.43 AHM:0.42 LBcontacta:0.98 LBcontactb:0.98 LHM:0.22
id:0.92 blosum:0.04 compass:0.24 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.44 tmscore:0.57 rmsd:0.77 AHM:0.69 LBcontacta:0.37 LBcontactb:0.58 LHM:0.39
id:0.02 blosum:0.05 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.8 Raw score:635.80)
Query          1 -SLQLRLAL-nqidstVGDIAGnAEAILrWTRHsaeqgAHLVAFPEMaltgYPVEDLALR     58
d1ntfa_        1 pPAQLSVHTvswnsghERAPTN-LEELL-GLNS--getPDVIAVAVQ----GFGFQTDKP     52

Query         59 SsFVEASRTALRELAARLAeegfGELPvlvgyldrsesaqpkygqpagaprNAAAVLHR-    117
d1ntfa_       53 Q-QGPACVKNFQSLLTSKG----YTKL-----------------kntitetMGLTVYCLe     90

Query        118 ----grvaltfakHHLPNYgvFDEFryfvpgdtMPIVRLHGVDIALAICE----------    163
d1ntfa_       91 khldqntlknetiIVTVDD--QKKS-----ggiVTSFTIYNKRFSFTTSRmsdedvtstn    143

Query        164 -dlWQDGGRVpAARS-AGAGLLLSVNASPYERDK-------------------DDTRLEL    202
d1ntfa_      144 tkyAYDTRLD-YSKKdDPSDFLFWIGDLNVRVETnathakslvdqnnidglmaFDQLKKA    202

Query        203 V--rKRAQEagcttaylamiggqdelvfdgdsivvdrdgeVVARAPQFS-----------    249
d1ntfa_      203 KeqkLFDGW-------------------------------TEPQVTFKPtykfkpntdey    231

Query        250 ---------------------------------------egcVVLDLDLpaaeaepptgv    270
d1ntfa_      232 dlsatpswtdralyksgtgktiqplsynsltnykqtehrpvlAKFRVTL-----------    280

Query        271 vddglridrlviseeplpayeaelaggyadrldadeevysalvvglrayvakngfrsvli    330
d1ntfa_      281 ------------------------------------------------------------    281

Query        331 glsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiep    390
d1ntfa_      281 ------------------------------------------------------------    281

Query        391 mfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsv    450
d1ntfa_      281 ------------------------------------------------------------    281

Query        451 gaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtg    510
d1ntfa_      281 ------------------------------------------------------------    281

Query        511 adaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1ntfa_      281 ----------------------------------------------------------    281


hit structure      alignment
FAST alignment (Normalized score: 2.57 Raw score:1025.00)
Query          1 S--LQLRLALNQIDSTVGDIAGN--AEAILRWTRHSA-----EQGAHLVAFPEMALTGY-     50
d1ntfa_        1 -PPAQLSVHTVSWN-SGHE----RAPTNLEEL-----LGLNSGETPDVIAV--------A     41

Query         51 -PVEDLAL--RSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGA    107
d1ntfa_       42 VQGFGFQ-TDKPQQGPACVKNFQS---LLTSKG---------------------------     70

Query        108 P----------RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG-------------    144
d1ntfa_       71 -YTKLKNTITETMGLTVY-----------------------------CLEKHLDQNTLKN    100

Query        145 --------------DTMPIVRLHGVDIALAICEDLWQDGGRVPAARSA------------    178
d1ntfa_      101 ETIIVTVDDQKKSGGIVTSFTIYNKRFSFTT-----------------SRMSDEDVTSTN    143

Query        179 ----------------GAGLLLSVNASPYERDK----------------------DDTRL    200
d1ntfa_      144 TKYAYDTRLDYSKKDDPSDFLFWIGDLNVR---VETNATHAKSLVDQNNIDGLMAFDQLK    200

Query        201 ELVRKRAQEAGCTTAYLAMIGGQDELVF--------------------------------    228
d1ntfa_      201 K---------------------------AKEQKLFDGWTEPQVTFKPTYKFKPNTDEYDL    233

Query        229 ------DGDSIVVDRDGEVVARAPQ----------------------FSEGCVVLDLDLP    260
d1ntfa_      234 SATPSWTDRALYK------------SGTGKTIQPLSYNSLTNYKQTEHRPVLAKFRV---    278

Query        261 AAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYV    320
d1ntfa_      279 ------------------------------------------------------------    279

Query        321 AKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTG    380
d1ntfa_      279 ------------------------------------------------------------    279

Query        381 LNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAV    440
d1ntfa_      279 ------------------------------------------------------------    279

Query        441 GYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAI    500
d1ntfa_      279 ------------------------------------------------------------    279

Query        501 LELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPI    560
d1ntfa_      279 ------------------------------------------------------------    279

Query        561 TNRWREGH--    568
d1ntfa_      279 --------TL    280


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:170.29)
Query          1 -SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1ntfa_        1 PPAQLSVHTVS-WNSGHERAP--TNLEELLGLNSGETPDVIAVAVQ----G-F--GFQTD     50

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG-    118
d1ntfa_       51 KP--QQGPACVKNFQSLLT-SKGYTKLKN-T-IT--------------ETMGLTVYCLEK     91

Query        119 ------RVA-LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICED-------    164
d1ntfa_       92 HLDQNT--LKNETIIVTV--------DDQKKSGGIVTSFTIYNKRFSFTTSRMSDEDVTS    141

Query        165 -----LWQDGGRVPAARSAGAGLLLSVNASPYERD-------------------KDDTRL    200
d1ntfa_      142 TNTKYAYD-TRLDYSKKDDPSDFLFWIGDLNVRVETNATHAKSLVDQNNIDGLMAFDQLK    200

Query        201 ELV--RKRAQEAGCTTAY-LA---MIGGQD--------EL-VFD-GDSIVVDR-DGEVVA    243
d1ntfa_      201 KAKEQKLFDG----WTEPQ-VTFKPTYKFKPNTDEYDLSATPSWTDRALYKSGTGKTIQP    255

Query        244 -RAPQFS--------EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAEL    294
d1ntfa_      256 LSYNSLTNYKQTEHRPVLAKFRVTL-----------------------------------    280

Query        295 AGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNV    354
d1ntfa_      281 ------------------------------------------------------------    281

Query        355 YGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLR    414
d1ntfa_      281 ------------------------------------------------------------    281

Query        415 GTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRA    474
d1ntfa_      281 ------------------------------------------------------------    281

Query        475 AAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTA    534
d1ntfa_      281 ------------------------------------------------------------    281

Query        535 EYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1ntfa_      281 ----------------------------------    281


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.01)
DALI match       ******      ...... *****...   .   *****  ....
Query          3 QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA--FPEM     45
d1ntfa_        4 QLSVHTVSWNSGHERAPTNLEELLGLN---SGETPDVIAVAVQGF     45



top
20: d1ru8a_ Putative N-​type ATP pyrophosphatase PF0828 (hh: 0.986)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 1048
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.32 AHM:0.34 LBcontacta:0.96 LBcontactb:0.94 LHM:0.26
id:1.00 blosum:0.87 compass:0.27 pearson:0.96
Scaled scores:
dali:0.72 daliz:0.44 gdtts:0.57 tmscore:0.67 rmsd:0.82 AHM:0.71 LBcontacta:0.42 LBcontactb:0.59 LHM:0.34
id:0.13 blosum:0.17 compass:0.22 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 7.4 Raw score:643.70)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1ru8a_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1ru8a_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1ru8a_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1ru8a_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1ru8a_        1 ------------------------------------------------------------      1

Query        301 rldadeevysalvvglrayvaknGFRSVLIGLSGGIDSALVAAIACDALgaqNVYGVSMP    360
d1ru8a_        1 -----------------------GLADVAVLYSGGKDSNYALYWAIKNR-fsVKFLVTMV     36

Query        361 SKYS-----sDHSKGdAAELARRTGLNFRTVSIEpmfdaymaslgltglaEENLQSRLRG    415
d1ru8a_       37 SENEesymytINANL-TDLQARALGIPLVKGFTQ---------------gEKEKEVEDLK     80

Query        416 TTLMAIsnqEGHIVLAPGnkselavGYSTlyGDSVG------AYGPIKDVYKTSIFRLAE    469
d1ru8a_       81 RVLSGL---KIQGIVAGA------sKYQRkrIEKVAkelgleVYTPAWGRDAKEYMRELL    131

Query        470 WRN------------------------------------raaaergqtppipEASItkpd    493
d1ru8a_      132 NLGfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggefeTFVL----    187

Query        494 ypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfg    553
d1ru8a_      188 -----------------------------------dmplfkykivvdkakkvwepctssg    212

Query        554 kdrrlpitnrwregh    568
d1ru8a_      213 kliieeahleskleh    227


hit structure      alignment
FAST alignment (Normalized score: 3.54 Raw score:1270.00)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ru8a_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ru8a_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1ru8a_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1ru8a_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1ru8a_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQN-----VY    355
d1ru8a_        1 -----------------------GLADVAVLYSGGKDSNYALYWAIK------NRFSVKF     31

Query        356 GVSMPSKYS----SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLA---EEN    408
d1ru8a_       32 LVTMVSENEESYMYTINANLTDLQARALGIPLVKGF------------------TQGEKE     73

Query        409 LQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLY-----GDSVG-----------A    452
d1ru8a_       74 KEVEDLKRVLSG--LKI-QGIVA---------------GASKYQRKR-IEKVAKELGLEV    114

Query        453 YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP--------------------    492
d1ru8a_      115 YTPAWGRDAKEYMRELLN----------------------LGFKIMVVGVSAYGLDESWL    152

Query        493 ----------DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYP    542
d1ru8a_      153 GRILDESALEELITLNEK------------------------------------------    170

Query        543 PGTKISAKGFGKDRRLPITNRWREGH----------------------------------    568
d1ru8a_      171 --------------------------YKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKV    204

Query        569 -----------------------    569
d1ru8a_      205 WEPCTSSGKLIIEEAHLESKLEH    227


hit structure      alignment
TMalign alignment (TM-score: 0.21 Raw score:120.91)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1ru8a_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1ru8a_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1ru8a_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1ru8a_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1ru8a_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP    360
d1ru8a_        1 -----------------------GLADVAVLYSGGKDSNYALYWAIKNRF-SVKFLVTMV     36

Query        361 SKYS-S---DHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGT    416
d1ru8a_       37 SENEESYMYTINANLTDLQARALGIPLVKGFTQ--G-------------E-KEKEVEDLK     80

Query        417 TLMAISNQEGHIVLAPGNKSELAVGYSTL-YGDSV-G------AYGPIKDVYKTSIFRLA    468
d1ru8a_       81 RVLSGL--KIQGIVAGA---SK--Y--QRK-RIEKVAKELGLEVYTPAWGRDAKEYMREL    130

Query        469 EWRNRAAAERGQTPPIPEASITK---P-DY----------------PVLDAILELYVDRD    508
d1ru8a_      131 LNL-G----------F-K-IMVVGVSAYGLDESWLGRILDESALEELITLN---------    168

Query        509 TGADAIVAAGYDRELV--------------------------------------------    524
d1ru8a_      169 ---------EKY--KVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVWEPCTSSGKLIIE    217

Query        525 ----------VKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1ru8a_      218 EAHLESKLEH--------------------------------------------    227


hit structure      alignment
HHsearch alignment (Probability: 0.87 E-value:0.00)
DALI match       **************************  ............. ...   .. *********
Query        324 GFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHS---KGDAAELARRTG    380
d1ru8a_        1 GLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSENEESYMYTINANLTDLQARALG     60

DALI match       *********          
Query        381 LNFRTVSIEPMFDAYMASL    399
d1ru8a_       61 IPLVKGFTQGEKEKEVEDL     79



hit structures. 
top
21: d2dnja_ Deoxyribonuclease I (svm: 1.427)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.21  Contact: 850
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.39 AHM:0.39 LBcontacta:0.95 LBcontactb:0.96 LHM:0.30
id:0.99 blosum:0.69 compass:0.50 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.38 gdtts:0.49 tmscore:0.60 rmsd:0.78 AHM:0.73 LBcontacta:0.34 LBcontactb:0.57 LHM:0.32
id:0.08 blosum:0.13 compass:0.22 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:586.90)
Query          1 slqLRLALNQIDS-tvGDIAG--NAEAILRWTRHsaeqgAHLVAFPEMaltgypvedlal     57
d2dnja_        1 ---LKIAAFNIRTfgeTKMSNatLASYIVRIVRR-----YDIVLIQEV------------     40

Query         58 rssfveaSRTALRELAARLAEEGFGELPvlvgyldrsesaqpkygqpagaprnaaavlhr    117
d2dnja_       41 ----rdsHLVAVGKLLDYLNQDDPNTYH--------------------------------     64

Query        118 grvALTFAKHhlpnygVFDEfryfvpgdtmpivrLHGVDialaiceDLWQD--------g    169
d2dnja_       65 ---YVVSEPL-----gRNSY--kerylflfrpnkVSVLD-----tyQYDDDsfsrepavv    109

Query        170 grvpaarsagAGLLLSVNaSPYErdkdDTRLELVRKRAQEAG------CTTAYLA--mig    221
d2dnja_      110 kfsshstkvkEFAIVALH-SAPS--daVAEINSLYDVYLDVQqkwhlnDVMLMGDfnadc    166

Query        222 gqdelvfdgdsivvdrdgEVVAR---aPQFS-----------------------------    249
d2dnja_      167 syvtssqwssirlrtsstFQWLIpdsaDTTAtstncaydrivvagsllqssvvpgsaapf    226

Query        250 ------------------EGCVVLDLDlpaaeaepptgvvddglridrlviseeplpaye    291
d2dnja_      227 dfqaayglsnemalaisdHYPVEVTLT---------------------------------    253

Query        292 aelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalga    351
d2dnja_      254 ------------------------------------------------------------    254

Query        352 qnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqs    411
d2dnja_      254 ------------------------------------------------------------    254

Query        412 rlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewr    471
d2dnja_      254 ------------------------------------------------------------    254

Query        472 nraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmv    531
d2dnja_      254 ------------------------------------------------------------    254

Query        532 dtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d2dnja_      254 -------------------------------------    254


hit structure      alignment
FAST alignment (Normalized score: 2.81 Raw score:1064.00)
Query          1 SLQLRLALNQIDSTVGD---------IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYP     51
d2dnja_        1 ---LKIAAFNI------RTFGETKMSNATLASYIVRIVR-----RYDIVLIQ--------     38

Query         52 VEDLALRSSFVEAS------RTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQP    104
d2dnja_       39 --------------EVRDSHLVAVGKLLDYLN-QDDPNTYHYVV----------------     67

Query        105 AG-------APRNAAAVLHRGRVALTFAK------------HHLPNYGVFDEFRYFVPGD    145
d2dnja_       68 --SEPLGRNSYKERYLFL-----------FRPNKVSVLDTYQYDDDSF------------    102

Query        146 T-----MPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA-------GLLLSVNASPYER    193
d2dnja_      103 -SREPAVVKFS-----------------------------SHSTKVKEFAIVALHSA---    129

Query        194 DKD--------DTRLELVRKRAQEAG-CTTAYLAMIGGQDELVF----------------    228
d2dnja_      130 ---PSDAVAEINSLYDVYLDVQQKWHLNDVMLMG----------DFNADCSYVTSSQWSS    176

Query        229 ---------------------------DGDSIVVDRDGEVVARAPQFS------------    249
d2dnja_      177 IRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVA--------------GSLLQSSVVPGS    222

Query        250 ----------------------EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPL    287
d2dnja_      223 AAPFDFQAAYGLSNEMALAISDHYPVEVTL------------------------------    252

Query        288 PAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD    347
d2dnja_      253 ------------------------------------------------------------    253

Query        348 ALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE    407
d2dnja_      253 ------------------------------------------------------------    253

Query        408 NLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRL    467
d2dnja_      253 ------------------------------------------------------------    253

Query        468 AEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKT    527
d2dnja_      253 ------------------------------------------------------------    253

Query        528 LRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-    568
d2dnja_      253 -----------------------------------------T    253


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:157.74)
Query          1 SLQLRLALNQIDSTVGDIAGNAE--AILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d2dnja_        1 ---LKIAAFNI-RTF-GETKMSNATLASYIVRIVRR--YDIVLI-QE-VR----------     41

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRG    118
d2dnja_       42 --DSH--LVAVGKLLDYLNQDDPNTYHYVV-SEPLG--------R--NSYKERYLFLFRP     86

Query        119 ----RVA-LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH----GVDIALAICE------    163
d2dnja_       87 NKVS--VLDTYQYDDDSF-----S---R-EP-AVVKFSSHSTKVKEFAIVALHSAPSDAV    134

Query        164 -DLWQDGGRVPAARS-A-GAGLLLSVNASP-YERDKDDTRLEL-VRKRAQEAGCTTAY--    216
d2dnja_      135 AEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTF--QWLIPDS    192

Query        217 -LAMIGG-QDELVFDGDSIVVDRD---G--E-VV-ARAPQ------------F---SEGC    252
d2dnja_      193 A-DTTATS----TNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYP    247

Query        253 VVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSAL    312
d2dnja_      248 VEVTLT------------------------------------------------------    253

Query        313 VVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA    372
d2dnja_      254 ------------------------------------------------------------    254

Query        373 AELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAP    432
d2dnja_      254 ------------------------------------------------------------    254

Query        433 GNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP    492
d2dnja_      254 ------------------------------------------------------------    254

Query        493 DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGF    552
d2dnja_      254 ------------------------------------------------------------    254

Query        553 GKDRRLPITNRWREGH    568
d2dnja_      254 ----------------    254


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match       **********  ................     ********
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPE     44
d2dnja_        1 LKIAAFNIRTF-GETKMSNATLASYIVRIVRR-YDIVLIQE     39



top
22: d1s3la_ Putative phosphodiesterase MJ0936 (svm: 1.430)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.44  Contact: 1173
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.43 AHM:0.44 LBcontacta:0.99 LBcontactb:0.97 LHM:0.34
id:0.85 blosum:0.20 compass:0.65 pearson:0.99
Scaled scores:
dali:0.69 daliz:0.39 gdtts:0.49 tmscore:0.60 rmsd:0.75 AHM:0.64 LBcontacta:0.48 LBcontactb:0.60 LHM:0.24
id:0.02 blosum:0.08 compass:0.31 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 6.5 Raw score:666.30)
Query          1 slqLRLALNQIDStvgdiagNAEAILRWTRHSAEQGAHLVAFPEMALtgypvedlalrss     60
d1s3la_        1 ---MKIGIMSDTH------dHLPNIRKAIEIFNDENVETVIHCGDFV-------------     38

Query         61 fveaSRTALrELAARLaeegfgeLPVLV----gYLDRSesaqpkygqpagaprnaaavLH    116
d1s3la_       39 ----SLFVI-KEFENL------nANIIAtygnnDGERC---------------klkewLK     72

Query        117 RGR-vALTFAkhhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICEDLwqdgGRVPAA    175
d1s3la_       73 DINeeNIIDD---------------------fISVEIDDLKFFITHGHHQ----SVLEMA    107

Query        176 R-SAGAGLLLSVNASpyerdkddtrlelvrkRAQEaGCTTAYLAM--IGGQdelvfdgds    232
d1s3la_      108 IkSGLYDVVIYGHTH------------ervfEEVD-DVLVINPGEccGYLT---------    145

Query        233 ivvdrdgevvarapqFSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpayeA    292
d1s3la_      146 ---------------GIPTIGILDTE---------------------------------K    157

Query        293 ELAGgyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaq    352
d1s3la_      158 KEYR--------------------------------------------------------    161

Query        353 nvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsr    412
d1s3la_      162 ------------------------------------------------------------    162

Query        413 lrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrn    472
d1s3la_      162 ------------------------------------------------------------    162

Query        473 raaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvd    532
d1s3la_      162 ------------------------------------------------------------    162

Query        533 taeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1s3la_      162 --------------------------------eivl    165


hit structure      alignment
FAST alignment (Normalized score: 2.92 Raw score:894.50)
Query          1 SLQL-RLALNQIDSTVGDIAG-----NAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED     54
d1s3la_        1 ----MKIGIM-----------SDTHDHLPNIRKAIEIFNDENVETVI-------------     32

Query         55 LALRSSFVEASRT------------------------------ALRELAARLAEEGFGEL     84
d1s3la_       33 -------------HCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKD------     73

Query         85 PVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPG    144
d1s3la_       74 ------------------------------------------------------------     74

Query        145 D--------TMPIVRLHGVDIALAICEDLWQDGGRVPAARSA-GAGLLLSVNASPYERDK    195
d1s3la_       74 -INEENIIDDFISVEIDDLKFFITH---GHHQ-SVLEMAIKSGLYDVVIYGH--------    120

Query        196 DDTRLELVRKRAQE---------AGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAP    246
d1s3la_      121 --------------THERVFEEVDDVLVINP-----------------------------    137

Query        247 -------QFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA    299
d1s3la_      138 GECCGYLTGIPTIGILD-------------------------------------------    154

Query        300 DRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSM    359
d1s3la_      155 ------------------------------------------------------------    155

Query        360 PSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLM    419
d1s3la_      155 ------------------------------------------------------------    155

Query        420 AISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERG    479
d1s3la_      155 ------------------------------------------------------------    155

Query        480 QTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRR    539
d1s3la_      155 ------------------------------------------------------------    155

Query        540 QYPPGTKISAKGFGKDRRLPITNRWREGH-----------    568
d1s3la_      155 -----------------------------TEKKEYREIVL    165


hit structure      alignment
TMalign alignment (TM-score: 0.14 Raw score:78.14)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1s3la_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1s3la_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1s3la_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1s3la_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1s3la_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLS-GG-IDSALVAAIACDALGAQNVYGVS    358
d1s3la_        1 ------------------------MKIGIMSDTHDHLPNIRKAIEIFNDEN--VETVIHC     34

Query        359 MPSKYSSDHSKGDAAELARRTGLNFRTVSIE----------------------P------    390
d1s3la_       35 GD---FVS--LFV-IKEFENLNANIIATYGNNDGERCKLKEWLKDINEENIIDDFISVEI     88

Query        391 ---------MFDAY------------------MASLGLTGLAEENLQSRLRGTTLMA---    420
d1s3la_       89 DDLKFFITHGH-HQSVLEMAIKSGLYDVVIYG--------------HTHE-RV-FEEVDD    131

Query        421 ISNQEGHIVLAPGNKSELAVGYSTLYGDSV--------GAYGPIKDVYKTSIFRLAEWRN    472
d1s3la_      132 -VLV--INPGECC---G----YLTGIPTIGILDTEKKEYREIVL----------------    165

Query        473 RAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVD    532
d1s3la_      166 ------------------------------------------------------------    166

Query        533 TAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1s3la_      166 ------------------------------------    166


hit structure      alignment
HHsearch alignment (Probability: 0.34 E-value:0.00)
DALI match       ******           **********************
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1s3la_        1 MKIGIM------SDTHDHLPNIRKAIEIFNDENVETVIH     33



top
23: d1vyba_ Endonuclease domain of LINE-​1 reverse transcriptase homolog (svm: 1.447)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.22  Contact: 850
Modified z-scores:
dali:0.97 daliz:0.93 gdtts:0.96 tmscore:0.98 rmsd:0.43 AHM:0.43 LBcontacta:0.97 LBcontactb:0.97 LHM:0.33
id:0.92 blosum:0.50 compass:0.45 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.34 gdtts:0.42 tmscore:0.55 rmsd:0.75 AHM:0.67 LBcontacta:0.38 LBcontactb:0.57 LHM:0.23
id:0.03 blosum:0.11 compass:0.28 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:573.70)
Query          1 --SLQLRLALNQIDStvgDIAGNAEAILRWTRHSAeqgAHLVAFPeMALTgypvedlalr     58
d1vyba_        1 gsNSHITILTLNING--lNSAIKRHRLASWIKSQD---PSVCCIQ-ETHL----------     44

Query         59 ssfveaSRTALRELAarlaeEGFGElpvlvgyldrsesaqpkygqpagaprnaAAVL---    115
d1vyba_       45 ------TCRDTHRLK----iKGWRK----------------iyqangkqkkagVAILvsd     78

Query        116 -hrgrvalTFAKhhlpnygvfdefryfvpgdtmPIVRLHGVDIALAIC------------    162
d1vyba_       79 ktdfkptkIKRD--------------keghyimVKGSIQQEELTILNIyapntgaprfik    124

Query        163 EDLWQdggRVPAARsagagLLLSVNASPYE----------RDKD--DTRLELVRKRAqea    210
d1vyba_      125 QVLSD---LQRDLD----sHTLIMGDFNTPlstldrstrqKVNKdtQELNSALHQAD---    174

Query        211 gcttaylamiggqdelvfdgdsivvdrdGEVVAR------aPQFS---------------    249
d1vyba_      175 ----------------------------LIDIYRtlhpkstEYTFfsaphhtyskidhiv    206

Query        250 ---------------------EGCVVLDLDlpaaeaepptgvvddglridrlviseeplp    288
d1vyba_      207 gskallskckrteiitnylsdHSAIKLELR------------------------------    236

Query        289 ayeaelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacda    348
d1vyba_      237 ------------------------------------------------------------    237

Query        349 lgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeen    408
d1vyba_      237 ------------------------------------------------------------    237

Query        409 lqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrla    468
d1vyba_      237 ------------------------------------------------------------    237

Query        469 ewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktl    528
d1vyba_      237 ------------------------------------------------------------    237

Query        529 rmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1vyba_      237 ----------------------------------------    237


hit structure      alignment
FAST alignment (Normalized score: 2.25 Raw score:822.80)
Query          1 SLQ---LRLALNQIDSTVGD---IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVED     54
d1vyba_        1 ---GSNSHITILTLNIN---GLNSAIKRHRLASWIKS---QDPSVCCIQ-----------     40

Query         55 LALRSSFVEA----SRTALRELAARLAEEGFGE------LPVLVGYLDRSESAQPKYGQP    104
d1vyba_       41 ----------ETHLTCRDTHR------------LKIKGWRKIYQAN--------------     64

Query        105 AGA---PRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDT---------------    146
d1vyba_       65 ---GKQKKAGVAIL-------------------------------VSDKTDFKPTKIKRD     90

Query        147 ------MPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDD--T    198
d1vyba_       91 KEGHYIMVKGSIQQEE-------------------------LTILNIYAP-------NTG    118

Query        199 RLELVRKRAQEAG------CTTAYLAM---------------------------------    219
d1vyba_      119 APRFIKQVLSD--LQRDLDSHTLIM--GDFNTPLSTLDRSTRQKVNKDTQELNSALHQAD    174

Query        220 ---------------IGGQDELVF--------DGDSIVVDRDGEVVARAPQ---------    247
d1vyba_      175 LIDIYRTLHPKSTEYTFFS-----APHHTYSKIDHIV--------------GSKALLSKC    215

Query        248 ------------FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELA    295
d1vyba_      216 KRTEIITNYLSDHSAIKLEL----------------------------------------    235

Query        296 GGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVY    355
d1vyba_      236 ------------------------------------------------------------    236

Query        356 GVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRG    415
d1vyba_      236 ------------------------------------------------------------    236

Query        416 TTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAA    475
d1vyba_      236 ------------------------------------------------------------    236

Query        476 AERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAE    535
d1vyba_      236 ------------------------------------------------------------    236

Query        536 YKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-    568
d1vyba_      236 ---------------------------------R    236


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:151.09)
Query          1 ---SLQLRLALNQIDSTVGDIA-GNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLA     56
d1vyba_        1 GSN-SHITILTL-NING--LNSAIKRHRLASWIKSQD---PSVCCIQ-E-TH--------     43

Query         57 LRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH    116
d1vyba_       44 ----LTC--RD-THRLK--I--KGWR--KIYQ-ANGK-------------QKKAGVAILV     76

Query        117 RG-----RVA--LTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLH--GVDIALAI-C----    162
d1vyba_       77 SDKTDFK--PTKIKRDK---------------EGH-YIMVKGSIQQEELTILNIYAPNTG    118

Query        163 E--DLWQDGGRVPAARSAGAGLLLSVNASPY-----E-RDKDDT-RLELVRKRAQEAGCT    213
d1vyba_      119 APRFIKQVLSDLQRDL--DSHTLIMGDFNTPLSTLDRSTRQKVNKDTQELNSALHQADLI    176

Query        214 TAY---------LAMIGGQDELVFDGDSIVVDRDG-E--V-VARAPQ---FSEGCVVLDL    257
d1vyba_      177 DIYRTLHPKSTE-YTFFSAPHHTYSKIDHIVGSKALLSKCKRTEIITNYLSDHSAIKLEL    235

Query        258 DLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLR    317
d1vyba_      236 R-----------------------------------------------------------    236

Query        318 AYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELAR    377
d1vyba_      237 ------------------------------------------------------------    237

Query        378 RTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSE    437
d1vyba_      237 ------------------------------------------------------------    237

Query        438 LAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVL    497
d1vyba_      237 ------------------------------------------------------------    237

Query        498 DAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRR    557
d1vyba_      237 ------------------------------------------------------------    237

Query        558 LPITNRWREGH    568
d1vyba_      237 -----------    237


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.04)
DALI match       ************* .     .............   *******.
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPE     44
d1vyba_        3 NSHITILTLNINGLN-----SAIKRHRLASWIKSQDPSVCCIQE     41



top
24: d1su1a_ Phosphodiesterase yfcE (svm: 1.234)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.60  Contact: 1068
Modified z-scores:
dali:0.97 daliz:0.92 gdtts:0.94 tmscore:0.97 rmsd:0.52 AHM:0.51 LBcontacta:0.98 LBcontactb:0.97 LHM:0.27
id:0.98 blosum:0.42 compass:0.62 pearson:0.99
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.40 tmscore:0.52 rmsd:0.70 AHM:0.62 LBcontacta:0.43 LBcontactb:0.59 LHM:0.31
id:0.07 blosum:0.11 compass:0.25 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:536.00)
Query          1 slQLRLALNQidstvgdiagNAEAILRWTRHSAEQGAHLVAFPEMALTGyPVEDLalrss     60
d1su1a_        1 --MMKLMFAS------dihgSLPATERVLELFAQSGAQWLVILGDVLNH-GPRNA----l     47

Query         61 fveasrTALRELAARLaeegfGELPVL--vgYLDRsesaqpkygqpagaprnaaavlhrg    118
d1su1a_       48 pegyapAKVVERLNEV-----AHKVIAvrgnCDSE-------------------vdqmll     83

Query        119 RVALTFAkhhlpnygvfdefryfvpgdtmPIVRLHGVDIALAICE-DLWQdgGRVPAars    177
d1su1a_       84 HFPITAP---------------------wQQVLLEKQRLFLTHGHlFGPE--NLPAL---    117

Query        178 agaGLLLSVNASpyerdkddtrlelvrkrAQEAgCTTAYLAM---IGGQdelvfdgdsiv    234
d1su1a_      118 nqnDVLVYGHTH------------lpvaeQRGE-IFHFNPGSvsiPKGG-----------    153

Query        235 vdrdgevvarapqfSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpayeael    294
d1su1a_      154 -------------nPASYGMLDND----------------------------vlsvialn    172

Query        295 aGGYAdrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnv    354
d1su1a_      173 dQSII-------------------------------------------------------    177

Query        355 ygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlr    414
d1su1a_      178 ------------------------------------------------------------    178

Query        415 gttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnra    474
d1su1a_      178 ------------------------------------------------------------    178

Query        475 aaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdta    534
d1su1a_      178 ------------------------------------------------------------    178

Query        535 eykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1su1a_      178 ---------------------------aqvainp    184


hit structure      alignment
FAST alignment (Normalized score: 2.56 Raw score:827.10)
Query          1 SLQLRLALNQIDSTVGD-----IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL     55
d1su1a_        1 --MMKLMFA--------SDIHGSLPATERVLELFAQ---SGAQWLVILGDVLNH------     41

Query         56 ALRSS----------FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPA    105
d1su1a_       42 -----GPRNALPEGYAPAKVVERLN---------EVAH-KVIA-----------------     69

Query        106 GAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD--------------------    145
d1su1a_       70 ----------------------------------------VRGNCDSEVDQMLLHFPITA     89

Query        146 TMPIVRLHGVDIALAICEDLWQD----GGRVPAARSAGA-----GLLLSVNASPYERDKD    196
d1su1a_       90 PWQQVLLEKQRLFLTHGH-----LFGPENLP--------ALNQNDVLVY-----------    125

Query        197 DTRLELVRKRAQE-----------AGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARA    245
d1su1a_      126 -------------GHTHLPVAEQRGEIFHFNPG---------------------------    145

Query        246 PQ--------FSEGCVVL-----------------DLDLPAAEAEPPTGVVDDGLRIDRL    280
d1su1a_      146 --SVSIPKGGNPASYGMLDNDVLSVIALNDQSIIAQVAIN--------------------    183

Query        281 VISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSAL    340
d1su1a_      184 ------------------------------------------------------------    184

Query        341 VAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG    400
d1su1a_      184 ------------------------------------------------------------    184

Query        401 LTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVY    460
d1su1a_      184 ------------------------------------------------------------    184

Query        461 KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYD    520
d1su1a_      184 ------------------------------------------------------------    184

Query        521 RELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-    568
d1su1a_      184 ------------------------------------------------P    184


hit structure      alignment
TMalign alignment (TM-score: 0.23 Raw score:127.82)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDL-----     55
d1su1a_        1 --MMKLMFASD-IH---G--SLPATERVLELFAQSGAQWLVILGDVLNH-GPRNALPEGY     51

Query         56 ALRSSFVEASRTALRELAARLAEEGFGELPVLV-G-YLDRSESAQPKYGQPAGAPRNAAA    113
d1su1a_       52 --------AP-AKVVERLNEVA----H-KVIAVRGNCDSE-V---------------D-Q     80

Query        114 --VLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHG-VDIALAICE-DLWQDG    169
d1su1a_       81 ML----LHFPITAP----------------------WQQVLLEKQRLFLTHGHLFGPEN-    113

Query        170 GRVPAARS-AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVF    228
d1su1a_      114 L-PA--LNQ--NDVLVYGHTHLP-------VAE-QRG--EI---FHFNPGSVSI----PK    151

Query        229 DGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLP    288
d1su1a_      152 G-----------------GNPASYGMLDND------------------------------    164

Query        289 AYEAELAG-------GYAD------RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGG    335
d1su1a_      165 -----VLSVIALNDQSIIAQVAINP-----------------------------------    184

Query        336 IDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAY    395
d1su1a_      185 ------------------------------------------------------------    185

Query        396 MASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGP    455
d1su1a_      185 ------------------------------------------------------------    185

Query        456 IKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIV    515
d1su1a_      185 ------------------------------------------------------------    185

Query        516 AAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1su1a_      185 -----------------------------------------------------    185


hit structure      alignment
HHsearch alignment (Probability: 0.25 E-value:0.00)
DALI match       ******           **********************
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAF     42
d1su1a_        2 MKLMFA------SDIHGSLPATERVLELFAQSGAQWLVI     34



top
25: d1nnwa_ Hypothetical protein PF1291 (svm: 1.235)

SCOP Superfamily: Metallo-​dependent phosphatases  |  SCOP Fold: Metallo-​dependent phosphatases  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.35  Contact: 1073
Modified z-scores:
dali:0.97 daliz:0.90 gdtts:0.93 tmscore:0.97 rmsd:0.57 AHM:0.53 LBcontacta:0.97 LBcontactb:0.97 LHM:0.23
id:0.93 blosum:0.36 compass:0.41 pearson:0.98
Scaled scores:
dali:0.67 daliz:0.30 gdtts:0.38 tmscore:0.48 rmsd:0.67 AHM:0.61 LBcontacta:0.38 LBcontactb:0.60 LHM:0.38
id:0.03 blosum:0.10 compass:0.23 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:558.60)
Query          1 slqLRLALNQidstvgdiagNAEAILRWTRHSAEQ-----GAHLVAFPEMALTGypvedl     55
d1nnwa_        1 ---VYVAVLA------niagNLPALTAALSRIEEMreegyEIEKYYILGNIVGL------     45

Query         56 alrssfveasRTALRELAARLAeegfGELPVLV---gYLDR--SESAQPK----------    100
d1nnwa_       46 -------fpyPKEVIEVIKDLT----KKENVKIirgkYDQIiaMSDPHATdpgyidklel     94

Query        101 ---ygqpagaprnaaavlhrgrvaLTFAkhhlpnygvfdefryfvpgdtmPIVRLHGVDI    157
d1nnwa_       95 pghvkkalkftweklghegreylrDLPI---------------------yLVDKIGGNEV    133

Query        158 ALAICeDLWQ--------------dggRVPAARsaGAGLLLSVN-ASPYerdkddtrlel    202
d1nnwa_      134 FGVYG-SPINpfdgevlaeqptsyyeaIMRPVK--DYEMLIVASpMYPV-----------    179

Query        203 vrkRAQEaGCTTAYLAM--IGGQdelvfdgdsivvdrdgevvarapqFSEGCVVLDLDLp    260
d1nnwa_      180 --dAMTR-YGRVVCPGSvgFPPG----------------------keHKATFALVDVDT-    213

Query        261 aaeaepptgvvddglridrlviseeplpayeaelaggyadrldadeevysalvvglraYV    320
d1nnwa_      214 ---------------------------------lkpkfieveydkkiieeriraeglpEE    240

Query        321 AKNgfrsvliglsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelarrtg    380
d1nnwa_      241 IIK---------------------------------------------------------    243

Query        381 lnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkselav    440
d1nnwa_      244 ------------------------------------------------------------    244

Query        441 gystlygdsvgaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldai    500
d1nnwa_      244 ------------------------------------------------------------    244

Query        501 lelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpi    560
d1nnwa_      244 ------------------------------------------------------------    244

Query        561 tnrwregh    568
d1nnwa_      244 ilyhggrp    251


hit structure      alignment
FAST alignment (Normalized score: 2.31 Raw score:873.40)
Query          1 SLQL-RLALNQIDSTVGD-----IAGNAEAILRWTRHSAE--QGAHLVAFPEMALTGYPV     52
d1nnwa_        1 ----VYVAVL--------ANIAGNLPALTAALSRIEEMREEGYEIEKYYILG--------     40

Query         53 EDLALRSS-------FVEASRTALRELAARLAEEGFGELPVLVGYLDRSES---------     96
d1nnwa_       41 --------NIVGLFPYPKEVIEVIKDLTK--------KENVKI--------IRGKYDQII     76

Query         97 --------AQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGD---    145
d1nnwa_       77 AMSDPHATDPGY---------------------------------------------IDK     91

Query        146 ------------------------------TMPIVRLHGVDIALAICEDLWQDG------    169
d1nnwa_       92 LELPGHVKKALKFTWEKLGHEGREYLRDLPIYLVDKIGGNEVFGV---------YGSPIN    142

Query        170 ----------------GRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEA---    210
d1nnwa_      143 PFDGEVLAEQPTSYYEAIMRPV--KDYEMLIV-------------------------ASP    175

Query        211 ---------GCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQ----------FSEG    251
d1nnwa_      176 MYPVDAMTRYGRVVCP------------------------------GSVGFPPGKEHKAT    205

Query        252 CVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSA    311
d1nnwa_      206 FALVDV------------------------------------------------------    211

Query        312 LVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGD    371
d1nnwa_      212 ------------------------------------------------------------    212

Query        372 AAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLA    431
d1nnwa_      212 ------------------------------------------------------------    212

Query        432 PGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK    491
d1nnwa_      212 ------------------------------------------------------------    212

Query        492 PDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKG    551
d1nnwa_      212 ------------------------------------------------------------    212

Query        552 FGKDRRLPITNRWREGH----------------------------------------    568
d1nnwa_      212 -----------------DTLKPKFIEVEYDKKIIEERIRAEGLPEEIIKILYHGGRP    251


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:146.72)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSA--EQGAHLVAFPEMALTGYPVEDLALR     58
d1nnwa_        1 ---VYVAVLANIAGN-L--PALTAALSRIEEMREEGYEIEKYYILGNI-V-GLFP-YP--     49

Query         59 SSFVEASRTALRELAARLAEEGFGELPVLVGY---LD-RSESAQPKYGQPAGA-------    107
d1nnwa_       50 --K--EVIEVIKDLTK-K-----E--NVKIIRGKYDQIIA---M----SDPHATDPGYID     90

Query        108 -PRNAAAVLHRGRVALTFAKHHLPNYG-VFD-EFR--Y----------FV-PGDTMPIVR    151
d1nnwa_       91 K----------------------LELPGHVKKALKFTWEKLGHEGREYLRD-LPIYLVDK    127

Query        152 LHGVDIALAICE---D--LWQ-------D---GGRVPAARSAGAGLLLSVNASPYERDKD    196
d1nnwa_      128 IGGNEVFGVYGSPINPFDGEVLAEQPTSYYEA--IMRPVK--DYEMLIVASPM-------    176

Query        197 DTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLD    256
d1nnwa_      177 --YP-VDA--MT-RYGRVVCPGSVGF----PPGK----------------EHKATFALVD    210

Query        257 -LDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA--DRLDADEEVYSALV    313
d1nnwa_      211 VDTL----------------------------------KPKFIEVE--------------    222

Query        314 VGLRAYVAKNGF-RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA    372
d1nnwa_      223 Y--DK-KIIEERI-----------------------------------------------    232

Query        373 AELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHI--VL    430
d1nnwa_      233 -------------------------------------------------------RAE--    235

Query        431 APGNKSELAVGYSTLYGDSVGA-YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASI    489
d1nnwa_      236 ---------------------GL-------------------------------------    237

Query        490 TKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPP-GTK--    546
d1nnwa_      238 ---------------------------------------------------PEEIIKILY    246

Query        547 ISAK-GFGKDRRLPITNRWREGH    568
d1nnwa_      247 HGGRP------------------    251


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.01)
DALI match       ******           ***************     *******
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ-----GAHLVAF     42
d1nnwa_        1 VYVAVL------ANIAGNLPALTAALSRIEEMREEGYEIEKYYI     38



hit structures. 
top
26: d1hd7a_ DNA repair endonuclease Hap1 (svm: 1.447)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.36  Contact: 1213
Modified z-scores:
dali:0.98 daliz:0.93 gdtts:0.98 tmscore:0.99 rmsd:0.48 AHM:0.50 LBcontacta:0.99 LBcontactb:0.96 LHM:0.29
id:0.97 blosum:0.33 compass:0.37 pearson:0.99
Scaled scores:
dali:0.65 daliz:0.29 gdtts:0.44 tmscore:0.57 rmsd:0.73 AHM:0.63 LBcontacta:0.36 LBcontactb:0.47 LHM:0.27
id:0.04 blosum:0.11 compass:0.27 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:557.10)
Query          1 ---------------slQLRLALNQIdstvgdiAGNA-EAILRWTRHSAeqgAHLVAFPE     44
d1hd7a_        1 lyedppdqktspsgkpaTLKICSWNV----dglRAWIkKKGLDWVKEEA---PDILCLQE     53

Query         45 MaltgypvedlalrssfveasrtalrelaarlaeegFGELPvlvgYLDRsesaqpkygqp    104
d1hd7a_       54 T-------------------------------kcseGLSHQ--ywSAPY-----------     69

Query        105 agaprNAAAVLH--rgrvALTFakhhlpnygvfdefryfVPGD---tmPIVRLHGVDIAL    159
d1hd7a_       70 -----SGVGLLSrqcplkVSYG--------------igdEEHDqegrvIVAEFDSFVLVT    110

Query        160 AICE-----------dlwQDGGRVPAARSAG---aGLLLSV------nasPYER--DKDD    197
d1hd7a_      111 AYVPnagrglvrleyrqrWDEAFRKFLKGLAsrkpLVLCGDlnvaheeidLRNPkgNKKN    170

Query        198 TR-----LELVRKRAQEAGCT---------taylaMIGG-----QDELVFDGDSIVVDRD    238
d1hd7a_      171 AGftpqeRQGFGELLQAVPLAdsfrhlypntpyayTFWTymmnaRSKNVGWRLDYFLLSH    230

Query        239 --------gevvarapqfSEGCVVLDLDlpaaeaepptgvvddglridrlviseeplpay    290
d1hd7a_      231 sllpalcdskirskalgsDHCPITLYLA--------------------------------    258

Query        291 eaelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalg    350
d1hd7a_      259 ------------------------------------------------------------    259

Query        351 aqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlq    410
d1hd7a_      259 ------------------------------------------------------------    259

Query        411 srlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaew    470
d1hd7a_      259 ------------------------------------------------------------    259

Query        471 rnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrm    530
d1hd7a_      259 ------------------------------------------------------------    259

Query        531 vdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1hd7a_      259 -------------------------------------l    259


hit structure      alignment
FAST alignment (Normalized score: 2.54 Raw score:972.60)
Query          1 SL-----------------QLRLALNQIDSTVG-DIAGNAE-AILRWTRHSAEQGAHLVA     41
d1hd7a_        1 --LYEDPPDQKTSPSGKPATLKICSWNV-----DGLRAWIKKKGLDWVKE---EAPDILC     50

Query         42 FPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGE--------LPVLVGYLDR     93
d1hd7a_       51 LQ----------------------------------------ETKCSEGLSHQYWS----     66

Query         94 SESAQPKYGQPAGAP--RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDT-----    146
d1hd7a_       67 ---------------APYSGVGLL-------------------------------SRQCP     80

Query        147 -----------------MPIVRLHGVDIALAICEDLWQ-----------------DGGRV    172
d1hd7a_       81 LKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAY------VPNAGRGLVRLEYRQRWDEAFR    134

Query        173 PAARSAGA------GLLLSVNASPYERDKD-------------------------DTRLE    201
d1hd7a_      135 KFLKG---LASRKPLVLC------------GDLNVAHEEIDLRNPKGNKKNAGFTPQERQ    179

Query        202 LVRKRAQEAGCTTAYLA---------------MIGGQDELVFDG-----------DSIVV    235
d1hd7a_      180 GFGELLQAVPL------ADSFRHLYPNTPYAYTFWTYM------MNARSKNVGWRLDYFL    227

Query        236 DRDGEVVARAPQFS---------------------EGCVVLDLDLPAAEAEPPTGVVDDG    274
d1hd7a_      228 L-------------SHSLLPALCDSKIRSKALGSDHCPITLYLA----------------    258

Query        275 LRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSG    334
d1hd7a_      259 ------------------------------------------------------------    259

Query        335 GIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDA    394
d1hd7a_      259 ------------------------------------------------------------    259

Query        395 YMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYG    454
d1hd7a_      259 ------------------------------------------------------------    259

Query        455 PIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAI    514
d1hd7a_      259 ------------------------------------------------------------    259

Query        515 VAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-    568
d1hd7a_      259 ------------------------------------------------------L    259


hit structure      alignment
TMalign alignment (TM-score: 0.22 Raw score:125.13)
Query          1 -SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQG---------AHLVAFPEMALTGY     50
d1hd7a_        1 L---------------------------Y-EDPPDQKTSPSGKPATLKICSWN-VDGL--     29

Query         51 PVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRN    110
d1hd7a_       30 -----------R--AWIKK-KGLDWVKE--EAPDILCLQET-----------------KC     56

Query        111 AAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAI-CEDLWQD-    168
d1hd7a_       57 SE----G-LSHQYWSA--P-------Y---S-GV--GLLSRQCPLKVSYGIG-DEEHDQE     95

Query        169 GGRVPAARSAG-AGLLLSVNAS-PYERDKDDTRLELVRKRAQEA-GC-----T-TAYLAM    219
d1hd7a_       96 -GRV-IVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLN    153

Query        220 I------G-------GQDELVFDGD---S---IV-VDRDGEVVA--R---------APQF    248
d1hd7a_      154 VAHEEIDLRNPKGNK-----KNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFW    208

Query        249 -----------SEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPL-PAYEAEL--    294
d1hd7a_      209 TYMMNARSKNVGWRLDYFLLSHS--------------------------LL-PALCDSKI    241

Query        295 -------AGGYADRLDADEEVYSALVVGLRAYVAK----------NGFRSVLIGLSGGID    337
d1hd7a_      242 RSKALGS---------------------------DHCPITLYLAL---------------    259

Query        338 SALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMA    397
d1hd7a_      260 ------------------------------------------------------------    260

Query        398 SLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIK    457
d1hd7a_      260 ------------------------------------------------------------    260

Query        458 DVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAA    517
d1hd7a_      260 ------------------------------------------------------------    260

Query        518 GYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1hd7a_      260 ---------------------------------------------------    260


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.02)
DALI match         *********      .....*******   .   *********
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEM     45
d1hd7a_       16 PATLKICSWNVD---GLRAWIKKKGLDWV---KEEAPDILCLQET     54



top
27: d1mjha_ ​(​Hypothetical​(​ protein MJ0577 (hh: 0.952)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 1048
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.97 rmsd:0.34 AHM:0.33 LBcontacta:0.92 LBcontactb:0.91 LHM:0.23
id:0.86 blosum:0.45 compass:0.17 pearson:0.93
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.57 tmscore:0.67 rmsd:0.80 AHM:0.72 LBcontacta:0.40 LBcontactb:0.57 LHM:0.36
id:0.04 blosum:0.11 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 9.0 Raw score:589.40)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1mjha_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1mjha_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1mjha_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1mjha_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1mjha_        1 ------------------------------------------------------------      1

Query        301 rldadeevysalvvglrayvakNGFRSVLIGLSGGIDSALVAAIACDAL--gaQNVYGVS    358
d1mjha_        1 ----------------------VMYKKILYPTDFSETAEIALKHVKAFKtlkaEEVILLH     38

Query        359 MPS-------------KYSS-DHSKGDAAELARRTG-----LNFRTVSIepmfdaymasl    399
d1mjha_       39 VIDereikveefenelKNKLtEEAKNKMENIKKELEdvgfkVKDIIVVG-----------     87

Query        400 gltglaeenlqsrLRGTTLMAISNQEGH-IVLAPGN-ksELAVGYSTLyGDSVG------    451
d1mjha_       88 -------------IPHEEIVKIAEDEGVdIIIMGSHgktNLKEILLGS-VTENVikksnk    133

Query        452 -AYGPIkdVYKTsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtg    510
d1mjha_      134 pVLVVK--RKNS------------------------------------------------    143

Query        511 adaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1mjha_      144 ----------------------------------------------------------    144


hit structure      alignment
FAST alignment (Normalized score: 2.95 Raw score:841.50)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1mjha_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1mjha_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1mjha_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1mjha_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1mjha_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKN-GFRSVLIGLSGGIDSALVAAIACDALGAQ-------    352
d1mjha_        1 -----------------------VMYKKILYPTDFSETAEIALKHVKA-----FKTLKAE     32

Query        353 NVYGVSMPSKYS-------------SDHSKGDAAELARR---------TGLNFRTVSIEP    390
d1mjha_       33 EVILLHVID---EREIKVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIV----     85

Query        391 MFDAYMASLGLTGLAEENLQSR--LRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY-    446
d1mjha_       86 ----------------------VGIPHEEIVKIAEDEGVDIIIMG--------------S    109

Query        447 -------------GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPD    493
d1mjha_      110 HGKTNLKEILLGSVTEN-------------------------------------------    126

Query        494 YPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFG    553
d1mjha_      127 ------------------------------------------------------------    127

Query        554 KDRRLPITNRWREGH-----------------    568
d1mjha_      127 ---------------VIKKSNKPVLVVKRKNS    143


hit structure      alignment
TMalign alignment (TM-score: 0.18 Raw score:101.58)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1mjha_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1mjha_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1mjha_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1mjha_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1mjha_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--AQNVYGVS    358
d1mjha_        1 ----------------------VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLH     38

Query        359 MPSK--Y---------S--S-DHSKGDAAELARRTG---L-NFRTVSIEPMFDAYMASLG    400
d1mjha_       39 VIDEREIKVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVG-----------     87

Query        401 LTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGN---KSELAVGYSTLYGDS-VG-----    451
d1mjha_       88 ---------IPHEEIVKIAEDE--GVDIIIMGSHGKT-NLKEILLGS--VTENVIKKSNK    133

Query        452 AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGA    511
d1mjha_      134 PVLVVK--RKN--------------------------------S----------------    143

Query        512 DAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1mjha_      144 ---------------------------------------------------------    144


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.11)
DALI match                                                                   
Query        352 QNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQS    411
d1mjha_        4 KKILYPTDFSE-TAEIALKHVKAFKTLKAEEVILLHVIDEREIKVEEFENELKNKLTEEA     62

DALI match                      
Query        412 RLRGTTLMAISNQEG    426
d1mjha_       63 KNKMENIKKELEDVG     77



top
28: d1wdua_ Endonuclease domain of TRAS1 retrotransposon (ORF2) (svm: 1.447)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.28  Contact: 819
Modified z-scores:
dali:0.96 daliz:0.91 gdtts:0.96 tmscore:0.97 rmsd:0.42 AHM:0.39 LBcontacta:0.95 LBcontactb:0.94 LHM:0.30
id:0.97 blosum:0.50 compass:0.48 pearson:0.95
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.46 tmscore:0.56 rmsd:0.76 AHM:0.71 LBcontacta:0.38 LBcontactb:0.55 LHM:0.26
id:0.05 blosum:0.10 compass:0.13 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:507.40)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeQGAHLVAFPeMALTgypvedlalrss     60
d1wdua_        1 ----------------------------------PPYRVLQAN-LQRK------------     13

Query         61 fveasRTALRELAARLAEEGFgeLPVLV-GYLD------------RSESaqpkygqpaga    107
d1wdua_       14 -----KLATAELAIEAATRKA--AIALIqEPYVkgfrgvrvfqstAQGD-----------     55

Query        108 pRNAAAVLHRgrvaltfakhhlpnygvfdefryfvpgDTMP-----IVRLH----GVDIA    158
d1wdua_       56 gTVKAAIAVF------------------dhdldviqyPQLTtnnivVVGIRtrawEITLV     97

Query        159 LAICE-dlWQDG--GRVPAARSAG---aGLLLSVN---aspyerdKDDTRLELVRKRAQE    209
d1wdua_       98 SYYFEpdkPIESylEQIKRVERKMgpkrLIFGGDAnakstwwgskEDDARGDQLMGTLGE    157

Query        210 AGCT---taylaMIGGqdeLVFDGDSIvvdrdgevvarapqfsegcvvldLDLPaaeaep    266
d1wdua_      158 LGLHilnegdvpTFDT---RYQSRVDV-------------------tfctEDML--dlid    193

Query        267 ptgvvddglridrlviseepLPAYeaelaggyadrldadeevysalvvglrayvakngfr    326
d1wdua_      194 gwrvdedlvssdhngmvfniRLQK------------------------------------    217

Query        327 svliglsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtv    386
d1wdua_      218 ------------------------------------------------------------    218

Query        387 siepmfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkselavgystly    446
d1wdua_      218 ------------------------------------------------------------    218

Query        447 gdsvgaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvd    506
d1wdua_      218 ------------------------------------------------------------    218

Query        507 rdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwre    566
d1wdua_      218 ------------------------------------------------------------    218

Query        567 gh    568
d1wdua_      218 --    218


hit structure      alignment
FAST alignment (Normalized score: 2.44 Raw score:854.70)
Query          1 SLQLRLALNQIDSTVGD--IAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALR     58
d1wdua_        1 -PPYRVLQANL------QRKKLATAELAIEA---ATRKAAIAL-IQEP------------     37

Query         59 SSFVEASRTALRELAARLAEE---GFGELPVLVGYLDRSESAQPKYGQPAGAPRN-----    110
d1wdua_       38 ---------------------YVKGFRGVRVFQ----------------------STAQG     54

Query        111 ----AAAVLHRGRV-------ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRL-------    152
d1wdua_       55 DGTVKAAIA-----VFDHDLDVIQY----------------------------PQLTTNN     81

Query        153 --------HGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-----DTR    199
d1wdua_       82 IVVVGIRTRAWE-------------------------ITLVSYYFE------PDKPIESY    110

Query        200 LELVRKRAQE-AGCTTAYLAMIGGQDELVFDG----------------------------    230
d1wdua_      111 LEQIKRVERKMGPKRLIFG-------------GDANAKSTWWGSKEDDARGDQLMGTLGE    157

Query        231 ---------------------DSIVVDRDGEVVARAPQF--------------------S    249
d1wdua_      158 LGLHILNEGDVPTFDTRYQSRVDVTFC------------TEDMLDLIDGWRVDEDLVSSD    205

Query        250 EGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVY    309
d1wdua_      206 HNGMVFN-----------------------------------------------------    212

Query        310 SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSK    369
d1wdua_      213 ------------------------------------------------------------    213

Query        370 GDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIV    429
d1wdua_      213 ------------------------------------------------------------    213

Query        430 LAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASI    489
d1wdua_      213 ------------------------------------------------------------    213

Query        490 TKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISA    549
d1wdua_      213 ------------------------------------------------------------    213

Query        550 KGFGKDRRLPITNRWREGH-----    568
d1wdua_      213 -------------------IRLQK    217


hit structure      alignment
TMalign alignment (TM-score: 0.25 Raw score:143.33)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1wdua_        1 --PPYRVLQAN-LQR-KK-LATAELAIEAATRK---AAIALI-QE-PY------------     38

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLH--R-    117
d1wdua_       39 ----V-----KGFR--G----V--RVFQS-TAQ------------GDGTVKAAIAVFDHD     68

Query        118 ---GRVAL-T--FAKHHLPNYGVFDEFRYFVPGDTMPIVRLH----GVDIALAICE--DL    165
d1wdua_       69 LDV---IQYPQLTTNN-------------------IVVVGIRTRAWEITLVSYYFEPDKP    106

Query        166 WQD-GGRVPAARSAGA--GLLLSVNASPYE----RDKDDT-RLELVRKRAQEAGCTTAY-    216
d1wdua_      107 IESYLEQIKRVERKMGPKRLIFGGDANAKSTWWG-SKEDDARGDQLMGTLGELGLHILNE    165

Query        217 ---LAMIGGQDELVFDGDSIVVDRD--GE---VV-ARAPQ-----FSEGCVVLDLDLPAA    262
d1wdua_      166 GDV-PTFDT---RYQSRVDVTFCTEDM-LDLI-DGWRVDEDLVSSDHNGMVFNIR-----    214

Query        263 EAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAK    322
d1wdua_      215 ---------------------------LQK------------------------------    217

Query        323 NGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLN    382
d1wdua_      218 ------------------------------------------------------------    218

Query        383 FRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGY    442
d1wdua_      218 ------------------------------------------------------------    218

Query        443 STLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILE    502
d1wdua_      218 ------------------------------------------------------------    218

Query        503 LYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITN    562
d1wdua_      218 ------------------------------------------------------------    218

Query        563 RWREGH    568
d1wdua_      218 ------    218


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.01)
DALI match                                          
Query         17 DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYP     51
d1wdua_        9 NLQRKKLATAELAIEAATRKAAIALIQEPYVKGFR     43



top
29: d1akoa_ DNA-​repair enzyme exonuclease III (svm: 1.447)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.17  Contact: 868
Modified z-scores:
dali:0.95 daliz:0.90 gdtts:0.97 tmscore:0.98 rmsd:0.38 AHM:0.34 LBcontacta:0.93 LBcontactb:0.91 LHM:0.28
id:0.84 blosum:0.06 compass:0.14 pearson:0.96
Scaled scores:
dali:0.66 daliz:0.31 gdtts:0.49 tmscore:0.61 rmsd:0.76 AHM:0.70 LBcontacta:0.32 LBcontactb:0.47 LHM:0.25
id:0.01 blosum:0.03 compass:0.17 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:507.10)
Query          1 slqlRLALNQidstvgdiAGNAEAILRWTRHSAeqgahLVAFPEMAltgypvedlalrss     60
d1akoa_        1 ----MKFVSF---ninglRARPHQLEAIVEKHQ----pDVIGLQET-------------k     36

Query         61 fVEASRtaLRELAARLAeegfgelpvlvgYLDRSesaqpkygqpagaprNAAAVLH-rgr    119
d1akoa_       37 vHDDMF--PLEEVAKLG-------ynvfyHGQKG--------------hYGVALLTketp     73

Query        120 vaLTFAkhhlpnygvfdefryFVPG-dtmPIVRLH--GVDIALAICE-------------    163
d1akoa_       74 iaVRRG----------fpgddEEAQrriiMAEIPSllGNVTVINGYFpqgesrdhpikfp    123

Query        164 -dlWQDGGRVPAARSAG---aGLLLSVNaspyerdkddTRLE------------------    201
d1akoa_      124 akaQFYQNLQNYLETELkrdnPVLIMGD--------mnISPTdldigigeenrkrwlrtg    175

Query        202 ----------LVRKRAQeAGCTtaylamiggqdelvfdgdsivvdrdgeVVARA------    245
d1akoa_      176 kcsflpeereWMDRLMS-WGLV---------------------------DTFRHanpqta    207

Query        246 -PQFS-----------------------------------------------egcVVLDL    257
d1akoa_      208 dRFSWfdyrskgfddnrglridlllasqplaeccvetgidyeirsmekpsdhapvWATFR    267

Query        258 Dlpaaeaepptgvvddglridrlviseeplpayeaelaggyadrldadeevysalvvglr    317
d1akoa_      268 R-----------------------------------------------------------    268

Query        318 ayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaaelar    377
d1akoa_      269 ------------------------------------------------------------    269

Query        378 rtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnkse    437
d1akoa_      269 ------------------------------------------------------------    269

Query        438 lavgystlygdsvgaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvl    497
d1akoa_      269 ------------------------------------------------------------    269

Query        498 dailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrr    557
d1akoa_      269 ------------------------------------------------------------    269

Query        558 lpitnrwregh    568
d1akoa_      269 -----------    269


hit structure      alignment
FAST alignment (Normalized score: 2.42 Raw score:945.70)
Query          1 SLQLRLALNQIDSTVG-DIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS     59
d1akoa_        1 ---MKFVSFNI-----NGLRARPHQLEAIVEK---HQPDVIGLQ----------------     33

Query         60 S----FVEA-SRTALRELAARLAEEGFG-ELPVLVGYLDRSESAQPKYGQPAGAP-----    108
d1akoa_       34 -ETKVHDDMFPLEEVAK-----------LGYNVFY--------------------HGQKG     61

Query        109 RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTM---------------------    147
d1akoa_       62 HYGVALL--------------------------------TKETPIAVRRGFPGDDEEAQR     89

Query        148 ----PIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKD-------    196
d1akoa_       90 RIIMAEIPSLLG-------------------------NVTVINGYFPQGE---SRDHPIK    121

Query        197 ----DTRLELVRKRAQE---AGCTTAYLA-------------------------------    218
d1akoa_      122 FPAKAQFYQNLQNYLETELKRDNPVLIM-GDMNISPTDLDIGIGEENRKRWLRTGKCSFL    180

Query        219 ------------------------------MIGGQDELVF-----------DGDSIVVDR    237
d1akoa_      181 PEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYR----SKGFDDNRGLRIDLLLA---    233

Query        238 DGEVVARAPQF------------------------SEGCVVLDLDLPAAEAEPPTGVVDD    273
d1akoa_      234 -----------SQPLAECCVETGIDYEIRSMEKPSDHAPVWAT-----------------    265

Query        274 GLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLS    333
d1akoa_      266 ------------------------------------------------------------    266

Query        334 GGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFD    393
d1akoa_      266 ------------------------------------------------------------    266

Query        394 AYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAY    453
d1akoa_      266 ------------------------------------------------------------    266

Query        454 GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADA    513
d1akoa_      266 ------------------------------------------------------------    266

Query        514 IVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH---    568
d1akoa_      266 -------------------------------------------------------FRR    268


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:151.13)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAE-QGAHLVAFPEMALTGYPVEDLALRS     59
d1akoa_        1 ---MKFVSFNING-------LRAR-PHQLEAIVEKHQPDVIGLQ--ETK-----------     36

Query         60 SFVEASRTALRELAARLAEEGFGELPVLVGYLD-RSESAQPKYGQPAGAPRNAAAVLHR-    117
d1akoa_       37 ----VHDDMF--PLEEVAK--LG-YNVFYHGQKG----------------HYGVALLTKE     71

Query        118 GRV-ALTFAKHHLPNYGVFDEFRYFVPG--DTMPIVRLHG--VDIALAI-C---------    162
d1akoa_       72 -TPIAVRRGFPGD--------D--EEAQRR-IIMAEIPSLLGNVTVINGYFPQGESRDHP    119

Query        163 -----E--DLWQDGGRVPAARSAGAGLLLSVNASP---------------------YERD    194
d1akoa_      120 IKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSF    179

Query        195 KDDTRLELVRKRAQEAGCTTAY-----------LAMIGGQ--------DELVFDGDSIVV    235
d1akoa_      180 LPEER-EWMDRLMSW-GLVDTFRHANPQTADRF-SWFDYRSKGFDDNR----GLRIDLLL    232

Query        236 DRD--GE-V-VARA-P--------QFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVI    282
d1akoa_      233 ASQPLAECCVETGIDYEIRSMEKP-SDHAPVWATFR------------------------    267

Query        283 SEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVA    342
d1akoa_      268 ------R-----------------------------------------------------    268

Query        343 AIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLT    402
d1akoa_      269 ------------------------------------------------------------    269

Query        403 GLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKT    462
d1akoa_      269 ------------------------------------------------------------    269

Query        463 SIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRE    522
d1akoa_      269 ------------------------------------------------------------    269

Query        523 LVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1akoa_      269 ----------------------------------------------    269


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.02)
DALI match       .......        ***********   .    .......
Query          4 LRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPE     44
d1akoa_        1 MKFVSFNIN----GLRARPHQLEAIV---EKHQPDVIGLQE     34



top
30: d1sr4b_ Cytolethal distending toxin subunit B (svm: 1.446)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.23  Contact: 852
Modified z-scores:
dali:0.96 daliz:0.93 gdtts:0.97 tmscore:0.97 rmsd:0.40 AHM:0.40 LBcontacta:0.90 LBcontactb:0.92 LHM:0.34
id:0.94 blosum:0.58 compass:0.54 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.51 tmscore:0.60 rmsd:0.77 AHM:0.69 LBcontacta:0.34 LBcontactb:0.54 LHM:0.24
id:0.05 blosum:0.12 compass:0.10 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:532.50)
Query          1 -slQLRLALNQIDSTVGdiaGNAEAILRWTRHSAE--QGAHLVAFPeMALTgypvedlal     57
d1sr4b_        1 nlsDFKVATWNLQGSSA---VNESKWNINVRQLLSgeQGADILMVQ-EAGS---------     47

Query         58 rssfveasrtalreLAAR-----------------lAEEG----fGELPVLVGY-LDRSe     95
d1sr4b_       48 -------------lPSSAvrtsrviqhggtpieeytWNLGtrsrpNMVYIYYSRlDVGA-     93

Query         96 saqpkygqpagaprnaaavlhrgrvaltfakhhlpnygvfdefryfvpgdtMPIVrlhgv    155
d1sr4b_       94 --------------------------------------nrvnlaivsrrqaDEAF-----    110

Query        156 dialaiceDLWQD---ggrvpaarsaGAGLLLSVNaSPYErdkdDTRLELVRKRAQEAG-    211
d1sr4b_      111 -------iVHSDSsvlqsrpavgiriGTDVFFTVHaLATG---gSDAVSLIRNIFTTFNs    160

Query        212 -------CTTAYLA-miggqdelvfdgdsivvdrDGEVVAR-aPQFS-------------    249
d1sr4b_      161 pperrvySWMVVGDfnrapanlevalrqepavseNTIIIAPtePTHRsgnildyailhda    220

Query        250 ----------------------------EGCVVLDLdlpaaeaepptgvvddglridrlv    281
d1sr4b_      221 hlprreqarerigaslmlnqlrsqitsdHFPVSFVR------------------------    256

Query        282 iseeplpayeaelaggyadrldadeevysalvvglrayvakngfrsvliglsggidsalv    341
d1sr4b_      257 ------------------------------------------------------------    257

Query        342 aaiacdalgaqnvygvsmpskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgl    401
d1sr4b_      257 ------------------------------------------------------------    257

Query        402 tglaeenlqsrlrgttlmaisnqeghivlapgnkselavgystlygdsvgaygpikdvyk    461
d1sr4b_      257 ------------------------------------------------------------    257

Query        462 tsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydr    521
d1sr4b_      257 ------------------------------------------------------------    257

Query        522 elvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1sr4b_      257 ---------------------------------------------dr    258


hit structure      alignment
FAST alignment (Normalized score: 2.13 Raw score:814.50)
Query          1 SL---QLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQ-----GAHLVAFPEMALTGYPV     52
d1sr4b_        1 --NLSDFKVATWNLQGSSA---VNESKWNINVRQL---LSGEQGADILM-----------     41

Query         53 EDLALRSSFVEASRTALRELAARLAEEGF-------------------------------     81
d1sr4b_       42 -----------------------------VQEAGSLPSSAVRTSRVIQHGGTPIEEYTWN     72

Query         82 -------GELPVLVGYLDRSESAQPKYGQPAGAP-------RNAAAVLHRGRVALTFAKH    127
d1sr4b_       73 LGTRSRPNMVYIYYS-------------------RLDVGANRVNLAIV------------    101

Query        128 HLPNYGVFDEFRYFVPGDTMPIVRLHGVD-----IALAICEDLWQDGGRVPAARSAG---    179
d1sr4b_      102 -----------------------------SRRQADEAF-------------------IVH    113

Query        180 ----------------AGLLLSVNASPYERDKD----DTRLELVRKRAQE-------AGC    212
d1sr4b_      114 SDSSVLQSRPAVGIRIGTDVFFTVHAL------ATGGSDAVSLIRNIFTTFNSPPERRVY    167

Query        213 TTAYLAMIGGQDELVF---------------------------------------DGDSI    233
d1sr4b_      168 SWMVV-----------GDFNRAPANLEVALRQEPAVSENTIIIAPTEPTHRSGNILDYAI    216

Query        234 VVDRDGEVVARAPQFS-----------------------------EGCVVLDLDLPAAEA    264
d1sr4b_      217 LHD-------------AHLPRREQARERIGASLMLNQLRSQITSDHFPVSF---------    254

Query        265 EPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNG    324
d1sr4b_      255 ------------------------------------------------------------    255

Query        325 FRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFR    384
d1sr4b_      255 ------------------------------------------------------------    255

Query        385 TVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYST    444
d1sr4b_      255 ------------------------------------------------------------    255

Query        445 LYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELY    504
d1sr4b_      255 ------------------------------------------------------------    255

Query        505 VDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRW    564
d1sr4b_      255 ------------------------------------------------------------    255

Query        565 REGH----    568
d1sr4b_      255 ----VRDR    258


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:161.71)
Query          1 SLQLRLALNQIDSTVG--DIAGNAE-AILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1sr4b_        1 -NLSDFKVATWNLQGSSAVNESKWNINVRQLLSG--EQGA-DILMVQE-AG---------     46

Query         58 RSSFVEASRTALRE---------------LAARLAE--EGFGELPVLVGYLDRSESAQPK    100
d1sr4b_       47 -------SLPSSAVRTSRVIQHGGTPIEEYTWNLGTRSRPNM-VYI-Y-YSRLD------     90

Query        101 YGQPAGA-P-RNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIA    158
d1sr4b_       91 -----VGANRVNLAIVSRR-QADEAFIVHSDSSV---LQS--R-PA-V-GIRIG--TDVF    134

Query        159 LAICE------DLWQD-GGRVPAAR-S--AGAGLLLSVNASPYERDKDDTRLELVRKRAQ    208
d1sr4b_      135 FTVHALATGGSDAVSLIRNIFTTFNSPPERRVYSWMVVGDFNRA---PANLEVALRQEPA    191

Query        209 EAGCTTAYLA--MIGGQDELVFDGDSIVV-D--R---DGEVV--ARAP-----------Q    247
d1sr4b_      192 VSENTIIIAPTEPTHR---SGNILDYAILHDAHLPRREQARERIGASLMLNQLRSQITS-    247

Query        248 FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEE    307
d1sr4b_      248 DHFPVSFVR-------------------------------------DR------------    258

Query        308 VYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDH    367
d1sr4b_      259 ------------------------------------------------------------    259

Query        368 SKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGH    427
d1sr4b_      259 ------------------------------------------------------------    259

Query        428 IVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEA    487
d1sr4b_      259 ------------------------------------------------------------    259

Query        488 SITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKI    547
d1sr4b_      259 ------------------------------------------------------------    259

Query        548 SAKGFGKDRRLPITNRWREGH    568
d1sr4b_      259 ---------------------    259


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.46)
DALI match                                                  
Query        333 SGGIDSALVAAIACDALGAQN----VYGVSMPSKYSSDHSKGD    371
d1sr4b_      142 TGGSDAVSLIRNIFTTFNSPPERRVYSWMVVGDFNRAPANLEV    184



hit structures. 
top
31: d1i9za_ Synaptojanin,​ IPP5C domain (svm: 1.445)

SCOP Superfamily: DNase I-​like  |  SCOP Fold: DNase I-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.25  Contact: 663
Modified z-scores:
dali:0.94 daliz:0.89 gdtts:0.94 tmscore:0.96 rmsd:0.50 AHM:0.44 LBcontacta:0.91 LBcontactb:0.94 LHM:0.30
id:0.50 blosum:0.02 compass:0.24 pearson:0.95
Scaled scores:
dali:0.69 daliz:0.35 gdtts:0.46 tmscore:0.56 rmsd:0.73 AHM:0.69 LBcontacta:0.37 LBcontactb:0.59 LHM:0.23
id:-0.02 blosum:-0.00 compass:0.20 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:457.60)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqGAHLVAFPEmaltGYPVEdlalrss     60
d1i9za_        1 ------------ydpiheyvnhelrkrenefsehkNVKIFVASY----NLNGC-------     37

Query         61 FVEAsrtalrelaarlaEEGFgeLPVLVGYldrsesaqpkygqpaGAPR-----------    109
d1i9za_       38 SATT----klenwlfpeNTPL-aDIYVVGF-----qeivqltsadPAKRrewescvkrll     87

Query        110 -naaavlhRGRVALTFA-----------------------kHHLPNYGvfdefryfvpgd    145
d1i9za_       88 ngkctsgpGYVQLRSGQlvgtalmifckesclpsiknvegtVKKTGLG--------nkga    139

Query        146 tMPIVRLHGVDIALAICE-----------dlWQDGGR-------vpAARSagAGLLLSVN    187
d1i9za_      140 vAIRFDYEDTGLCFITSHlaagytnyderdhDYRTIAsglrfrrgrSIFN--HDYVVWFG    197

Query        188 ASPyERDK-------------------DDTRLELVR---KRAQeagcttaylamiggqde    225
d1i9za_      198 DFNyRISLtyeevvpciaqgklsylfeYDQLNKQMLtgkVFPF-----------------    240

Query        226 lvfdgdsivvdrdgeVVARAPQFS------------------------------egCVVL    255
d1i9za_      241 --------------fSELPITFPPtykfdigtdiydtsdkhrvpawtdrilyrgelVPHS    286

Query        256 dldlpaaeaepptgvvddglridrlvisEEPLPAyeaelaggyadrldadeevysalvvg    315
d1i9za_      287 -------yqsvplyysdhrpiyatyeanIVKVDR--------------------------    313

Query        316 lrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmpskyssdhskgdaael    375
d1i9za_      314 ------------------------------------------------------------    314

Query        376 arrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlmaisnqeghivlapgnk    435
d1i9za_      314 ------------------------------------------------------------    314

Query        436 selavgystlygdsvgaygpikdvyktsifrlaewrnraaaergqtppipeasitkpdyp    495
d1i9za_      314 ------------------------------------------------------------    314

Query        496 vldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkd    555
d1i9za_      314 --------------------------------------------------ekkkilfeel    323

Query        556 rrlpitnrwregh    568
d1i9za_      324 ynqrkqevrdasq    336


hit structure      alignment
FAST alignment (Normalized score: 2.81 Raw score:1227.00)
Query          1 ---------------------SLQLRLALNQIDSTVGDIAGNAE---AILRWTRHSAEQ-     35
d1i9za_        1 YDPIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCS------ATTKLENWL------F     48

Query         36 -----GAHLVAFPEM---ALTGYPVEDLALRSS----FVEASRTALRELAARLAEEGFGE     83
d1i9za_       49 PENTPLADIYVV---GFQEIVQ-----------LTSADPAKRREWESCVKRLLNG-----     89

Query         84 LP----------VLVGYLDRSESAQPKYGQPAGAP---RNAAAVLHRGRV----------    120
d1i9za_       90 --KCTSGPGYVQLRSG-------------------QLVGTALMIF-----CKESCLPSIK    123

Query        121 -ALTFAKHHLPNYGVFDEFRYFVPGD------TMPIVRLHGVDIALAICEDLWQDG----    169
d1i9za_      124 NVEGT--VKKTG--------------LGNKGAVAIRFDYEDTGLCFI---------TSHL    158

Query        170 ---------------GRVPAARS----------AGAGLLLSVNASPYERDK---------    195
d1i9za_      159 AAGYTNYDERDHDYRTIAS----GLRFRRGRSIFNHDYVVWFGDFNYR---ISLTYEEVV    211

Query        196 -------------DDTRLELVRKRAQEAGCTTAYLAMIGGQDELVF--------------    228
d1i9za_      212 PCIAQGKLSYLFEYDQLNKQML------------------------TGKVFPFFSELPIT    247

Query        229 -------------------------DGDSIVVDRDGEVVARAPQ----------------    247
d1i9za_      248 FPPTYKFDIGTDIYDTSDKHRVPAWTDRILY-------------RGELVPHSYQSVPLYY    294

Query        248 --FSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDAD    305
d1i9za_      295 SDHRPIYATYEANI----------------------------------------------    308

Query        306 EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSS    365
d1i9za_      309 ------------------------------------------------------------    309

Query        366 DHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQE    425
d1i9za_      309 ------------------------------------------------------------    309

Query        426 GHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIP    485
d1i9za_      309 ------------------------------------------------------------    309

Query        486 EASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGT    545
d1i9za_      309 ------------------------------------------------------------    309

Query        546 KISAKGFGKDRRLPITNRWREGH----------------------------    568
d1i9za_      309 -----------------------VKVDREKKKILFEELYNQRKQEVRDASQ    336


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:172.69)
Query          1 ---------------------SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHL     39
d1i9za_        1 YDPIHEYVNHELRKRENEFSEHKNVKIFVASY-NLNGCSAT-TKL-ENWLFPENTPLADI     57

Query         40 VAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGF--GELPVLVGYLDRSESA     97
d1i9za_       58 YVVGFQE-IV--QLT--SA--DPAKRREWESCVKRLLNGKCTSGPGYVQLRSG-QL----    105

Query         98 QPKYGQPAGAPRNAAAVLHRG-----RVA--LTFAKHHLPNYGVFDEFRYFVPGDTMPIV    150
d1i9za_      106 ----------VGTALMIFCKESCLPS--IKNVEGTVKKTGL----GNK--G-AV--AIRF    144

Query        151 RLHGVDIALAIC-E------------DLWQ-DGGRV----PAARSAGAGLLLSVNASPYE    192
d1i9za_      145 DYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRGRSIFN--HDYVVWFGDFNYR    202

Query        193 RD--------------------K-D-DTRLELVRKRAQEAGCTTAY-L-A-MIGGQ----    223
d1i9za_      203 ISLTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPF----FSELPITFPPTYKFDIGT    258

Query        224 ---D---E-L-VFDGDSIVVDRDGEVVARAPQ-------FSEGCVVLDLDLPAAEAE---    265
d1i9za_      259 DIYDTSDKHRVPAWTDRILYRGE-LVPHSYQSVPLYYSDHRPIYATYEA-NIVKVDREKK    316

Query        266 --------------------PPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDAD    305
d1i9za_      317 KILFEELYNQRKQEVRDASQ----------------------------------------    336

Query        306 EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSS    365
d1i9za_      337 ------------------------------------------------------------    337

Query        366 DHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQE    425
d1i9za_      337 ------------------------------------------------------------    337

Query        426 GHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIP    485
d1i9za_      337 ------------------------------------------------------------    337

Query        486 EASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGT    545
d1i9za_      337 ------------------------------------------------------------    337

Query        546 KISAKGFGKDRRLPITNRWREGH    568
d1i9za_      337 -----------------------    337


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.12)
DALI match                                                      
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVA--FPEM     45
d1i9za_       22 HKNVKIFVASYNLNGCSATTKLENWLFPE---NTPLADIYVVGFQEI     65



top
32: d1jmva_ Universal stress protein A,​ UspA (hh: 0.956)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.53  Contact: 860
Modified z-scores:
dali:0.96 daliz:0.97 gdtts:0.93 tmscore:0.93 rmsd:0.34 AHM:0.37 LBcontacta:0.92 LBcontactb:0.91 LHM:0.27
id:0.87 blosum:0.50 compass:0.49 pearson:0.94
Scaled scores:
dali:0.77 daliz:0.52 gdtts:0.57 tmscore:0.65 rmsd:0.79 AHM:0.69 LBcontacta:0.46 LBcontactb:0.66 LHM:0.30
id:0.04 blosum:0.10 compass:0.23 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 7.9 Raw score:512.80)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1jmva_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1jmva_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1jmva_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1jmva_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1jmva_        1 ------------------------------------------------------------      1

Query        301 rldadeevysalvvglrayvaknGFRSVLIGLSGGIDSALVAAIACDALG--aqNVYGVS    358
d1jmva_        1 -----------------------MYKHILVAVDLSEESPILLKKAVGIAKrhdaKLSIIH     37

Query        359 MPS------------------kysSDHSKGDAAELARRTG---lNFRTVSIepmfdayma    397
d1jmva_       38 VDVnfsdlytglidvnmssmqdriSTETQKALLDLAESVDypisEKLSGSG---------     88

Query        398 slgltglaeenlqsrLRGTTLMAISNQEGH-IVLAPGNKseLAVGYS------tlygdsv    450
d1jmva_       89 ---------------DLGQVLSDAIEQYDVdLLVTGHHQ--DFWSKLmsstrqvmntiki    131

Query        451 gAYGPiKDVYktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtg    510
d1jmva_      132 dMLVV-PLRD--------------------------------------------------    140

Query        511 adaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1jmva_      141 ----------------------------------------------------------    141


hit structure      alignment
FAST alignment (Normalized score: 3.30 Raw score:930.50)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1jmva_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1jmva_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1jmva_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1jmva_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1jmva_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ------NV    354
d1jmva_        1 -----------------------MYKHILVAVDLSEESPILLKKAVGI----AKRHDAKL     33

Query        355 YGVSMPSKYSS-----------------------DHSKGDAAELAR--RTGL-NFRTVSI    388
d1jmva_       34 SIIHVD-----VNFSDLYTGLIDVNMSSMQDRISTETQKALLDLAESVDYPISEKLSG--     86

Query        389 EPMFDAYMASLGLTGLAEENLQSR--LRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTL    445
d1jmva_       87 ------------------------SGDLGQVLSDAIEQYDVDLLVTGHH-----------    111

Query        446 Y-------------GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP    492
d1jmva_      112 -QDFWSKLMSSTRQVMNTIK----------------------------------------    130

Query        493 DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGF    552
d1jmva_      131 ------------------------------------------------------------    131

Query        553 GKDRRLPITNRWREGH----------    568
d1jmva_      131 ----------------IDMLVVPLRD    140


hit structure      alignment
TMalign alignment (TM-score: 0.17 Raw score:95.23)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1jmva_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1jmva_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1jmva_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1jmva_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1jmva_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--AQNVYGVS    358
d1jmva_        1 -----------------------MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIH     37

Query        359 MPSK---------------------YSSDHSKGDAAELARRT--GLNFRTVSIEPMFDAY    395
d1jmva_       38 VDVNFSDLYTGLIDVNMSSMQDRIS--TE-TQKALLDLAESVDYPISEKLSGS-------     87

Query        396 MASLGLTGLAEENLQSRLRGTTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDS-VG--    451
d1jmva_       88 --------------G--DLGQVLSDAIEQYDVDLLVTGHH-QDFWSKLMS--STRQVMNT    128

Query        452 ----AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDR    507
d1jmva_      129 IKIDMLV-VP-L-RD---------------------------------------------    140

Query        508 DTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREG    567
d1jmva_      141 ------------------------------------------------------------    141

Query        568 H    568
d1jmva_      141 -    141


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.35)
DALI match                                                                   
Query         19 AGNAEAILRWTRHSAEQGAHLVAF------PEMALTGYPVEDLALRSSFVEASRTALREL     72
d1jmva_       13 EESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSSMQDRISTETQKALLDL     72

DALI match          
Query         73 AAR     75
d1jmva_       73 AES     75



top
33: d1jila_ Tyrosyl-​tRNA synthetase (TyrRS) (svm: 1.013)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.07  Contact: 1049
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.39 AHM:0.37 LBcontacta:0.93 LBcontactb:0.95 LHM:0.23
id:0.82 blosum:0.11 compass:0.20 pearson:0.98
Scaled scores:
dali:0.73 daliz:0.41 gdtts:0.50 tmscore:0.64 rmsd:0.79 AHM:0.74 LBcontacta:0.35 LBcontactb:0.58 LHM:0.39
id:0.01 blosum:0.05 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 6.1 Raw score:653.80)
Query          1 slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss     60
d1jila_        1 ------------------------------------------------------------      1

Query         61 fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv    120
d1jila_        1 ------------------------------------------------------------      1

Query        121 altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga    180
d1jila_        1 ------------------------------------------------------------      1

Query        181 glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge    240
d1jila_        1 ------------------------------------------------------------      1

Query        241 vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad    300
d1jila_        1 -----------------------------------------------------------t      1

Query        301 rldadeeVYSAL-----vvglrayvAKNGFRSVLIGLS-----ggIDSALVAAIACDALG    350
d1jila_        2 nvliedlKWRGLiyqqtdeqgiedlLNKEQVTLYCGADptadslhIGHLLPFLTLRRFQE     61

Query        351 -aqNVYGVSMP--SKYS----------------SDHSKGDAAELARRTG-------LNFR    384
d1jila_       62 hghRPIVLIGGgtGMIGdpsgkseervlqteeqVDKNIEGISKQMHNIFefgtdhgAVLV    121

Query        385 TVS--IEPMfdAYMASL----------------------gltGLAEENLQSRLRGTTLMA    420
d1jila_      122 NNRdwLGQI--SLISFLrdygkhvgvnymlgkdsiqsrlehgISYTEFTYTILQAIDFGH    179

Query        421 ISNQEGH-IVLAPGNkselavgystlyGDSV--------------gAYGPiKDVY-----    460
d1jila_      180 LNRELNCkIQVGGSD---------qwgNITSgielmrrmygqtdayGLTI-PLVTksdgk    229

Query        461 ---------------------------------ktsifrLAEW-----------------    470
d1jila_      230 kfgksesgavwldaektspyefyqfwinqsdedvikflkYFTFlgkeeidrleqskneap    289

Query        471 -------rnRAAAerGQTPpipeasitkpdypvldailelyvdrdtgadaivaagydrel    523
d1jila_      290 hlreaqktlAEEV--TKFI-----------------------------------------    306

Query        524 vvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    568
d1jila_      307 ----------------------------hgedalndairisqalf    323


hit structure      alignment
FAST alignment (Normalized score: 1.72 Raw score:734.40)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1jila_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1jila_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1jila_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1jila_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1jila_        1 ------------------------------------------------------------      1

Query        301 RLDADEEVYSA------------------LVVGLRAYVAKNGFRSVLIGLSG--------    334
d1jila_        1 -----------TNVLIEDLKWRGLIYQQTDEQGIEDLLN---KEQVTLYC--GADPTADS     44

Query        335 ----GIDSALVAAIACDALGAQNVYGVSMPSKYS--------------------------    364
d1jila_       45 LHIGHLLPFLTLRRFQE----HGHRPIVLI----GGGTGMIGDPSGKSEERVLQTEEQVD     96

Query        365 --SDHSKGDAAELARRTGL-------NFRTVSIEPMFDAYMASLGLTG------------    403
d1jila_       97 KNIEGISKQMHNI------FEFGTDHGAVLVNNRDWLGQ---------ISLISFLRDYGK    141

Query        404 ---------------------LAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGY    442
d1jila_      142 HVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNC-KIQVGGSD------    194

Query        443 STLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILE    502
d1jila_      195 ------------------------------------------------------------    195

Query        503 LYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITN    562
d1jila_      195 ------------------------------------------------------------    195

Query        563 RWREGH------------------------------------------------------    568
d1jila_      195 ------QWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSP    248

Query        569 ------------------------------------------------------------    569
d1jila_      249 YEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHG    308

Query        569 ---------------    569
d1jila_      309 EDALNDAIRISQALF    323


hit structure      alignment
TMalign alignment (TM-score: 0.23 Raw score:132.47)
Query          1 -------------------------S--LQLRLALNQIDSTVGDIAGN-AEAI-LRWTRH     31
d1jila_        1 TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYC-GADPTADSLHIG-HLLP-FLTLR     57

Query         32 SAEQGAHLVAFPEMA-LT--GYP--V--EDLALRSSFVEASRTALRELAARLAEEGFGEL     84
d1jila_       58 RFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHG    117

Query         85 PVLVGYLD-RSESAQPKYG------QPAGAPRNAAAVLHRGRVALTFAKHHL--PN----    131
d1jila_      118 AVLVNNRDWLGQISLISFLRDYGKH------------------------VGVNYMLGKDS    153

Query        132 YGVF----DEFRY-FV-PG-DT--MP-IVRLHGVDIALA----ICEDLWQDGGRVPAARS    177
d1jila_      154 IQSRLEHGISYTEFTYTILQAIDFGHLNREL--NCKIQVGGSDQWGNITSGIELMRRMYG    211

Query        178 AGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDR    237
d1jila_      212 Q-TD-A------------------------------YGLT------------IP------    221

Query        238 DGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGG    297
d1jila_      222 ---------LVT------------------------------------------------    224

Query        298 YADRLDADEEVYSALVVGLRAYVAKN----GFR-----SVLIGLSGGIDSALVAAIACDA    348
d1jila_      225 -------KS--DG-KKFGKSESGAVWLDAEKTSPYEFY-------------------QFW    255

Query        349 LGA--------------------------QNVYGVSMPSKYSSDHSKGDAAELARRTGLN    382
d1jila_      256 INQSDEDVIKFLKYFTFLGKEEIDRLEQS-------------------------------    284

Query        383 FRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGY    442
d1jila_      285 ------------------------------------------------------------    285

Query        443 STLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERG-QT--------------------    481
d1jila_      285 ----------------------------------KNEAPHLREAQKTLAEEVTKFIHGED    310

Query        482 -------------PPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTL    528
d1jila_      311 ALNDAIRISQALF-----------------------------------------------    323

Query        529 RMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    568
d1jila_      324 ----------------------------------------    324


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.49)
DALI match                                                                   
Query        465 FRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVA--AGYDRE    522
d1jila_      203 IELMRRMYGQTDAYGLTIPLVTKSDGKK-FGKSESGAVWLDAEKTSPYEFYQFWINQSDE    261

DALI match                
Query        523 LVVKTLRMV    531
d1jila_      262 DVIKFLKYF    270



top
34: d1qopb_ Tryptophan synthase,​ beta-​subunit (cs: 2.435)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.18  Contact: 933
Modified z-scores:
dali:0.96 daliz:0.96 gdtts:0.93 tmscore:0.95 rmsd:0.41 AHM:0.39 LBcontacta:0.92 LBcontactb:0.94 LHM:0.52
id:0.81 blosum:0.16 compass:0.11 pearson:0.93
Scaled scores:
dali:0.75 daliz:0.45 gdtts:0.47 tmscore:0.58 rmsd:0.79 AHM:0.74 LBcontacta:0.36 LBcontactb:0.55 LHM:0.15
id:0.01 blosum:0.05 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:639.30)
Query          1 -------------------------slqlrlalnqIDSTvgdiagnaeailrwtrhsaeq     35
d1qopb_        1 ttllnpyfgefggmyvpqilmpalnqleeafvsaqKDPE---------------------     39

Query         36 gahlvafpemaltgypvedlalrssfveasrtalrelaarlaeegfgelpvlvgyldrse     95
d1qopb_       40 ------------------------------------------------------------     40

Query         96 saqpkygqpagaprnaaavlhrgrvaltfakhhlpnygvfdefryfvpgdtmpivrlhgv    155
d1qopb_       40 ------------------------------------------------------------     40

Query        156 dialaicedlwqdggrvpaarsagaglllsvnaspyerdkddtrlelvrkraqeagctta    215
d1qopb_       40 ------------------------------------------------------------     40

Query        216 ylaMIGGqdelvfdgdsivvdrdgevvarapqfsegcvvldldlpaaeaepptgvvddgl    275
d1qopb_       40 --fQAQF-----------------------------------------------------     44

Query        276 ridrlviseeplpayeaelaggyadrldadEEVY--------------------------    309
d1qopb_       45 --------------------------adllKNYAgrptaltkcqnitagtrttlylkred     78

Query        310 --------salvVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMPS    361
d1qopb_       79 llhggahktnqvLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGL--KCRIYMGAK    136

Query        362 kyssdHSKGDAAELARRTGLNFRTVSIEPmfdaymaslgltglaeenlqSRLRGTTLMAI    421
d1qopb_      137 ---dvERQSPNVFRMRLMGAEVIPVHSGS------------------atLKDACNEALRD    175

Query        422 SNQEG--HIVLAPGNkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaerg    479
d1qopb_      176 WSGSYetAHYMLGTA---------------------------------------------    190

Query        480 qtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrr    539
d1qopb_      191 -------------------------------------------------------agphp    195

Query        540 qYPPG--TKISAK------------------------------GFGKDR-----------    556
d1qopb_      196 yPTIVreFQRMIGeetkaqildkegrlpdaviacvgggsnaigMFADFIndtsvgligve    255

Query        557 ------------------------------------------------------------    557
d1qopb_      256 pgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisagldfpsvgpqhayl    315

Query        557 ----rLPIT-------------------------------nrwREGH-------------    568
d1qopb_      316 nsigrADYVsitddealeafktlcrhegiipalesshalahalKMMReqpekeqllvvnl    375

Query        569 ---------------    569
d1qopb_      376 sgrgdkdiftvhdil    390


hit structure      alignment
FAST alignment (Normalized score: 1.86 Raw score:875.50)
Query          1 SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS     60
d1qopb_        1 ------------------------------------------------------------      1

Query         61 FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV    120
d1qopb_        1 ------------------------------------------------------------      1

Query        121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA    180
d1qopb_        1 ------------------------------------------------------------      1

Query        181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE    240
d1qopb_        1 ------------------------------------------------------------      1

Query        241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD    300
d1qopb_        1 ------------------------------------------------------------      1

Query        301 RLDAD-------------------------------------------------------    305
d1qopb_        1 -----TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRP     55

Query        306 -------------------------------EEVYSALVVGLRAYVAKNGFRSVLIGLSG    334
d1qopb_       56 TALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKR----MGKSEIIAET--    109

Query        335 --GIDSALVAAIACDALGAQ---NVYGVSMPSKYSSDHS------KGDAAELARRTGLNF    383
d1qopb_      110 GAGQHGVASALASAL-----LGLKCRIYMG---------AKDVERQSPNVFRMRLMGAEV    155

Query        384 RTVSIEPMFDAYMASLGLTGLAEENL----QSRLRGTTLMAISNQE---GHIVLAPGNKS    436
d1qopb_      156 IPVH----------------------SGSATLKDACNEALRDWSG-SYETAHYMLG----    188

Query        437 ELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPV    496
d1qopb_      189 ------------------------------------------------------------    189

Query        497 LDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDR    556
d1qopb_      189 ------------------------------------------------------------    189

Query        557 RLPITNRWREGH------------------------------------------------    568
d1qopb_      189 ------------TAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNA    236

Query        569 ------------------------------------------------------------    569
d1qopb_      237 IGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEES    296

Query        569 ------------------------------------------------------------    569
d1qopb_      297 YSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAH    356

Query        569 ----------------------------------    569
d1qopb_      357 ALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDIL    390


hit structure      alignment
TMalign alignment (TM-score: 0.22 Raw score:125.56)
Query          1 ---SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLAL     57
d1qopb_        1 TTL----------------LNPYFGEFG-GMY-VP-QILMPAL-----------------     24

Query         58 RSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHR    117
d1qopb_       25 --------------------------NQLEEA----------------------FVSA--     34

Query        118 GRVALT-FA--KH--HL----PNYGV--------------FD-EF----------RYFVP    143
d1qopb_       35 --QKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTL-YL-KREDLLHGGAH-----     85

Query        144 GDTMPIVRLHGVDIALAICEDLWQDGGRV-PAARSAGAGLLLSVNASPYERDKDDTRLEL    202
d1qopb_       86 -----------------KTNQVLG--QALL-AK--RMGKSEIIAE---T---GAGQHGVA    117

Query        203 VRKRAQEAGCTTAYL---------------AMIGGQDELVFDGDSIVV-DRDGEVVAR--    244
d1qopb_      118 SALASALLGLKCRIYMGAKDVERQSPNVFR----------------MRL-MGAEVIPVHS    160

Query        245 ---APQFSEG-CV--VLDLDLPA-------------------------------------    261
d1qopb_      161 GSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEG    220

Query        262 --------AEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALV    313
d1qopb_      221 RLPDAVIA-----------------------------------------------CVGGG    233

Query        314 VG---------------------LRAYVAKNGFRSVLIGLSGGIDSALVAAI-ACDA-LG    350
d1qopb_      234 SNAIGMFADFINDTSVGLIGVEP---------------------GGHGIETGEHGAPLKH    272

Query        351 AQ------------------------------------------NVYGVSMPSKYSSDHS    368
d1qopb_      273 GRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLN----------------    316

Query        369 KGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHI    428
d1qopb_      317 -----------------------------------------------------------S    317

Query        429 ----VLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPI    484
d1qopb_      318 IGRA-----------------------DYVSIT-DDEAL---------------------    332

Query        485 PEASITKPDYPVLDAILELYVDRDT------------GADAIVAAGYDRELVVKTLRMV-    531
d1qopb_      333 ------------EAFKTLCRHEGIIPALESSHALAHA--------------------LKM    360

Query        532 DTAEYKRRQYPPGTKISAKG-----------FGKDRRLPITNRWREGH    568
d1qopb_      361 -MREQPEKEQLLVVNLSGRGDKDIFTVHDIL-----------------    390


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.06)