HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T0542d2+3
Query:
T0542_Ad2+3.pdb
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1kqpa_ NH3-​dependent NAD+-​synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 19.65 0.730 1.00 22.6 16.9 0.75
2 d1gpma1 GMP synthetase,​ central domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 11.93 2.152 1.00 17.0 13.1 0.53
3 d1ni5a1 Putative cell cycle protein MesJ,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 8.17 2.482 1.00 13.9 8.9 0.55
4 d1sura_ Phosphoadenylyl sulphate (PAPS) reductase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 7.35 2.210 1.00 11.1 7.9 0.49
5 d1q15a1 beta-​Lactam synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 7.29 2.385 0.99 13.1 7.2 0.51
6 d1jgta1 beta-​Lactam synthetase Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.79 1.963 0.99 10.5 6.6 0.50
7 d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.61 1.905 1.00 12.5 7.9 0.47
8 d1ct9a1 Asparagine synthetase B,​ C-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.49 1.924 0.99 9.9 6.8 0.51
9 d1k92a1 Argininosuccinate synthetase,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 6.46 1.588 1.00 11.2 6.8 0.49
10 d1ru8a_ Putative N-​type ATP pyrophosphatase PF0828 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 4.24 1.159 0.99 6.9 5.1 0.41
11 d1mopa_ Pantothenate synthetase (Pantoate-​beta-​alanine ligase,​ PanC) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 3.82 0.995 0.01 5.8 3.1 0.50
12 d1mjha_ ​(​Hypothetical​(​ protein MJ0577 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 3.14 0.449 0.95 7.6 3.7 0.35
13 d1o97c_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 3.02 1.607 0.18 5.9 3.0 0.37
14 d1jmva_ Universal stress protein A,​ UspA Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.96 1.476 0.96 6.4 4.8 0.33
15 d1tq8a_ Hypothetical protein Rv1636 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.91 1.545 0.95 6.9 4.5 0.34
16 d1ll2a_ Glycogenin Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 2.88 0.738 0.01 5.0 3.4 0.39
17 d1a3wa3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.86 0.690 0.01 5.9 4.5 0.32
18 d1efvb_ Small,​ beta subunit of electron transfer flavoprotein ETFP Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.83 1.924 0.16 6.1 3.3 0.30
19 d1t57a_ Hypothetical protein MTH1675 PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.80 0.668 0.08 4.8 3.3 0.36
20 d1jila_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.71 1.015 0.02 6.1 2.4 0.46
21 d1fo8a_ N-​acetylglucosaminyltransferase I Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 2.665 0.458 0.01 4.4 2.9 0.43
22 d1o58a_ O-​acetylserine sulfhydrylase (Cysteine synthase) Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.66 1.490 0.06 6.3 3.5 0.42
23 d1j0aa_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.65 0.705 0.05 6.6 3.5 0.33
24 d1ga8a_ Galactosyltransferase LgtC Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 2.629 0.574 0.02 4.1 2.8 0.38
25 d1a49a3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.63 0.691 0.01 5.2 4.3 0.33
26 d1od6a_ Phosphopantetheine adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.58 1.593 0.01 6.0 3.3 0.34
27 d1rq2a1 Cell-​division protein FtsZ Tubulin nucleotide-​binding domain-​like Tubulin nucleotide-​binding domain-​like α/β 2.57 0.859 0.23 5.0 4.2 0.36
28 d1p5ja_ L-​serine dehydratase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.55 1.485 0.11 6.6 3.3 0.41
29 d1vi2a1 Putative shikimate dehydrogenase YdiB NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.54 0.714 0.04 5.2 3.3 0.38
30 d1e0ta3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.54 0.690 0.02 5.6 4.5 0.30
31 d1o97d1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.54 1.564 0.09 4.9 3.3 0.35
32 d1efva1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.54 1.771 0.04 5.5 3.4 0.36
33 d1vl1a_ 6-​phosphogluconolactonase NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 2.53 0.646 0.27 3.3 3.5 0.44
34 d1tuba1 Tubulin alpha-​subunit Tubulin nucleotide-​binding domain-​like Tubulin nucleotide-​binding domain-​like α/β 2.517 -0.241 0.01 4.3 4.5 0.38
35 d1o98a1 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain α/β 2.508 0.427 0.01 4.7 3.9 0.42
36 d1w2w.1 Putative methylthioribose-​1-​phosphate isomerase Ypr118W NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 2.505 -0.623 0.01 4.9 3.0 0.47
37 d1f2da_ 1-​aminocyclopropane-​1-​carboxylate deaminase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.500 0.353 0.10 3.9 2.5 0.46
38 d1j09a2 Glutamyl-​tRNA synthetase (GluRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.47 0.775 0.02 4.7 2.4 0.38
39 d1pkla3 Pyruvate kinase,​ C-​terminal domain PK C-​terminal domain-​like Pyruvate kinase C-​terminal domain-​like α/β 2.46 0.691 0.01 5.1 4.3 0.32
40 d1e5xa_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.44 0.724 0.05 3.6 2.8 0.35
41 d1jzta_ Hypothetical protein YNL200c (YNU0 YEAST) YjeF N-​terminal domain-​like YjeF N-​terminal domain-​like α/β 2.427 0.485 0.06 4.0 3.0 0.38
42 d1j1ua_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.41 1.021 0.01 5.3 2.6 0.41
43 d1nzja_ Glutamyl-​Q tRNA-​Asp synthetase YadB Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.41 0.722 0.02 4.5 1.9 0.35
44 d1v7ca_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.38 0.721 0.09 5.8 3.1 0.41
45 d1qopb_ Tryptophan synthase,​ beta-​subunit Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.38 0.724 0.14 3.7 3.0 0.44
46 d1gtra2 Glutaminyl-​tRNA synthetase (GlnRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.38 0.726 0.01 4.2 2.2 0.43
47 d1dnpa2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 2.36 1.499 0.01 5.2 3.5 0.23
48 d1ne7a_ Glucosamine 6-​phosphate deaminase/​isomerase NagB NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 2.346 -0.519 0.44 2.8 3.7 0.44
49 d1pl7a2 Ketose reductase (sorbitol dehydrogenase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.32 0.873 0.10 4.8 3.4 0.37
50 d1uana_ Hypothetical protein TT1542 LmbE-​like LmbE-​like α/β 2.31 0.281 0.93 4.0 2.8 0.38
51 d1q74a_ 1D-​myo-​inosityl 2-​acetamido-​2-​deoxy-​alpha-​D-​glucopyranoside deacetylase MshD LmbE-​like LmbE-​like α/β 2.30 0.737 0.01 4.2 2.2 0.42
52 d1irxa2 Class I lysyl-​tRNA synthetase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.28 0.723 0.01 4.0 2.5 0.41
53 d1n3la_ Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.27 0.709 0.01 4.0 2.5 0.42
54 d1npya1 Shikimate 5-​dehydrogenase-​like protein HI0607 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.25 1.194 0.09 4.9 3.4 0.35
55 d1h3fa1 Tyrosyl-​tRNA synthetase (TyrRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.24 0.733 0.00 4.7 1.7 0.42
56 d1nula_ Xanthine-​guanine PRTase (XPRTase) PRTase-​like PRTase-​like α/β 2.231 -0.241 0.07 3.3 2.9 0.32
57 d1owla2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 2.20 -0.438 0.93 4.7 2.4 0.30
58 d1efpa1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.19 1.519 0.02 4.7 2.2 0.34
59 d1jhda2 ATP sulfurylase central domain Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.18 0.728 0.01 4.3 3.0 0.35
60 d1np7a2 Cryptochrome Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 2.18 -0.258 0.91 4.6 2.1 0.37
61 d1tdja1 Allosteric threonine deaminase N-​terminal domain Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 2.12 0.837 0.09 6.7 3.2 0.42
62 d1jvba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.12 1.365 0.04 3.5 2.9 0.36
63 d1iqra2 DNA photolyase Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 2.12 1.495 0.02 4.1 2.7 0.23
64 d1ep3b2 Dihydroorotate dehydrogenase B,​ PyrK subunit Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 2.12 0.907 0.02 5.0 2.3 0.36
65 d1u3da2 Cryptochrome Cryptochrome/​photolyase,​ N-​terminal domain Cryptochrome/​photolyase,​ N-​terminal domain α/β 2.11 -0.212 0.91 4.6 2.5 0.30
66 d1h2ba2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.10 1.234 0.04 5.0 3.6 0.35
67 d1k4ka_ Nicotinamide mononucleotide (NMN) adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.10 0.727 0.01 3.7 2.5 0.39
68 d1rxwa2 Flap endonuclease-​1 (Fen-​1 nuclease) PIN domain-​like PIN domain-​like α/β 2.093 0.434 0.01 4.2 2.5 0.23
69 d1nupa_ Cytosolic NMN/​NAMN adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.09 0.722 0.01 4.0 2.7 0.39
70 d1g8fa2 ATP sulfurylase central domain Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.09 0.734 0.02 4.1 3.5 0.35
71 d1gpja2 Glutamyl tRNA-​reductase middle domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.09 1.493 0.07 3.8 3.0 0.35
72 d1lw7a1 Transcriptional regulator NadR,​ NMN-​adenylyltransferase domain Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 2.08 1.032 0.01 4.1 4.2 0.35
73 d1p5dx1 Phosphomannomutase/​phosphoglucomutase Phosphoglucomutase,​ first 3 domains Phosphoglucomutase,​ first 3 domains α/β 2.084 -1.007 0.15 3.3 3.2 0.30
74 d1ecfa1 Glutamine PRPP amidotransferase,​ C-​terminal domain PRTase-​like PRTase-​like α/β 2.052 -0.726 0.02 3.1 2.0 0.39
75 d1l1qa_ Adenine PRTase PRTase-​like PRTase-​like α/β 2.050 -0.715 0.02 3.3 2.8 0.36
76 d1ls1a2 GTPase domain of the signal sequence recognition protein Ffh P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 2.050 -1.436 0.08 3.8 3.4 0.40
77 d1ihua2 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 2.043 -0.901 0.02 3.4 3.0 0.42
78 d1xvaa_ Glycine N-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 2.040 -0.912 0.01 3.8 2.9 0.43
79 d1nyta1 Shikimate 5-​dehydrogenase AroE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.04 0.853 0.04 3.8 2.8 0.35
80 d1f8fa2 Benzyl alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 2.03 1.312 0.03 4.6 3.4 0.37
81 d1uj6a1 D-​ribose-​5-​phosphate isomerase (RpiA),​ catalytic domain NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 2.021 0.469 0.02 2.4 2.7 0.36
82 d1q77a_ Hypothetical protein Aq 178 Adenine nucleotide alpha hydrolases-​like Adenine nucleotide alpha hydrolase-​like α/β 2.02 1.491 0.02 4.5 3.6 0.30
83 d2masa_ Inosine-​uridine nucleoside N-​ribohydrolase,​ IU-​NH Nucleoside hydrolase Nucleoside hydrolase α/β 2.013 0.568 0.14 3.1 2.7 0.44
84 d1r6ta2 Tryptophanyl-​tRNA synthetase (TrpRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.99 0.711 0.02 3.9 2.1 0.38
85 d1q8fa_ Pyrimidine nucleoside hydrolase YeiK Nucleoside hydrolase Nucleoside hydrolase α/β 1.96 1.234 0.17 3.2 2.8 0.31
86 d1nvta1 Shikimate 5-​dehydrogenase AroE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.95 0.737 0.08 3.4 2.5 0.36
87 d1j9ja_ SurE homolog TM1662 SurE-​like SurE-​like α/β 1.94 0.996 0.02 3.7 1.6 0.37
88 d1lu9a1 Methylene-​tetrahydromethanopterin dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.94 1.492 0.18 3.6 2.8 0.37
89 d1kama_ Nicotinamide mononucleotide (NMN) adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.94 0.726 0.01 3.8 2.9 0.34
90 d1ne2a_ Hypothetical protein Ta1320 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.94 0.864 0.01 3.9 2.9 0.36
91 d1vj0a2 Hypothetical protein TM0436 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.92 0.873 0.09 4.1 3.2 0.36
92 d1iira_ UDP-​glucosyltransferase GtfB UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.91 1.495 0.02 5.4 1.6 0.32
93 d1np3a2 Class I ketol-​acid reductoisomerase (KARI) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.91 0.862 0.01 3.8 2.9 0.37
94 d1u0la2 Probable GTPase EngC (YjeQ),​ C-​terminal domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.90 1.403 0.01 4.1 2.6 0.35
95 d1qg8a_ Spore coat polysaccharide biosynthesis protein SpsA Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.87 0.676 0.01 3.1 2.5 0.36
96 d1v4va_ UDP-​N-​acetylglucosamine 2-​epimerase UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.87 0.803 0.02 5.2 2.6 0.36
97 d1qwja_ CMP acylneuraminate synthetase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.86 0.618 0.01 3.5 2.2 0.32
98 d1s3ia2 10-​formyltetrahydrofolate dehydrogenase domain 2 Formyltransferase Formyltransferase α/β 1.85 -1.019 0.93 3.6 2.2 0.36
99 d1c1da1 Phenylalanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.85 1.231 0.01 4.3 3.4 0.36
100 d1nv8a_ N5-​glutamine methyltransferase,​ HemK S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.84 0.866 0.02 3.6 2.4 0.27
101 d1saya1 L-​alanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.84 1.081 0.04 4.1 3.0 0.36
102 d1jqba2 Bacterial secondary alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.82 0.863 0.02 4.4 3.0 0.33
103 d1vl6a1 Malate oxidoreductase (malic enzyme) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.82 0.874 0.04 3.7 2.4 0.36
104 d1lk5a1 D-​ribose-​5-​phosphate isomerase (RpiA),​ catalytic domain NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.81 0.811 0.03 2.5 3.5 0.36
105 d1vlla_ Archaeal alanine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.81 0.876 0.02 4.2 2.8 0.33
106 d1mx3a1 Transcription corepressor CtbP NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.80 0.875 0.00 4.0 2.8 0.32
107 d1o89a2 Hypothetical protein YhdH NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.80 0.784 0.08 3.5 3.0 0.34
108 d1f3la_ Arginine methyltransferase,​ HMT1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.80 0.862 0.02 2.3 1.1 0.42
109 d1e8ca2 UDP-​N-​acetylmuramyl tripeptide synthetase MurE MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.79 1.004 0.04 3.2 2.8 0.31
110 d1jsxa_ Glucose-​inhibited division protein B (GidB) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.78 0.867 0.01 3.4 2.1 0.37
111 d1f9aa_ Nicotinamide mononucleotide (NMN) adenylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.78 0.732 0.01 3.3 2.6 0.31
112 d1nnla_ Phosphoserine phosphatase HAD-​like HAD-​like α/β 1.78 0.781 0.01 3.0 1.8 0.36
113 d1k1ea_ Probable phosphatase YrbI HAD-​like HAD-​like α/β 1.77 0.670 0.02 3.1 2.5 0.30
114 d1gsoa2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.77 1.805 0.04 4.2 2.9 0.28
115 d1coza_ CTP:glycerol-​3-​phosphate cytidylyltransferase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.76 1.495 0.01 4.8 3.1 0.23
116 d1dv1a2 Biotin carboxylase (BC),​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.76 1.927 0.01 4.4 3.3 0.24
117 d1meoa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 1.76 2.146 0.02 3.8 2.6 0.35
118 d1p91a_ rRNA methyltransferase RlmA S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.76 0.866 0.01 3.7 2.2 0.39
119 d1h2ea_ Broad specificity phosphatase PhoE (YhfR) Phosphoglycerate mutase-​like Phosphoglycerate mutase-​like α/β 1.75 0.613 0.10 2.8 2.2 0.32
120 d1qyra_ High level kasugamycin resistance protein KsgA S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.74 0.614 0.03 4.3 1.9 0.41
121 d1gu7a2 2,​4-​dienoyl-​CoA reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.74 0.797 0.09 3.8 2.7 0.35
122 d1h7ea_ CMP:2-​keto-​3-​deoxy-​manno-​octonic acid (CMP-​KDO)synthetase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.73 0.721 0.01 3.9 2.1 0.31
123 d1k75a_ L-​histidinol dehydrogenase HisD ALDH-​like ALDH-​like α/β 1.73 0.739 0.01 3.6 1.6 0.41
124 d1p1ca_ Guanidinoacetate methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.73 0.691 0.04 3.6 2.8 0.39
125 d1ixka_ Hypothetical methyltransferase PH1374 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.73 0.868 0.01 3.2 2.3 0.41
126 d1vh3a_ CMP:2-​keto-​3-​deoxy-​manno-​octonic acid (CMP-​KDO)synthetase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.71 0.678 0.02 2.8 2.5 0.29
127 d1cqxa3 Flavohemoglobin,​ C-​terminal domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.71 0.665 0.01 3.8 3.1 0.30
128 d1heta2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.71 0.863 0.05 4.5 3.0 0.32
129 d1i6la_ Tryptophanyl-​tRNA synthetase (TrpRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.70 0.724 0.01 3.6 1.7 0.38
130 d1kpga_ CmaA1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.70 0.866 0.05 2.8 2.6 0.40
131 d1qx4a2 cytochrome b5 reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.70 1.289 0.01 3.7 2.7 0.29
132 d1vhxa_ Hypothetical protein YrrK (RuvX) Ribonuclease H-​like Ribonuclease H-​like motif α/β 1.70 0.642 0.04 3.6 1.6 0.27
133 d1l5xa_ SurE homolog PAE2908 (SurE-​alpha) SurE-​like SurE-​like α/β 1.69 0.861 0.01 3.1 1.7 0.37
134 d1t43a_ N5-​glutamine methyltransferase,​ HemK S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.69 0.872 0.01 3.2 1.9 0.38
135 d1rjwa2 Alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.68 1.196 0.01 4.2 3.0 0.35
136 d1pjqa1 Siroheme synthase CysG,​ domain 1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.68 1.085 0.01 4.4 3.5 0.29
137 d1jyka_ CTP:phosphocholine cytidylytransferase LicC Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.68 0.841 0.01 3.0 2.4 0.33
138 d1x9ga_ Ribonuclease MAR1 Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.68 0.857 0.03 3.6 1.9 0.36
139 d1yaca_ YcaC Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.67 0.862 0.06 2.6 1.4 0.32
140 d1qama_ rRNA adenine dimethylase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.67 0.938 0.01 4.1 2.0 0.38
141 d1leha1 Leucine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.67 0.869 0.02 3.0 3.1 0.35
142 d1rqga2 Methionyl-​tRNA synthetase (MetRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.66 0.706 0.01 3.3 2.0 0.37
143 d1b8pa1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.65 1.049 0.13 3.0 3.5 0.30
144 d1a9xa3 Carbamoyl phosphate synthetase (CPS),​ large subunit PreATP-​grasp domains PreATP-​grasp domain PreATP-​grasp domain α/β 1.65 1.509 0.01 4.3 1.8 0.24
145 d1ujna_ Dehydroquinate synthase,​ DHQS Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 1.64 0.630 0.05 2.3 1.6 0.38
146 d1a8ha2 Methionyl-​tRNA synthetase (MetRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.62 0.706 0.01 3.2 2.4 0.27
147 d1cp2a_ Nitrogenase iron protein P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.61 1.085 0.01 3.7 1.8 0.38
148 d1nhpa2 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.61 1.160 0.04 3.6 2.7 0.26
149 d1o5za1 Folylpolyglutamate synthetase,​ C-​terminal domain MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.60 1.492 0.05 3.1 2.2 0.30
150 d1n8na_ Class B acid phosphatase HAD-​like HAD-​like α/β 1.60 0.860 0.01 3.2 2.3 0.38
151 d1mrza2 FMN adenylyltransferase domain of bifunctional FAD synthetase Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.60 1.149 0.01 3.3 1.9 0.32
152 d1nu0a_ Hypothetical protein YqgF (RuvX) Ribonuclease H-​like Ribonuclease H-​like motif α/β 1.59 1.052 0.03 3.3 3.0 0.25
153 d1pqwa_ Putative enoyl reductase domain of polyketide synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.58 0.987 0.02 3.8 2.8 0.36
154 d1gdha1 D-​glycerate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.57 0.865 0.01 2.6 2.9 0.33
155 d1vjra_ Hypothetical protein TM1742 HAD-​like HAD-​like α/β 1.57 0.627 0.01 2.8 2.3 0.38
156 d1t1ra2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.57 1.052 0.03 3.4 2.7 0.28
157 d1uufa2 Hypothetical protein YahK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.57 0.873 0.02 3.8 3.0 0.32
158 d1odka_ Purine nucleoside phosphorylase,​ PNP Purine and uridine phosphorylases Phosphorylase/​hydrolase-​like α/β 1.56 -1.346 0.91 3.0 1.9 0.29
159 d1pfva2 Methionyl-​tRNA synthetase (MetRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.55 0.704 0.01 3.2 2.2 0.37
160 d1ivsa4 Valyl-​tRNA synthetase (ValRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.54 0.707 0.01 3.1 0.9 0.40
161 d1jw9b_ Molybdenum cofactor biosynthesis protein MoeB Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 1.53 0.871 0.04 3.3 2.2 0.37
162 d1q1na2 Cinnamyl alcohol dehydrogenase,​ ADH6 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.52 1.325 0.01 3.6 2.9 0.35
163 d1li5a2 Cysteinyl-​tRNA synthetase (CysRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.52 0.709 0.01 3.2 1.9 0.36
164 d1lsua_ Ktn bsu222 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.52 0.867 0.10 3.3 2.7 0.29
165 d1o6za1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.52 1.088 0.10 3.7 2.7 0.31
166 d6ldha1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.52 1.436 0.05 3.5 3.5 0.28
167 d1fp1d2 Chalcone O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.51 0.665 0.01 2.8 1.9 0.38
168 d1f0ka_ Peptidoglycan biosynthesis glycosyltransferase MurG UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 1.50 0.916 0.02 4.3 2.3 0.34
169 d1li4a1 S-​adenosylhomocystein hydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.50 0.876 0.01 3.5 3.0 0.28
170 d1ngvb_ UBA3 Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 1.50 0.864 0.01 3.1 1.5 0.37
171 d1dl5a1 Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.49 0.863 0.03 2.4 2.0 0.34
172 d1psda1 Phosphoglycerate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.47 0.872 0.01 3.2 2.3 0.32
173 d1im8a_ Hypothetical protein HI0319 (YecO) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.47 1.047 0.05 2.8 1.8 0.41
174 d1vl5a_ Hypothetical protein BH2331 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.47 0.871 0.01 3.3 1.6 0.37
175 d1f14a2 Short chain L-​3-​hydroxyacyl CoA dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.47 0.872 0.09 2.6 2.3 0.33
176 d1duvg2 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.46 0.861 0.05 2.8 2.1 0.29
177 d1l7da1 Nicotinamide nucleotide transhydrogenase dI component NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.46 1.064 0.02 4.5 3.1 0.35
178 d1trba2 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.46 0.863 0.09 3.3 2.5 0.25
179 d1ufka_ Hypothetical protein TT0836 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.45 0.861 0.04 3.2 2.1 0.36
180 d1iz0a2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.45 1.083 0.02 3.8 3.0 0.33
181 d1dxya1 D-​2-​hydroxyisocaproate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.45 0.871 0.01 2.7 2.0 0.33
182 d1i1na_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.45 0.867 0.02 3.0 1.5 0.34
183 d3grsa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.45 0.867 0.02 3.1 2.2 0.25
184 d1m6ia2 Apoptosis-​inducing factor (AIF) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.45 0.868 0.02 3.7 1.6 0.28
185 d1h7wa3 Dihydropyrimidine dehydrogenase,​ domain 3 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.45 0.865 0.04 2.8 1.7 0.28
186 d1vkza2 Glycinamide ribonucleotide synthetase (GAR-​syn),​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.45 0.626 0.01 3.3 2.7 0.24
187 d1feca2 Trypanothione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.44 0.867 0.01 3.2 2.5 0.26
188 d1i36a2 Conserved hypothetical protein MTH1747 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.44 0.871 0.02 2.7 2.9 0.32
189 d1vbfa_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.43 0.866 0.01 2.8 1.8 0.33
190 d1ldna1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.42 1.361 0.06 2.9 3.1 0.29
191 d1v3ua2 Leukotriene b4 12-​hydroxydehydrogenase/​prostaglandin 15-​keto reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.42 1.605 0.03 3.6 2.6 0.34
192 d1ffya3 Isoleucyl-​tRNA synthetase (IleRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.42 0.707 0.01 3.3 1.7 0.28
193 d1id1a_ Rck domain from putative potassium channel Kch NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.42 1.347 0.08 3.6 2.9 0.31
194 d1wdka3 Fatty oxidation complex alpha subunit,​ middle domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 0.870 0.04 2.7 2.1 0.34
195 d2piaa2 Phthalate dioxygenase reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.41 0.856 0.02 3.2 2.6 0.29
196 d1hyea1 MJ0490,​ lactate/​malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 0.876 0.08 3.0 2.6 0.31
197 d1vlja_ NADH-​dependent butanol dehydrogenase A (TM0820) Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 1.41 0.730 0.06 3.6 2.1 0.39
198 d1vl8a_ Gluconate 5-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 0.871 0.11 3.3 3.5 0.43
199 d1sg6a_ Dehydroquinate synthase,​ DHQS Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 1.41 0.631 0.05 2.3 2.1 0.41
200 d1gega_ meso-​2,​3-​butanediol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 0.871 0.10 3.7 3.0 0.42
201 d1uxja1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.41 0.877 0.02 3.6 2.8 0.28
202 d1h1da_ Catechol O-​methyltransferase,​ COMT S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.40 1.130 0.02 3.5 1.5 0.38
203 d1ltqa1 Polynucleotide kinase,​ phosphatase domain HAD-​like HAD-​like α/β 1.40 1.326 0.01 3.8 2.5 0.23
204 d1qzza2 Aclacinomycin-​10-​hydroxylase RdmB S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.40 0.864 0.01 3.4 2.0 0.38
205 d1lnqa1 Potassium channel-​related protein MthK NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.40 1.480 0.02 3.3 2.0 0.32
206 d1l3ia_ Precorrin-​6Y methyltransferase (CbiT) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.40 0.861 0.02 3.2 2.8 0.32
207 d1s6ya1 6-​phospho-​beta-​glucosidase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.40 0.873 0.06 2.5 2.5 0.32
208 d1j2ra_ Hypothetical protein YecD Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.40 0.761 0.05 2.4 1.6 0.25
209 d1hv8a1 Putative DEAD box RNA helicase P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.39 0.690 0.01 2.3 1.9 0.35
210 d1gz3a1 Mitochondrial NAD(P)-​dependent malic enzyme NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.39 0.865 0.03 2.6 1.9 0.36
211 d1edza1 Methylenetetrahydrofolate dehydrogenase/​cyclohydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.39 0.871 0.01 2.2 2.1 0.33
212 d1jg1a_ Protein-​L-​isoaspartyl O-​methyltransferase S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.38 0.867 0.02 2.6 1.3 0.33
213 d1nw9b_ Caspase-​9 Caspase-​like Caspase-​like α/β 1.37 0.907 0.01 2.5 1.8 0.33
214 d1l6ra_ Hypothetical protein TA0175 HAD-​like HAD-​like α/β 1.36 0.624 0.01 2.9 1.8 0.27
215 d1bdba_ Cis-​biphenyl-​2,​3-​dihydrodiol-​2,​3-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.36 0.871 0.03 3.2 2.7 0.42
216 d1byra_ Nuclease Nuc Phospholipase D/​nuclease Phospholipase D/​nuclease α+β 1.36 0.854 0.03 2.2 2.4 0.28
217 d1mv8a3 GDP-​mannose 6-​dehydrogenase,​ GDP-​binding domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.36 0.871 0.01 2.9 2.3 0.25
218 d1dusa_ Hypothetical protein MJ0882 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.35 0.873 0.01 2.6 2.2 0.32
219 d1j3va2 Hydroxyisobutyrate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.35 0.874 0.01 2.9 3.3 0.30
220 d1jkxa_ Glycinamide ribonucleotide transformylase,​ GART Formyltransferase Formyltransferase α/β 1.35 2.048 0.01 3.8 1.6 0.36
221 d1tuga1 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.35 0.867 0.01 3.2 2.0 0.34
222 d1f7ua2 Arginyl-​tRNA synthetase (ArgRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.34 0.702 0.01 3.4 2.3 0.28
223 d1r0ka2 1-​deoxy-​D-​xylulose-​5-​phosphate reductoisomerase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.34 1.248 0.04 2.2 2.5 0.29
224 d1qsga_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.34 0.863 0.05 3.0 3.1 0.43
225 d1snya_ Carbonyl reductase sniffer NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.34 0.865 0.16 3.2 2.8 0.39
226 d1mkya1 Probable GTPase Der,​ N-​terminal and middle domains P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.33 0.618 0.01 3.2 2.8 0.26
227 d1jrla_ Thioesterase I,​ TAP SGNH hydrolase Flavodoxin-​like α/β 1.33 0.789 0.01 3.9 2.5 0.28
228 d1fl2a2 Alkyl hydroperoxide reductase subunit F (AhpF),​ C-​terminal domains FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.33 0.864 0.05 3.0 2.4 0.26
229 d1vdca2 Thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.33 0.864 0.06 3.1 2.5 0.17
230 d1b16a_ Drosophila alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.33 0.873 0.10 2.9 2.5 0.40
231 d1kjqa2 Glycinamide ribonucleotide transformylase PurT,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 1.32 1.605 0.04 2.9 3.2 0.28
232 d1xeaa1 Putative oxidoreductase VCA1048 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.32 1.491 0.01 3.3 2.3 0.34
233 d1h6va2 Mammalian thioredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.32 0.864 0.02 3.1 2.4 0.25
234 d1n5da_ Carbonyl reductase/​20beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.32 0.874 0.05 3.6 2.5 0.41
235 d1im5a_ Pyrazinamidase/​nicotinamidase Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.32 0.845 0.10 2.3 2.1 0.30
236 d1di0a_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 1.32 1.024 0.07 3.3 1.9 0.25
237 d1fmta2 Methionyl-​tRNAfmet formyltransferase Formyltransferase Formyltransferase α/β 1.31 1.003 0.02 3.9 2.5 0.35
238 d1ogca_ Ribose transport protein RbsD Ribose transport protein RbsD Ribose transport protein RbsD α/β 1.31 0.628 0.01 2.8 2.5 0.22
239 d1o54a_ Hypothetical protein TM0748 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.31 0.661 0.02 3.3 1.8 0.36
240 d1p3da1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.31 1.873 0.02 4.1 2.8 0.26
241 d1kjna_ Hypothetical protein MTH777 (MT0777) Hypothetical protein MTH777 (MT0777) Hypothetical protein MTH777 (MT0777) α/β 1.30 0.630 0.01 4.2 2.6 0.32
242 d1mv8a2 GDP-​mannose 6-​dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.30 0.873 0.01 2.9 2.4 0.34
243 d1rcua_ Hypothetical protein TM1055 Putative lysine decarboxylase Putative lysine decarboxylase α/β 1.30 0.855 0.01 2.9 2.8 0.34
244 d1hdoa_ Biliverdin IX beta reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.30 0.863 0.04 3.3 1.6 0.36
245 d1oaaa_ Sepiapterin reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.30 0.868 0.05 3.6 2.2 0.40
246 d1e7wa_ Dihydropteridin reductase (pteridine reductase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.30 0.863 0.04 3.3 2.7 0.33
247 d1k2wa_ Sorbitol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.29 0.862 0.05 2.7 3.0 0.42
248 d1lvla2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.29 0.889 0.01 3.1 2.3 0.25
249 d1ve9a1 D-​aminoacid oxidase,​ N-​terminal domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.29 0.790 0.01 2.9 1.8 0.30
250 d1v2xa_ tRNA (Gm18) methyltransferase TrmH alpha/​beta knot alpha/​beta knot α/β 1.29 0.614 0.01 2.5 2.1 0.29
251 d2uaga1 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.29 1.254 0.01 4.4 2.3 0.26
252 d1cr1a_ Gene 4 protein (g4p,​ DNA primase),​ helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.28 0.722 0.02 2.1 2.0 0.35
253 d1qo0a_ Amide receptor/​negative regulator of the amidase operon (AmiC) Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.28 0.625 0.08 3.7 2.0 0.35
254 d1gg4a1 UDP-​murNac-​tripeptide D-​alanyl-​D-​alanine-​adding enzyme MurF MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.28 0.612 0.01 2.5 3.1 0.28
255 d1i24a_ Sulfolipid biosynthesis protein SQD1 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.28 1.261 0.02 2.3 2.1 0.46
256 d1ilea3 Isoleucyl-​tRNA synthetase (IleRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.28 0.706 0.01 2.1 1.5 0.40
257 d1jtva_ Human estrogenic 17beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.863 0.08 2.6 2.3 0.42
258 d1qyca_ Phenylcoumaran benzylic ether reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.866 0.06 4.7 1.8 0.42
259 d1nxqa_ R-​specific alcohol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.764 0.05 3.3 3.0 0.41
260 d1teaa2 Hydroxyisobutyrate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.874 0.01 3.2 1.8 0.22
261 d2cmda1 Malate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.874 0.05 2.9 2.9 0.27
262 d1nqua_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 1.27 1.442 0.12 2.5 2.4 0.27
263 d1hyha1 L-​2-​hydroxyisocapronate dehydrogenase,​ L-​HICDH NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.27 0.876 0.06 2.7 2.7 0.30
264 d1kmva_ Dihydrofolate reductases,​ eukaryotic type Dihydrofolate reductases Dihydrofolate reductases α/β 1.27 0.619 0.01 1.7 1.9 0.34
265 d1q1ra2 Putidaredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.27 1.190 0.01 3.6 1.1 0.26
266 d1hrda1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.26 0.871 0.03 2.0 1.6 0.34
267 d1o5ia_ beta-​keto acyl carrier protein reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.26 0.868 0.15 2.7 3.1 0.40
268 d1m66a2 Glycerol-​3-​ phosphate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.26 1.078 0.05 2.0 2.7 0.34
269 d1gz6a_ (3R)-​hydroxyacyl-​CoA dehydrogenase domain of estradiol 17 beta-​Dehydrogenase 4 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.25 0.869 0.11 3.8 2.5 0.41
270 d1nhpa1 NADH peroxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.25 0.865 0.01 2.7 2.1 0.32
271 d2pgda2 6-​phosphogluconate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.25 0.873 0.01 2.7 2.8 0.33
272 d1ps9a3 2,​4-​dienoyl-​CoA reductase,​ middle domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.25 0.935 0.01 2.7 1.8 0.31
273 d1vhqa_ Putative sigma cross-​reacting protein 27A (SCRP-​27A,​ EllB) Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 1.25 0.860 0.02 2.5 2.0 0.34
274 d1upaa1 Carboxyethylarginine synthase DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.24 0.623 0.01 2.0 2.0 0.33
275 d1q92a_ 5'​(3'​)-​deoxyribonucleotidase (dNT-​2) HAD-​like HAD-​like α/β 1.24 0.618 0.01 1.8 1.8 0.29
276 d1vima_ Hypothetical protein AF1796 SIS domain SIS domain α/β 1.24 0.818 0.02 2.4 2.5 0.28
277 d1lssa_ Ktn Mja218 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.24 0.999 0.17 4.1 3.3 0.31
278 d1th8b_ Anti-​sigma factor antagonist SpoIIaa Anti-​sigma factor antagonist SpoIIaa SpoIIaa-​like α/β 1.23 0.753 0.08 2.6 2.8 0.24
279 d1jx6a_ Quorum-​sensing signal (autoinducer-​2) binding protein LuxP Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.23 0.618 0.10 2.3 1.8 0.29
280 d1m6ya2 TM0872,​ methyltransferase domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.23 0.861 0.01 2.9 2.4 0.24
281 d1dbqa_ Purine repressor (PurR),​ C-​terminal domain Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.23 0.621 0.05 2.8 1.7 0.32
282 d1jyea_ Lac-​repressor (lacR) core (C-​terminal domain) Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.23 1.399 0.04 3.8 1.8 0.30
283 d1jx7a_ Hypothetical protein YchN YchN-​like YchN-​like α/β 1.23 1.064 0.01 3.2 2.6 0.24
284 d1u8xx1 Maltose-​6'​-​phosphate glucosidase GlvA NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.22 0.872 0.03 2.1 1.9 0.33
285 d1jv1a_ UDP-​N-​acetylglucosamine pyrophosphorylase Nucleotide-​diphospho-​sugar transferases Nucleotide-​diphospho-​sugar transferases α/β 1.22 0.859 0.01 2.5 1.4 0.30
286 d1b74a1 Glutamate racemase Aspartate/​glutamate racemase ATC-​like α/β 1.22 1.105 0.02 3.4 2.4 0.26
287 d1kyha_ Hypothetical protein YxkO Ribokinase-​like Ribokinase-​like α/β 1.22 0.862 0.02 2.5 2.1 0.36
288 d1ej0a_ RNA methyltransferase FtsJ S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.22 0.866 0.02 2.8 2.6 0.36
289 d1onfa2 Glutathione reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.22 1.073 0.03 2.6 2.2 0.25
290 d1dlja3 UDP-​glucose dehydrogenase (UDPGDH),​ C-​terminal (UDP-​binding) domain UDP-​glucose/​GDP-​mannose dehydrogenase C-​terminal domain Adenine nucleotide alpha hydrolase-​like α/β 1.21 0.866 0.01 3.2 2.2 0.23
291 d1nf9a_ Phenazine biosynthesis protein PhzD Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.21 1.013 0.03 2.5 1.4 0.24
292 d1e19a_ Carbamate kinase Carbamate kinase-​like Carbamate kinase-​like α/β 1.21 1.211 0.01 2.2 1.4 0.37
293 d1mjfa_ Putative spermidine synthetase PF0127 (SpeE) S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.21 0.848 0.01 2.6 1.7 0.37
294 d1q1ra1 Putidaredoxin reductase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.20 0.869 0.01 2.6 2.0 0.29
295 d1q0ua_ Probable DEAD box RNA helicase YqfR P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.20 0.691 0.01 2.4 2.2 0.35
296 d1h3na3 Leucyl-​tRNA synthetase (LeuRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.20 0.721 0.01 2.8 0.9 0.30
297 d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.20 0.996 0.03 2.4 2.5 0.27
298 d1mvla_ 4'​-​phosphopantothenoylcysteine decarboxylase (PPC decarboxylase,​ halotolerance protein Hal3a) Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.19 0.992 0.12 2.2 1.9 0.34
299 d1tjya_ AI-​2 receptor LsrB Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.19 0.618 0.11 3.4 2.0 0.28
300 d1xfia_ Hypothetical protein At2g17340 Hypothetical protein At2g17340 Hypothetical protein At2g17340 multi 1.18 1.494 0.02 2.1 1.6 0.36
301 d1j6ua2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.17 0.732 0.01 2.5 1.3 0.26
302 d4cd2a_ Dihydrofolate reductases,​ eukaryotic type Dihydrofolate reductases Dihydrofolate reductases α/β 1.17 0.614 0.00 1.5 1.8 0.36
303 d1p3y1_ MrsD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.17 0.958 0.15 2.2 1.8 0.36
304 d1qora2 Quinone oxidoreductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.16 1.466 0.03 3.2 2.7 0.36
305 d1rkua_ Homoserine kinase ThrH HAD-​like HAD-​like α/β 1.16 0.617 0.08 2.7 1.8 0.29
306 d1bg6a2 N-​(1-​D-​carboxylethyl)-​L-​norvaline dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.15 0.870 0.02 2.1 2.1 0.32
307 d1ig3a2 Thiamin pyrophosphokinase,​ catalytic domain Thiamin pyrophosphokinase,​ catalytic domain Thiamin pyrophosphokinase,​ catalytic domain α/β 1.15 0.665 0.01 2.3 1.5 0.32
308 d1jfla1 Aspartate racemase Aspartate/​glutamate racemase ATC-​like α/β 1.15 1.491 0.01 2.5 2.5 0.25
309 d1i9ga_ Probable methyltransferase Rv2118c S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.15 0.691 0.01 3.2 1.7 0.33
310 d1nbaa_ N-​carbamoylsarcosine amidohydrolase Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.15 0.859 0.11 2.3 1.4 0.25
311 d1lc0a1 Biliverdin reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.15 0.614 0.01 2.3 1.8 0.34
312 d1o2da_ Alcohol dehydrogenase TM0920 Dehydroquinate synthase-​like Dehydroquinate synthase-​like multi 1.14 1.182 0.03 2.4 1.4 0.41
313 d1byka_ Trehalose repressor,​ C-​terminal domain Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.14 1.491 0.04 3.3 2.2 0.30
314 d1enya_ Enoyl-​ACP reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.14 1.099 0.03 2.5 2.7 0.34
315 d1e6ua_ GDP-​4-​keto-​6-​deoxy-​d-​mannose epimerase/​reductase (GDP-​fucose synthetase) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.14 0.863 0.02 2.8 2.1 0.38
316 d1g99a2 Acetate kinase Actin-​like ATPase domain Ribonuclease H-​like motif α/β 1.13 0.683 0.02 2.1 1.7 0.33
317 d1ngva_ Amyloid beta precursor protein-​binding protein 1,​ APPBP1 Activating enzymes of the ubiquitin-​like proteins Activating enzymes of the ubiquitin-​like proteins α/β 1.13 0.877 0.01 3.4 1.2 0.30
318 d1a4ia1 Methylenetetrahydrofolate dehydrogenase/​cyclohydrolase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.13 0.877 0.02 2.4 2.5 0.30
319 d1obba1 Alpha-​glucosidase AglA NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.13 0.872 0.01 2.3 2.2 0.32
320 d1qcza_ N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) N5-​CAIR mutase (phosphoribosylaminoimidazole carboxylase,​ PurE) Flavodoxin-​like α/β 1.13 1.494 0.03 3.4 2.0 0.25
321 d1d7ya1 NADH-​dependent ferredoxin reductase,​ BphA4 FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.13 0.867 0.02 1.9 1.9 0.31
322 d1qdea_ Initiation factor 4a P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.13 0.692 0.01 2.2 2.2 0.34
323 d1s3la_ Putative phosphodiesterase MJ0936 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 1.12 0.680 0.01 2.1 1.9 0.28
324 d1kyqa1 Bifunctional dehydrogenase/​ferrochelatase Met8p,​ N-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.12 0.868 0.01 2.1 2.2 0.30
325 d1veca_ DEAD box RNA helicase rck/​p54 P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.12 0.691 0.01 2.4 1.5 0.35
326 d1ebda2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.12 0.864 0.01 2.7 2.1 0.24
327 d1pvoa3 Transcription termination factor Rho,​ ATPase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.11 0.698 0.01 2.2 1.5 0.38
328 d1dlja2 UDP-​glucose dehydrogenase (UDPGDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.11 1.006 0.01 2.0 2.6 0.34
329 d1hnja1 Ketoacyl-​ACP synthase III (FabH) Thiolase-​like Thiolase-​like α/β 1.11 0.675 0.32 1.9 2.3 0.19
330 d1nvmb1 Acetaldehyde dehydrogenase (acylating) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.11 1.324 0.01 3.5 2.6 0.29
331 d1ejba_ Lumazine synthase Lumazine synthase Lumazine synthase α/β 1.11 1.494 0.05 2.4 2.3 0.27
332 d1c0pa1 D-​aminoacid oxidase,​ N-​terminal domain Nucleotide-​binding domain Nucleotide-​binding domain α/β 1.11 0.867 0.01 2.6 2.0 0.23
333 d1rkqa_ Hypothetical protein YidA HAD-​like HAD-​like α/β 1.11 0.855 0.01 2.7 1.2 0.35
334 d1lqta1 Ferredoxin:NADP reductase FprA FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.10 0.863 0.01 1.4 1.4 0.28
335 d1vj5a1 Epoxide hydrolase,​ N-​terminal domain HAD-​like HAD-​like α/β 1.10 0.622 0.00 2.2 2.0 0.25
336 d1j6ua1 UDP-​N-​acetylmuramate-​alanine ligase MurC MurCD N-​terminal domain MurCD N-​terminal domain α/β 1.10 1.119 0.01 3.5 2.7 0.24
337 d1q0ra_ Aclacinomycin methylesterase RdmC alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 1.10 0.618 0.09 2.1 2.6 0.35
338 d1usga_ Leucine-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.09 0.698 0.05 3.2 1.5 0.31
339 d1jfla2 Aspartate racemase Aspartate/​glutamate racemase ATC-​like α/β 1.09 1.246 0.01 2.9 2.0 0.27
340 d1te2a_ Phosphatase YniC HAD-​like HAD-​like α/β 1.09 1.491 0.01 2.5 2.0 0.34
341 d1miob_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 1.09 0.896 0.07 3.5 1.2 0.34
342 d1mjna_ Integrin CD11a/​CD18 (Leukocyte function associated antigen-​1,​ LFA-​1) vWA-​like vWA-​like α/β 1.09 0.620 0.07 2.0 1.7 0.31
343 d1ml4a2 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 1.08 0.877 0.01 2.1 1.7 0.30
344 d1ipaa1 RrmA (RrmH),​ C-​terminal domain alpha/​beta knot alpha/​beta knot α/β 1.08 0.741 0.01 2.3 2.2 0.26
345 d1qq5a_ L-​2-​Haloacid dehalogenase,​ HAD HAD-​like HAD-​like α/β 1.08 0.628 0.01 2.0 1.7 0.33
346 d1dara2 Elongation factor G (EF-​G),​ N-​terminal (G) domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.08 0.613 0.01 2.2 1.5 0.32
347 d1ff9a1 Saccharopine reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.08 0.866 0.03 2.9 2.5 0.30
348 d1tvza1 3-​hydroxy-​3-​methylglutaryl CoA synthase MvaS Thiolase-​like Thiolase-​like α/β 1.07 0.677 0.35 1.6 2.1 0.19
349 d1o14a_ Putative sugar kinase TM0828 Ribokinase-​like Ribokinase-​like α/β 1.06 0.896 0.01 2.8 2.2 0.30
350 d2naca1 Formate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.06 0.874 0.01 3.4 2.7 0.33
351 d1o1xa_ Putative sugar-​phosphate isomerase Ribose/​Galactose isomerase RpiB/​AlsB Ribose/​Galactose isomerase RpiB/​AlsB α/β 1.06 1.491 0.02 1.7 2.1 0.27
352 d2uaga2 UDP-​N-​acetylmuramoyl-​L-​alanine:D-​glutamate ligase MurD MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 1.06 0.690 0.01 2.0 1.9 0.27
353 d1vl0a_ DTDP-​4-​dehydrorhamnose reductase RfbD NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.06 0.745 0.01 2.3 2.3 0.38
354 d1iq0a2 Arginyl-​tRNA synthetase (ArgRS) Nucleotidylyl transferase Adenine nucleotide alpha hydrolase-​like α/β 1.05 0.705 0.01 1.4 1.4 0.36
355 d1drka_ D-​ribose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 1.05 1.405 0.11 2.8 2.4 0.28
356 d1b93a_ Methylglyoxal synthase,​ MgsA Methylglyoxal synthase-​like Methylglyoxal synthase-​like α/β 1.05 0.755 0.02 2.7 1.8 0.25
357 d1t2da1 Lactate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.05 0.874 0.06 2.7 2.5 0.19
358 d1shux_ Capillary morphogenesis protein 2 domain vWA-​like vWA-​like α/β 1.04 0.697 0.03 2.3 2.0 0.31
359 d1d4oa_ Transhydrogenase domain III (dIII) DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.04 0.616 0.01 2.6 2.2 0.33
360 d1upaa3 Carboxyethylarginine synthase Thiamin diphosphate-​binding fold (THDP-​binding) Thiamin diphosphate-​binding fold (THDP-​binding) α/β 1.04 0.660 0.02 1.9 1.7 0.35
361 d1o94a2 Trimethylamine dehydrogenase,​ C-​terminal domain FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.04 0.678 0.02 1.8 2.1 0.26
362 d1ad3a_ Aldehyde reductase (dehydrogenase),​ ALDH ALDH-​like ALDH-​like α/β 1.04 0.697 0.01 2.5 1.5 0.40
363 d1qv9a_ F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) F420-​dependent methylenetetrahydromethanopterin dehydrogenase (MTD) α/β 1.04 0.681 0.01 2.8 2.4 0.29
364 d1tqha_ Carboxylesterase alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 1.04 0.855 0.01 3.0 2.9 0.31
365 d1l5ja3 Aconitase B,​ C-​terminal domain Aconitase iron-​sulfur domain Aconitase iron-​sulfur domain α/β 1.04 0.629 0.01 2.2 0.7 0.31
366 d1mf7a_ Integrin alpha M (CR3,​ CD11b/​CD18,​ Mac-​1 alpha subunit) vWA-​like vWA-​like α/β 1.04 0.658 0.10 2.3 1.6 0.31
367 d1v93a_ Methylenetetrahydrofolate reductase FAD-​linked oxidoreductase TIM beta/​alpha-​barrel α/β 1.03 -1.084 0.92 2.8 2.1 0.33
368 d1r5ja_ Putative phosphotransacetylase SPy1128 Isocitrate/​Isopropylmalate dehydrogenase-​like Isocitrate/​Isopropylmalate dehydrogenase-​like α/β 1.03 0.703 0.02 2.4 1.6 0.36
369 d1cz3a_ Dihydrofolate reductase,​ prokaryotic type Dihydrofolate reductases Dihydrofolate reductases α/β 1.03 0.615 0.01 1.4 2.0 0.29
370 d1sqga2 Ribosomal RNA small subunit methyltransferase B,​ RsmB (Sun,​ Fmu/​Fmv),​ C-​terminal domain S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 1.03 0.870 0.01 2.2 1.8 0.27
371 d1kl7a_ Threonine synthase Tryptophan synthase beta subunit-​like PLP-​dependent enzymes Tryptophan synthase beta subunit-​like PLP-​dependent enzymes α/β 1.03 0.721 0.05 3.3 2.1 0.44
372 d1bmta2 Methionine synthase,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 1.03 1.377 0.05 2.2 1.4 0.30
373 d1a9xa2 Carbamoyl phosphate synthetase,​ large subunit allosteric,​ C-​terminal domain Methylglyoxal synthase-​like Methylglyoxal synthase-​like α/β 1.02 1.432 0.04 2.3 2.3 0.23
374 d1fpza_ Kinase associated phosphatase (kap) (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.02 0.620 0.03 1.4 1.9 0.27
375 d1spxa_ Glucose dehydrogenase (5l265) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.02 0.863 0.03 3.1 2.6 0.39
376 d1pfka_ ATP-​dependent phosphofructokinase Phosphofructokinase Phosphofructokinase α/β 1.02 1.494 0.04 2.1 1.0 0.36
377 d1g5qa_ Epidermin modifying enzyme (peptidyl-​cysteine decarboxylase) EpiD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD Homo-​oligomeric flavin-​containing Cys decarboxylases,​ HFCD α/β 1.01 0.859 0.11 2.0 1.6 0.27
378 d1k68a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 1.01 0.740 0.01 2.7 2.3 0.25
379 d1jsca1 Acetohydroxyacid synthase catalytic subunit DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 1.01 0.628 0.01 1.7 1.5 0.31
380 d1vi9a_ Pyridoxamine kinase Ribokinase-​like Ribokinase-​like α/β 1.01 0.617 0.02 2.3 2.3 0.29
381 d1db3a_ GDP-​mannose 4,​6-​dehydratase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 0.762 0.07 2.3 2.7 0.38
382 d1vh0a_ Hypothetical protein SAV0024/​SA0023 alpha/​beta knot alpha/​beta knot α/β 1.00 0.780 0.01 2.1 1.6 0.28
383 d1q7ca_ beta-​keto acyl carrier protein reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 0.872 0.03 2.9 2.5 0.41
384 d1px0a_ Halohydrin dehalogenase HheC NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.00 0.864 0.03 2.6 2.3 0.40
385 d7reqa2 Methylmalonyl-​CoA mutase alpha subunit,​ C-​terminal domain Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 1.00 0.802 0.09 2.4 1.9 0.27
386 d1a4ia2 Tetrahydrofolate dehydrogenase/​cyclohydrolase Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 1.00 1.491 0.04 2.8 2.4 0.22
387 d1mo9a2 NADH-​dependent 2-​ketopropyl coenzyme M oxidoreductase/​carboxylase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 1.00 0.680 0.03 2.3 0.8 0.24
388 d1zrna_ L-​2-​Haloacid dehalogenase,​ HAD HAD-​like HAD-​like α/β 0.99 0.626 0.01 2.6 0.7 0.34
389 d1ks9a2 Ketopantoate reductase PanE NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.98 0.868 0.01 1.8 1.7 0.31
390 d1gtma1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.98 0.872 0.03 1.8 1.3 0.35
391 d1e5da1 Rubredoxin oxygen:oxidoreductase (ROO),​ C-​terminal domain Flavoproteins Flavodoxin-​like α/β 0.98 0.862 0.05 2.5 2.9 0.27
392 d1ojta2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.98 0.864 0.02 2.0 1.2 0.25
393 d1uk8a_ Meta-​cleavage product hydrolase CumD alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.97 0.605 0.02 1.8 2.8 0.36
394 d3lada2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.96 0.865 0.02 2.4 0.8 0.25
395 d1pyo.1 Caspase-​2 Caspase-​like Caspase-​like α/β 0.96 0.645 0.01 2.5 1.5 0.32
396 d3lada1 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.96 0.863 0.04 2.5 0.7 0.31
397 d1jeha2 Dihydrolipoamide dehydrogenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.96 1.006 0.02 2.6 1.1 0.25
398 d1guda_ D-​allose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.96 0.619 0.16 3.3 2.0 0.30
399 d1ta0a_ Carboxy-​terminal domain RNA polymerase II polypeptide A small phosphatase 1,​ NRAMP1 HAD-​like HAD-​like α/β 0.95 0.628 0.01 2.0 1.3 0.31
400 d1js1x2 Transcarbamylase-​like protein Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.94 0.864 0.01 2.3 1.8 0.29
401 d1hxha_ 3beta/​17beta hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.94 0.873 0.08 3.0 1.4 0.41
402 d1m2ka_ AF1676,​ Sir2 homolog (Sir2-​AF1?) DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.94 0.863 0.01 2.1 1.7 0.26
403 d1o20a_ Gamma-​glutamyl phosphate reductase ALDH-​like ALDH-​like α/β 0.93 0.693 0.02 3.4 1.4 0.41
404 d1uxna_ Non-​phosphorylating glyceraldehyde-​3-​phosphate dehydrogenase GapN ALDH-​like ALDH-​like α/β 0.93 0.698 0.01 2.8 1.0 0.41
405 d1uwka_ Urocanate hydratase HutU Urocanase (Pfam 01175) Urocanase (Pfam 01175) multi 0.93 0.784 0.01 3.8 2.0 0.42
406 d1hdca_ 3-​alpha,​20-​beta-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.93 0.864 0.08 4.5 2.4 0.43
407 d1ps9a2 2,​4-​dienoyl-​CoA reductase,​ C-​terminal domain FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.93 0.868 0.01 2.5 0.9 0.24
408 d1tlta1 Virulence factor MviM NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.93 0.870 0.02 2.0 2.7 0.34
409 d1ccwa_ Glutamate mutase,​ small subunit Cobalamin (vitamin B12)-​binding domain Flavodoxin-​like α/β 0.92 1.578 0.05 2.6 1.8 0.25
410 d1sqsa_ Hypothetical protein SP1951 Flavoproteins Flavodoxin-​like α/β 0.92 0.759 0.01 1.8 2.4 0.29
411 d1pswa_ ADP-​heptose LPS heptosyltransferase II UDP-​Glycosyltransferase/​glycogen phosphorylase UDP-​Glycosyltransferase/​glycogen phosphorylase α/β 0.92 0.612 0.01 2.7 1.6 0.28
412 d1o7ja_ Asparaginase type II Glutaminase/​Asparaginase Glutaminase/​Asparaginase α/β 0.92 1.131 0.03 3.0 1.3 0.24
413 d1hwxa1 Glutamate dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.91 0.869 0.02 1.8 1.8 0.35
414 d1uuya_ Plant CNX1 G domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.91 0.743 0.01 2.1 2.0 0.27
415 d1ijba_ von Willebrand factor A1 domain,​ vWA1 vWA-​like vWA-​like α/β 0.91 1.040 0.05 2.1 1.9 0.30
416 d1gcaa_ Galactose/​glucose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.91 0.900 0.08 2.2 1.7 0.31
417 d1m1nb_ Nitrogenase iron-​molybdenum protein,​ beta chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 0.91 0.853 0.04 3.7 1.2 0.33
418 d1c4xa_ 2-​hydroxy-​6-​oxo-​6-​phenylhexa-​2,​4-​dienoate hydrolase (BPHD) alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.91 0.617 0.02 1.6 2.6 0.35
419 d1to6a_ Glycerate kinase GlxK Glycerate kinase I (Pfam 02595) Glycerate kinase I (Pfam 02595) α/β 0.90 1.418 0.03 2.4 1.0 0.32
420 d1poxa1 Pyruvate oxidase DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.90 0.622 0.01 1.3 1.8 0.31
421 d1eucb1 Succinyl-​CoA synthetase,​ beta-​chain,​ C-​terminal domain Succinyl-​CoA synthetase domains Flavodoxin-​like α/β 0.89 1.090 0.37 2.1 1.3 0.28
422 d1vj5a2 Mammalian epoxide hydrolase,​ C-​terminal domain alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.89 0.614 0.02 1.7 1.5 0.34
423 d1euha_ Aldehyde reductase (dehydrogenase),​ ALDH ALDH-​like ALDH-​like α/β 0.89 0.695 0.01 2.4 1.2 0.40
424 d1ja9a_ 1,​3,​6,​8-​tetrahydroxynaphthalene reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.89 0.870 0.10 4.5 2.7 0.41
425 d1uzba_ 1-​pyrroline-​5-​carboxylate dehydrogenase ALDH-​like ALDH-​like α/β 0.88 0.697 0.01 2.7 0.8 0.41
426 d1a2oa1 Methylesterase CheB,​ N-​terminal domain CheY-​like Flavodoxin-​like α/β 0.88 0.626 0.01 2.8 1.8 0.25
427 d1sc3.1 Interleukin-​1beta converting enzyme (a cysteine protease) Caspase-​like Caspase-​like α/β 0.88 0.952 0.01 1.7 1.6 0.31
428 d1kbza_ dTDP-​6-​deoxy-​L-​lyxo-​4-​hexulose reductase (RmlD) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.88 0.748 0.01 1.9 1.8 0.39
429 d1otha2 Ornithine transcarbamoylase Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.88 0.867 0.02 1.7 2.2 0.30
430 d1h5qa_ Mannitol dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.87 0.863 0.08 4.0 3.1 0.42
431 d2ptha_ Peptidyl-​tRNA hydrolase Peptidyl-​tRNA hydrolase-​like Phosphorylase/​hydrolase-​like α/β 0.87 0.621 0.01 1.8 2.2 0.27
432 d1q9ia2 Flavocytochrome c3 (respiratory fumarate reductase) FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.86 0.863 0.01 1.6 1.5 0.26
433 d1ii7a_ Mre11 Metallo-​dependent phosphatases Metallo-​dependent phosphatases α+β 0.86 0.678 0.01 1.4 1.1 0.36
434 d1j8fa_ Sirt2 histone deacetylase DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.86 0.618 0.01 2.2 1.0 0.25
435 d1twda_ Copper homeostasis protein CutC CutC-​like (Pfam 03932) TIM beta/​alpha-​barrel α/β 0.86 -1.214 0.94 2.3 1.8 0.27
436 d2dapa1 Diaminopimelic acid dehydrogenase (DAPDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.86 0.863 0.01 2.1 2.5 0.26
437 d1di6a_ MogA Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.85 1.166 0.01 1.8 1.7 0.29
438 d1ez0a_ Aldehyde reductase (dehydrogenase),​ ALDH ALDH-​like ALDH-​like α/β 0.85 0.698 0.01 3.0 1.3 0.40
439 d1su4a2 Calcium ATPase,​ catalytic domain P HAD-​like HAD-​like α/β 0.85 0.628 0.02 0.7 2.9 0.32
440 d1ou0a_ Precorrin-​8x methylmutase related protein Precorrin-​8X methylmutase CbiC/​CobH Flavodoxin-​like α/β 0.84 0.618 0.01 1.5 2.1 0.31
441 d1a4ma_ Adenosine deaminase (ADA) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 0.83 -0.704 0.92 2.2 1.5 0.32
442 d1iuka_ Hypothetical protein TT1466 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.82 0.868 0.01 2.1 1.9 0.27
443 d1r8sa_ ADP-​ribosylation factor P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 0.82 0.614 0.01 2.7 1.7 0.28
444 d1rqla_ Phosphonoacetaldehyde hydrolase HAD-​like HAD-​like α/β 0.82 0.626 0.01 2.0 1.4 0.34
445 d1mb3a_ Cell division response regulator DivK CheY-​like Flavodoxin-​like α/β 0.82 0.625 0.01 2.2 2.1 0.23
446 d1jwqa_ N-​acetylmuramoyl-​L-​alanine amidase CwlV Zn-​dependent exopeptidases Phosphorylase/​hydrolase-​like α/β 0.82 1.491 0.04 1.9 1.8 0.26
447 d1xcba2 Transcriptional repressor Rex,​ C-​terminal domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.81 0.713 0.01 2.3 1.6 0.28
448 d1cyda_ Carbonyl reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.81 0.866 0.03 4.6 1.9 0.42
449 d1i0da_ Phosphotriesterase (parathion hydrolase,​ PTE) Metallo-​dependent hydrolases TIM beta/​alpha-​barrel α/β 0.81 -0.708 0.94 2.6 2.2 0.34
450 d1o4ua1 Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain Quinolinic acid phosphoribosyltransferase (Nicotinate-​nucleotide pyrophosphorylase,​ NadC),​ C-​terminal domain TIM beta/​alpha-​barrel α/β 0.81 0.721 0.14 2.3 1.3 0.24
451 d1ryba_ Chloroplast group II intron splicing factor Crs2 Peptidyl-​tRNA hydrolase-​like Phosphorylase/​hydrolase-​like α/β 0.81 0.618 0.01 2.0 1.8 0.28
452 d1ebfa1 Homoserine dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.80 0.730 0.01 1.7 1.7 0.31
453 d1fmca_ 7-​alpha-​hydroxysteroid dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.80 0.872 0.09 4.3 2.3 0.42
454 d1vkya_ Queuosine biosynthesis protein queA QueA-​like (Pfam 02547) QueA-​like (Pfam 02547) multi 0.80 0.773 0.01 1.6 1.0 0.26
455 d1t3ea3 Gephyrin,​ domain 5 Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.79 0.675 0.04 1.8 2.0 0.25
456 d1nrza_ Sorbose permease subunit IIb ,​ EIIb-​sor PTS IIb component PTS IIb component α/β 0.79 0.643 0.02 1.1 1.3 0.36
457 d1jaxa_ Coenzyme F420H2:NADP+ oxidoreductase (FNO) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.78 0.874 0.01 2.4 2.7 0.34
458 d1ny5a1 Transcriptional activator sigm54 (NtrC1),​ N-​terminal domain CheY-​like Flavodoxin-​like α/β 0.78 0.621 0.01 2.4 1.8 0.24
459 d1k66a_ Response regulator for cyanobacterial phytochrome CheY-​like Flavodoxin-​like α/β 0.77 0.619 0.01 2.4 1.8 0.23
460 d1u0ta_ Inorganic polyphosphate/​ATP-​NAD kinase PpnK NAD kinase (Pfam 01513) NAD kinase (Pfam 01513) multi 0.77 0.710 0.01 2.1 1.5 0.21
461 d1nzya_ 4-​Chlorobenzoyl-​CoA dehalogenase ClpP/​crotonase ClpP/​crotonase α/β 0.77 0.670 0.01 1.5 1.5 0.25
462 d1nf2a_ Hypothetical protein TM0651 HAD-​like HAD-​like α/β 0.76 0.625 0.01 2.4 1.3 0.32
463 d1i7qb_ Anthranilate synthase GAT subunit,​ TrpG Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.76 0.719 0.01 2.7 0.9 0.29
464 d1elua_ Cystine C-​S lyase C-​des PLP-​dependent transferases PLP-​dependent transferases α/β 0.76 0.841 0.02 1.1 1.7 0.34
465 d1uz5a3 MoeA,​ central domain Molybdenum cofactor biosynthesis proteins Molybdenum cofactor biosynthesis proteins α/β 0.75 0.738 0.07 2.0 2.2 0.24
466 d1o08a_ beta-​Phosphoglucomutase HAD-​like HAD-​like α/β 0.75 1.051 0.01 2.0 1.4 0.27
467 d1ozha1 Catabolic acetolactate synthase DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.74 0.623 0.02 1.3 1.6 0.32
468 d1v16b2 Branched-​chain alpha-​keto acid dehydrogenase TK C-​terminal domain-​like TK C-​terminal domain-​like α/β 0.73 0.619 0.03 2.1 2.2 0.24
469 d1ub7a2 Ketoacyl-​ACP synthase III (FabH) Thiolase-​like Thiolase-​like α/β 0.72 0.719 0.01 1.5 1.6 0.19
470 d1iowa1 D-​Ala-​D-​Ala ligase,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.72 1.461 0.02 2.0 1.5 0.21
471 d1j1ia_ Meta cleavage compound hydrolase CarC alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.71 0.613 0.03 2.0 1.1 0.31
472 d1hzpa2 Ketoacyl-​ACP synthase III (FabH) Thiolase-​like Thiolase-​like α/β 0.71 0.713 0.01 1.3 2.1 0.24
473 d1o04a_ Aldehyde reductase (dehydrogenase),​ ALDH ALDH-​like ALDH-​like α/β 0.70 0.700 0.00 2.3 1.0 0.41
474 d1hnja2 Ketoacyl-​ACP synthase III (FabH) Thiolase-​like Thiolase-​like α/β 0.70 0.720 0.01 1.7 2.0 0.25
475 d1uara1 Sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 0.70 0.703 0.02 1.1 1.3 0.24
476 d1oi7a1 Succinyl-​CoA synthetase,​ alpha-​chain,​ N-​terminal (CoA-​binding) domain NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.70 0.714 0.03 2.0 1.8 0.19
477 d1chua2 L-​aspartate oxidase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.69 0.822 0.01 2.0 0.6 0.23
478 d1g2ia_ Intracellular protease Class I glutamine amidotransferase-​like Flavodoxin-​like α/β 0.69 0.863 0.02 1.9 1.3 0.28
479 d1j5pa4 Hypothetical protein TM1643 NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.68 0.776 0.02 1.9 1.8 0.28
480 d1f2va_ Precorrin-​8x methylmutase Precorrin-​8X methylmutase CbiC/​CobH Flavodoxin-​like α/β 0.67 0.613 0.01 1.4 1.5 0.33
481 d1a9xa1 Carbamoyl phosphate synthetase,​ large subunit connection domain Carbamoyl phosphate synthetase,​ large subunit connection domain Carbamoyl phosphate synthetase,​ large subunit connection domain All α 0.67 0.803 0.03 3.0 1.0 0.24
482 d1gr0a1 Myo-​inositol 1-​phosphate synthase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.66 0.733 0.01 1.3 1.9 0.35
483 d1xyza_ Xylanase (Trans)glycosidases TIM beta/​alpha-​barrel α/β 0.65 -1.235 0.90 1.6 1.6 0.35
484 d1vl6a2 Malate oxidoreductase (malic enzyme) Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 0.65 0.736 0.01 2.2 1.9 0.14
485 d1u02a_ Trehalose-​6-​phosphate phosphatase related protein HAD-​like HAD-​like α/β 0.63 0.626 0.00 1.7 1.3 0.28
486 d1s5pa_ NAD-​dependent deacetylase CobB DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.62 0.619 0.01 2.3 1.7 0.28
487 d1qyia_ Hypothetical protein MW1667 (SA1546) HAD-​like HAD-​like α/β 0.62 0.625 0.01 1.7 0.8 0.34
488 d1p9la1 Dihydrodipicolinate reductase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.61 0.620 0.02 1.7 2.6 0.23
489 d1m1na_ Nitrogenase iron-​molybdenum protein,​ alpha chain ​(​Helical backbone​(​ metal receptor Chelatase-​like α/β 0.59 0.666 0.05 1.8 1.5 0.33
490 d1w4xa2 Phenylacetone monooxygenase FAD/​NAD(P)-​binding domain FAD/​NAD(P)-​binding domain α/β 0.59 0.866 0.01 2.2 0.6 0.25
491 d1ehia1 D-​alanine:D-​lactate ligase VanA,​ N-​domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.58 0.797 0.01 1.8 0.8 0.27
492 d1jkea_ D-​Tyr tRNAtyr deacylase,​ DTD DTD-​like (Pfam 02580) DTD-​like (Pfam 02580) α/β 0.52 1.018 0.01 1.4 1.1 0.24
493 d2at2a2 Aspartate carbamoyltransferase catalytic subunit Aspartate/​ornithine carbamoyltransferase ATC-​like α/β 0.50 0.865 0.01 0.7 1.3 0.28
494 d1obfo1 Glyceraldehyde-​3-​phosphate dehydrogenase (GAPDH) NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.48 0.864 0.01 1.7 1.7 0.29
495 d1o13a_ Hypothetical protein TM1816 Nitrogenase accessory factor-​like Ribonuclease H-​like motif α/β 0.44 0.859 0.01 1.7 1.5 0.20
496 d1nrwa_ Hypothetical protein YwpJ HAD-​like HAD-​like α/β 0.42 0.625 0.01 1.0 0.9 0.34
497 d1psda2 Phosphoglycerate dehydrogenase Formate/​glycerate dehydrogenase catalytic domain-​like Flavodoxin-​like α/β 0.42 0.753 0.01 1.2 1.9 0.23
498 d1m22a_ Peptide amidase Pam Amidase signature (AS) enzymes Amidase signature (AS) enzymes α/β 0.39 0.601 0.02 0.2 0.7 0.31
499 d1b00a_ PhoB receiver domain CheY-​like Flavodoxin-​like α/β 0.39 0.621 0.01 1.7 2.2 0.23
500 d1gsaa1 Prokaryotic glutathione synthetase,​ N-​terminal domain PreATP-​grasp domain PreATP-​grasp domain α/β 0.39 0.765 0.02 1.3 2.0 0.20
501 d1eo1a_ Hypothetical protein MTH1175 Nitrogenase accessory factor-​like Ribonuclease H-​like motif α/β 0.37 0.707 0.02 1.4 1.4 0.16
502 d1s8na_ Probable two-​component system transcriptional regulator Rv1626 CheY-​like Flavodoxin-​like α/β 0.32 1.251 0.01 2.2 1.6 0.26
503 d1etxa_ FIS protein Homeodomain-​like DNA/​RNA-​binding 3-​helical bundle All α 0.25 0.814 0.01 1.5 0.7 0.16
504 d1vkna1 N-​acetyl-​gamma-​glutamyl-​phosphate reductase ArgC NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 0.23 0.872 0.01 0.8 1.7 0.32
505 d1ui0a_ Thermophilic uracil-​DNA glycosylase DNA glycosylase DNA glycosylase α/β 0.23 0.623 0.01 0.6 1.4 0.25
506 d1vkea_ Hypothetical protein TM1620 AhpD-​like AhpD-​like All α 0.17 0.811 0.01 2.0 2.2 0.17
507 d1gv2a2 c-​Myb,​ DNA-​binding domain Homeodomain-​like DNA/​RNA-​binding 3-​helical bundle All α 0.11 0.814 0.01 2.2 0.13
508 d1biaa1 Biotin repressor,​ N-​terminal domain "​Winged helix"​ DNA-​binding domain DNA/​RNA-​binding 3-​helical bundle All α -0.00 0.723 0.01 2.5 1.1 0.15
509 d1g2ha_ Transcriptional regulator TyrR,​ C-​terminal domain Homeodomain-​like DNA/​RNA-​binding 3-​helical bundle All α -0.20 0.813 0.02 1.0 0.9 0.13
SCOP domains with score worse than the threshold
510 d1nmoa_ Hypothetical protein YbgI NIF3 (NGG1p interacting factor 3)-​like NIF3 (NGG1p interacting factor 3)-​like α/β 2.00 -1.493 0.01 3.3 2.5 0.30
511 d1ihua1 Arsenite-​translocating ATPase ArsA P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.98 -1.143 0.03 2.9 2.7 0.42
512 d1poib_ Glutaconate:CoA transferase beta NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.98 -1.042 0.01 2.7 1.8 0.40
513 d1okkd2 GTPase domain of the signal recognition particle receptor FtsY P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.97 -1.311 0.05 3.9 2.9 0.39
514 d1t5oa_ Putative eIF-​2B delta-​subunit NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.96 0.459 0.06 4.8 2.6 0.45
515 d1e58a_ Phosphoglycerate mutase Phosphoglycerate mutase-​like Phosphoglycerate mutase-​like α/β 1.92 -0.687 0.03 2.3 2.3 0.33
516 d1kola2 Formaldehyde dehydrogenase NAD(P)-​binding Rossmann-​fold domains NAD(P)-​binding Rossmann-​fold domains α/β 1.90 -1.018 0.04 4.1 2.6 0.38
517 d1k6da_ Acetate:CoA transferase alpha NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 1.87 -0.701 0.03 3.1 1.4 0.39
518 d1rxya_ Uridine phosphorylase Purine and uridine phosphorylases Phosphorylase/​hydrolase-​like α/β 1.87 -1.264 0.03 3.4 3.0 0.29
519 d1xo1a2 T5 5'​-​exonuclease PIN domain-​like PIN domain-​like α/β 1.87 -1.184 0.01 4.2 2.5 0.26


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1kqpa_ NH3-​dependent NAD+-​synthetase (hh: 1.000)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.76  Contact: 2410
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.22 AHM:0.28 LBcontacta:1.00 LBcontactb:1.00 LHM:0.17
id:1.00 blosum:1.00 compass:1.00 pearson:1.00
Scaled scores:
dali:0.86 daliz:0.72 gdtts:0.81 tmscore:0.92 rmsd:0.91 AHM:0.82 LBcontacta:0.60 LBcontactb:0.73 LHM:0.50
id:0.19 blosum:0.26 compass:0.74 pearson:0.64

hit structure      alignment
DALI alignment (Z-score: 22.6 Raw score:2213.70)
Query          1 ---------------dADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD     45
d1kqpa_        1 smqekimrelhvkpsiDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQL     60

Query         46 ALG-------aqNVYGVSMPSKySSDHsKGDAAELARRTGL-NFRTVSIEPMFDAYMASL     97
d1kqpa_       61 AVEsireeggdaQFIAVRLPHG-TQQD-EDDAQLALKFIKPdKSWKFDIKSTVSAFSDQY    118

Query         98 ------GLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTlyGDSVGAY    151
d1kqpa_      119 qqetgdQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTkyGDGGADL    178

Query        152 GPIKDVYKTSIFRLAEWRNraaaergqtppIPEASITK--------------------PD    191
d1kqpa_      179 LPLTGLTKRQGRTLLKELG-----------APERLYLKeptadlldekpqqsdetelgIS    227

Query        192 YPVLDAILELyvdrdtgadaivaaGYDRELVVKTLRMVDTAEYKRRQyppgtkisakgfg    251
d1kqpa_      228 YDEIDDYLEG-------------kEVSAKVSEALEKRYSMTEHKRQV------------p    262

Query        252 kdrrlPITNrwregh    266
d1kqpa_      263 asmfdDWWK------    271


hit structure      alignment
FAST alignment (Normalized score: 16.90 Raw score:4537.00)
Query          1 D----------------ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIAC     44
d1kqpa_        1 -SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQ     59

Query         45 DALGAQ-----------NVYGVSMPSKYSSDH-SKGDAAELARRTG-LNFRTVSIEPMFD     91
d1kqpa_       60 LA----VESIREEGGDAQFIAVRLPHGTQ---QDEDDAQLALKFIKPDKSWKFDIKSTVS    112

Query         92 AYMAS------LGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLY-    144
d1kqpa_      113 AFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTG-----F    167

Query        145 ----GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTP-PIPEASITK----------    189
d1kqpa_      168 FTKYGDGGADLLPLTGLTKRQGRTLLKE------------LGAPERLYL-KEPTADLLDE    214

Query        190 -----------PDYPVLDAILELYVDRDTGADAIVA--AGYDRELVVKTLRMVDTAEYKR    236
d1kqpa_      215 KPQQSDETELGISYDEIDDYL---------------EGKEVSAKVSEALEKRYSMTEHKR    259

Query        237 RQYPPGTKISAKGFGKDRRLPITNRWREGH------------    266
d1kqpa_      260 ------------------------------QVPASMFDDWWK    271


hit structure      alignment
TMalign alignment (TM-score: 0.75 Raw score:199.93)
Query          1 ---------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD     45
d1kqpa_        1 SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQL     60

Query         46 ALGA-------QNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMASL     97
d1kqpa_       61 AVESIREEGGDAQFIAVRLPHGTQQ-D-EDDAQLALKFIKPDKSWKFDIKSTVSAFSDQY    118

Query         98 ------GLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAY    151
d1kqpa_      119 QQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADL    178

Query        152 GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK--------------------PD    191
d1kqpa_      179 LPLTGLTKRQGRTLLKELG-----------APERLYLKEPTADLLDEKPQQSDETELGIS    227

Query        192 YPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQY----PPGTKISA    247
d1kqpa_      228 YDEIDDYLEG----------K--E-VSAKVSEALEKRYSMTEHKRQVPASMF--------    266

Query        248 KGFGKDRRLPITNRWREGH    266
d1kqpa_      267 -------DDWWK-------    271


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ...... *****************************************            
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGV-----     55
d1kqpa_       17 DPKQEI-EDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFI     75

DALI match       ..... .... *************... ***************        *********
Query         56 SMPSKYSSDHSKGDAAELARRTGLNFR-TVSIEPMFDAYMASLGL------TGLAEENLQ    108
d1kqpa_       76 AVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVK    135

DALI match       **********************************  ************************
Query        109 SRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEW    168
d1kqpa_      136 ARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKE    195

DALI match       **                            ***********               ****
Query        169 RN--RAAAERGQTPPIPEASITK-------PDYPVLDAILELYVDRDTGADAIVAAGYDR    219
d1kqpa_      196 LGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLE-------------GKEVSA    242

DALI match       ***************** .                 
Query        220 ELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRR    255
d1kqpa_      243 KVSEALEKRYSMTEHKR-QVPASM------FDDWWK    271



top
2: d1gpma1 GMP synthetase,​ central domain (hh: 1.000)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.91  Contact: 1648
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.33 LBcontacta:1.00 LBcontactb:0.99 LHM:0.13
id:1.00 blosum:0.98 compass:0.94 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.58 gdtts:0.60 tmscore:0.77 rmsd:0.85 AHM:0.75 LBcontacta:0.53 LBcontactb:0.67 LHM:0.52
id:0.11 blosum:0.20 compass:0.41 pearson:0.39

hit structure      alignment
DALI alignment (Z-score: 17.0 Raw score:1273.10)
Query          1 DADEEVYSALVVGLRAYVAkngFRSVLIGLSGGIDSALVAAIACDALGaQNVYGVSMPSK     60
d1gpma1        1 WTPAKIIDDAVARIREQVG---DDKVILGLSGGVDSSVTAMLLHRAIG-KNLTCVFVDNG     56

Query         61 YSSDHSKGDAA-ELARRTGLNFRTVSIEPMFDAYMAsLGLTGLAEENLQSRLRGTTLMAI    119
d1gpma1       57 LLRLNEAEQVLdMFGDHFGLNIVHVPAEDRFLSALA-GENDPEAKRKIIGRVFVEVFDEE    115

Query        120 SNQE--GHIVLAPGNKSELAVGystlygdsvgAYGPIKDVYKTSIFRLAEWRNraaaerg    177
d1gpma1      116 ALKLedVKWLAQGTIYPDVIES-----aakmgLVEPLKELFKDEVRKIGLELG-------    163

Query        178 qtppIPEASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrr    237
d1gpma1      164 ----LPYDMLYR------------------------------------------------    171

Query        238 qyppgtkisakgfgkdrrlpitnrwregh    266
d1gpma1      172 -------------------------hpfp    175


hit structure      alignment
FAST alignment (Normalized score: 13.11 Raw score:2830.00)
Query          1 DADEEVYSALVVGLRAYVAKNGF---RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSM     57
d1gpma1        1 WTPAKIIDDAVARIREQ------VGDDKVILGLSGGVDSSVTAMLLHRA-IGKNLTCVFV     53

Query         58 PSKYSSDHSKGDAA-ELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTL    116
d1gpma1       54 DNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGE-NDPEAKRKIIGRVFVEVF    112

Query        117 MAISNQEG----HIVLAPGNKSELAVGYSTLYGDSVG-------AYGPIKDVYKTSIFRL    165
d1gpma1      113 DEEALK--LEDVKWLAQGTIYPDVI------------ESAAKMGLVEPLKELFKDEVRKI    158

Query        166 AEWRNRAAAERGQTP-PIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVK    224
d1gpma1      159 GLE------------LGLPYDMLY------------------------------------    170

Query        225 TLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-----    266
d1gpma1      171 ------------------------------------------RHPFP    175


hit structure      alignment
TMalign alignment (TM-score: 0.53 Raw score:140.98)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1gpma1        1 WTPAKIIDDAVARIREQVG--DD-KVILGLSGGVDSSVTAMLLHRAIG-KNLTCVFVDNG     56

Query         61 YSSDHSKGDAA-ELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAI    119
d1gpma1       57 LLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALA-GENDPEAKRKIIGRVFVEVFDEE    115

Query        120 SNQEG-H-IVLAPGNKSELAVG---YSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAA    174
d1gpma1      116 ALKLEDVKWLAQGTIYPDVIESAAK--------MGLVEPLKELFKDEVRKIGLELG----    163

Query        175 ERGQTPPIPEASITKPDY--PVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTA    232
d1gpma1      164 -------LPYDMLYR-HPFP----------------------------------------    175

Query        233 EYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1gpma1      176 ----------------------------------    176


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ****************.   *************************.. ************
Query          4 EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSS     63
d1gpma1        4 AKIIDDAVARIREQVGD---DKVILGLSGGVDSSVTAMLLHRAIGKN-LTCVFVDNGLLR     59

DALI match       ****** ..************************....... *******************
Query         64 DHSKGD-AAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQ    122
d1gpma1       60 LNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEA-KRKIIGRVFVEVFDEEALK    118

DALI match       *... .............      .    ********************           
Query        123 EGHI-VLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPP    181
d1gpma1      119 LEDVKWLAQGTIYPDVIESAAKMGL----VEPLKELFKDEVRKIGLELG-----------    163

DALI match       ********    
Query        182 IPEASITKPDYP    193
d1gpma1      164 LPYDMLYRHPFP    175



top
3: d1ni5a1 Putative cell cycle protein MesJ,​ N-​terminal domain (hh: 0.999)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.59  Contact: 1515
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.37 LBcontacta:0.99 LBcontactb:0.99 LHM:0.10
id:0.96 blosum:0.72 compass:0.83 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.60 gdtts:0.68 tmscore:0.81 rmsd:0.83 AHM:0.71 LBcontacta:0.49 LBcontactb:0.65 LHM:0.59
id:0.04 blosum:0.14 compass:0.35 pearson:0.34

hit structure      alignment
DALI alignment (Z-score: 13.9 Raw score:1114.50)
Query          1 dadeevysALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALG---aQNVYGVSM     57
d1ni5a1        1 --------SMTLTLNRQLL--TSRQILVAFSGGLDSTVLLHQLVQWRTenpgVALRAIHV     50

Query         58 PSKYS--SDHSKGDAAELARRTGLNFRTVSIEpmFDAYmaslgltgLAEE-NLQSRLRGT    114
d1ni5a1       51 HHGLSanADAWVTHCENVCQQWQVPLVVERVQ--LAQE--------GLGIeAQARQARYQ    100

Query        115 TLMAISNqEGHIVLAPGNKSELAVGY-----------------stlygdsvgAYGPIKDV    157
d1ni5a1      101 AFARTLL-PGEVLVTAQHLDDQCETFllalkrgsgpaglsamaevsefagtrLIRPLLAR    159

Query        158 YKTSIFRLAEWRNraaaergqtppIPEASitkpdypvldailelyvdrdtgadaivaagy    217
d1ni5a1      160 TRGELVQWARQYD-----------LRWIE------------------------------d    178

Query        218 drelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1ni5a1      179 esnqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldel    227


hit structure      alignment
FAST alignment (Normalized score: 8.92 Raw score:2193.00)
Query          1 DADEEVYSA-LVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ-------NV     52
d1ni5a1        1 ---------SMTLTLNRQL--LTSRQILVAFSGGLDSTVLLHQLVQW----RTENPGVAL     45

Query         53 YGVSMPSKYS--SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAE-----E    105
d1ni5a1       46 RAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERV-----QLAQ---------EGLGIE     91

Query        106 NLQSRLRGTTLMAISNQ--EGHIVLAPGNKSELAVGYSTLYGDSVG--------------    149
d1ni5a1       92 AQARQARYQAFART---LLPGEVLVTAQHLDDQC------------ETFLLALKRGSGPA    136

Query        150 ---------------AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP----    190
d1ni5a1      137 GLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQ----------------------YDLR    174

Query        191 -------------------------------DYPVLDAILELYVDRDTGADAIVAAGYDR    219
d1ni5a1      175 WIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAE---------------    219

Query        220 ELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH--------    266
d1ni5a1      220 -----------------------------------------------QESLLDEL    227


hit structure      alignment
TMalign alignment (TM-score: 0.55 Raw score:147.16)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--A-QNVYGVSM     57
d1ni5a1        1 --------SMTLTLNRQLL-T-SRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHV     50

Query         58 PSKYS--SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE-NLQSRLRGT    114
d1ni5a1       51 HHGLSANADAWVTHCENVCQQWQVPLVVERVQ--L---A----QEG-LGIEAQARQARYQ    100

Query        115 TLMAISNQEGHIVLAPGNKSELAVG-YS-----------------TLYGDS-V---GAYG    152
d1ni5a1      101 AFARTL-LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEV-----SEFAGTRLIR    154

Query        153 PIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK-------------PD-YPVLDAI    198
d1ni5a1      155 PLLARTRGELVQWARQYD-----------L-RWIEDESNQDDSYDRNFLRLRVVPLLQQR    202

Query        199 LELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLP-    257
d1ni5a1      203 WPHFAE-A----------------------T------------------ARSAALCAEQE    221

Query        258 ------ITNRWREGH    266
d1ni5a1      222 SLLDEL---------    227


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ************************* .   ************.  ***************
Query         24 RSVLIGLSGGIDSALVAAIACDALGAQ---NVYGVSMPSKYSS--DHSKGDAAELARRTG     78
d1ni5a1       14 RQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQ     73

DALI match       *********.            .....****************........         
Query         79 LNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLA---------    129
d1ni5a1       74 VPLVVERVQL---------AQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCET    124

DALI match                                  . ********************       
Query        130 --------PGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERG    177
d1ni5a1      125 FLLALKRGSGPAGLSAMAEVSEFAGTRL-IRPLLARTRGELVQWARQYDLRWIEDE    179



top
4: d1sura_ Phosphoadenylyl sulphate (PAPS) reductase (hh: 0.997)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.64  Contact: 1408
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.33 AHM:0.32 LBcontacta:0.99 LBcontactb:0.98 LHM:0.15
id:0.99 blosum:0.32 compass:0.42 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.47 gdtts:0.53 tmscore:0.70 rmsd:0.81 AHM:0.76 LBcontacta:0.40 LBcontactb:0.56 LHM:0.47
id:0.05 blosum:0.11 compass:0.29 pearson:0.29

hit structure      alignment
DALI alignment (Z-score: 11.1 Raw score:953.30)
Query          1 ----------------------dadeevysALVVGLRAYVAKNGFrSVLIGLSGGIDSAL     38
d1sura_        1 skldlnalnelpkvdrilalaetnaeleklDAEGRVAWALDNLPG-EYVLSSSFGIQAAV     59

Query         39 VAAIACDALGAqnVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIePMFDAYMASLG     98
d1sura_       60 SLHLVNQIRPD--IPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRAtESAAWQEARYG    117

Query         99 L---TGLAEENLQSR-LRGTTLMAISNQEGH-IVLAPGNKSElAVGY----stlygdsvg    149
d1sura_      118 KlweQGVEGIEKYNDiNKVEPMNRALKELNAqTWFAGLRREQ-SGSRanlpvlaiqrgvf    176

Query        150 AYGPIKDVYKTSIFRLAEWRNraaaergqtppipEASITKpdypvldailelyvdrdtga    209
d1sura_      177 KVLPIIDWDNRTIYQYLQKHG------------lKYHPLW--------------------    204

Query        210 daivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1sura_      205 ----------------------------------------------degylsvgdth    215


hit structure      alignment
FAST alignment (Normalized score: 7.94 Raw score:1898.00)
Query          1 DADEEVYS------------------------------ALVVGLRAYVAKNGFRSVLIGL     30
d1sura_        1 --------SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLP-GEYVLSS     51

Query         31 SGGIDSALVAAIACDALGAQ-NVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEP-     88
d1sura_       52 SFGIQAAVSLHLVNQIR---PDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYR---A    105

Query         89 --MFDAYMASLGL-----TGLAEENLQSR-LRGTTLMAISNQEG-HIVLAPGNKSELAVG    139
d1sura_      106 TESAAWQEARY--GKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRR------    157

Query        140 YSTLYGDSVG-------------------AYGPIKDVYKTSIFRLAEWRNRAAAERGQTP    180
d1sura_      158 ----------EQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQK------------    195

Query        181 ---PIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRR    237
d1sura_      196 HGLKYHP-----------------------------------------------------    202

Query        238 QYPPGTKISAKGFGKDRRLPITNRWREGH-------------    266
d1sura_      203 -----------------------------LWDEGYLSVGDTH    215


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:131.05)
Query          1 -----------------------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLS     31
d1sura_        1 SKLDLNALNELPKVDRILALAETNAELEK-------LDAEGRVAWALDNLPGEYVLSS-S     52

Query         32 GGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMF-     90
d1sura_       53 FGIQAAVSLHLVNQIRP-D-IPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAA    110

Query         91 -DAYMASLGL-TGLAEENLQSR-LRGTTLMAISNQEGH-IVLAPGNKSELAVGY------    140
d1sura_      111 WQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQS-GSRANLPVL    169

Query        141 --STLYGDSV--GAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITK--PDYP-    193
d1sura_      170 AI------QRGVFKVLPIIDWDNRTIYQYLQKHG-----------L-KYHPLWDE-GYLS    210

Query        194 -----VLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAK    248
d1sura_      211 VGDTH-------------------------------------------------------    215

Query        249 GFGKDRRLPITNRWREGH    266
d1sura_      216 ------------------    216


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match             ............... **********************  .  ***********
Query          3 DEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYS     62
d1sura_       24 NAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQI--RPDIPVILTDTGYL     81

DALI match       ************************ ***********      ..................
Query         63 SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG-----LTGLAEENLQSRLRGTTLM    117
d1sura_       82 FPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNR    141

DALI match       ........**********.....         ...   ******************  
Query        118 AISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYG---PIKDVYKTSIFRLAEWRNRA    172
d1sura_      142 ALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLK    199



top
5: d1q15a1 beta-​Lactam synthetase (hh: 0.990)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 1608
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.32 AHM:0.38 LBcontacta:0.99 LBcontactb:0.99 LHM:0.16
id:1.00 blosum:0.73 compass:0.67 pearson:1.00
Scaled scores:
dali:0.78 daliz:0.56 gdtts:0.62 tmscore:0.74 rmsd:0.81 AHM:0.70 LBcontacta:0.47 LBcontactb:0.63 LHM:0.44
id:0.09 blosum:0.14 compass:0.20 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 13.1 Raw score:1147.70)
Query          1 ------------DADEEVYSALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALG     48
d1q15a1        1 pasnqllalprePLLALIDRYLNAPLEDLAP--RFDTVGIPLSGGLDSSLVTALASRHFK     58

Query         49 aqNVYGVSMPSKYSSdhSKGDAAELARRTGLNFRTVSIEP-MFDA--ymaslgltgLAEE    105
d1q15a1       59 --KLNTYSIGTELSN--EFEFSQQVADALGTHHQMKILSEtEVINgiiesiyyneiFDGL    114

Query        106 NLQSRLRGTTLMAISNQEGHIVLAPG-NKSE----------------lAVGY--------    140
d1q15a1      115 SAEIQSGLFNVYRQAQGQVSCMLTGYgSDLLfggilkpgaqydnpnqlLAEQvyrtrwtg    174

Query        141 ----stlygdsvGAYGPIKD-------------------vyKTSIFRLAEWRNraaaerg    177
d1q15a1      175 efathgascygiDIRHPFWShslislchalhpdykifdnevKNILREYADSLQ-------    227

Query        178 qtpPIPEASITkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrr    237
d1q15a1      228 ---LLPKDIVW--------------------------rsvnqafanvlgstvdnyqtksr    258

Query        238 qyppgtkisakgfgkdrrlpitnrwregh    266
d1q15a1      259 ftyrvyqaflrgrlsitdvtpsqlkdlik    287


hit structure      alignment
FAST alignment (Normalized score: 7.22 Raw score:1996.00)
Query          1 D---------ADEEVYSALVVGLRAYVAK--NGFRSVLIGLSGGIDSALVAAIACDALGA     49
d1q15a1        1 -PASNQLLALPREPLLALIDRYLNAPLEDLAPRFDTVGIPLSGGLDSSLVTALASRHF--     57

Query         50 Q-NVYGVSMPSKYSSDH---SKGDAAELARRTGLNFRTVS-IEPMFDAYMASLGLTGL--    102
d1q15a1       58 -KKLNTYSIGTE-----LSNEFEFSQQVADALGTHHQMKILSETEVINGI--------IE    103

Query        103 --------AEENLQSRLRGTTLMAISNQEG--HIVLAPGN------KSELAVGYSTLYGD    146
d1q15a1      104 SIYYNEIFDGLSAEIQSGLFNVYRQAQG--QVSCMLTG--YGSDLLFGGI----------    149

Query        147 SVG--------------------------------------AYGPIKDVY----------    158
d1q15a1      150 ---LKPGAQYDNPNQLLAEQVYRTRWTGEFATHGASCYGIDIRHPF----WSHSLISLCH    202

Query        159 -------------KTSIFRLAEWRNRAAAERGQT-PPIPEASITKPDYPVLDAILELYVD    204
d1q15a1      203 ALHPDYKIFDNEVKNILREYADS-----------LQLLPKDI------------------    233

Query        205 RDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE    264
d1q15a1      234 ------------------------------------------------------------    234

Query        265 GH------------------------------------------------------    266
d1q15a1      234 --VWRSVNQAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLSITDVTPSQLKDLIK    287


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:134.46)
Query          1 -----------DA-DEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG     48
d1q15a1        1 PASNQLLALPREPLLALIDRYLNAPLEDLAP--RFDTVGIPLSGGLDSSLVTALASRHFK     58

Query         49 AQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYM-AS---------LG     98
d1q15a1       59 --KLNTYSIGTELSN--EFEFSQQVADALGTHHQMKILSETEVINGI-IESIYYNEIF--    111

Query         99 LTGLAEENLQSRLRGTTLMAISNQEGHIVLAP-GN--KS--E-------------LAVGY    140
d1q15a1      112 ---DG-LSAEIQSGLFNVYRQAQGQVSCMLTGYGSDLLFGGILKPGAQYDNPNQLLAEQV    167

Query        141 -ST---LYGDS-V--G------AYGPIK---DV--Y--------------KTSIFRLAEW    168
d1q15a1      168 YRTRWT--GEFATHGASCYGIDIRHPFWSHSLISLCHALHPDYKIFDNEVKNILREYADS    225

Query        169 RNRAAAERGQTPPIPEASITK---------------------------------------    189
d1q15a1      226 LQ----------LLPKDIVWRSVNQAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLSIT    275

Query        190 ------------PDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRR    237
d1q15a1      276 DVTPSQLKDLIK------------------------------------------------    287

Query        238 QYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1q15a1      288 -----------------------------    288


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ...................  .........  ****************  . ********
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGL--SGGIDSALVAAIACDALGAQNVYGVSMP     58
d1q15a1        9 LPREPLLALIDRYLNAPLEDLAPRFDTVGIPLSGGLDSSLVTALASRH--FKKLNTYSIG     66

DALI match         ...  ****************  ...........         ...............
Query         59 SKYSSDHSKGDAAELARRTGLNF--RTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTL    116
d1q15a1       67 --TELSNEFEFSQQVADALGTHHQMKILSETEVINGIIESIYYNEIFDGLSAEIQSGLFN    124

DALI match       ........ *******....      
Query        117 MAISNQEG-HIVLAPGNKSELAVGYS    141
d1q15a1      125 VYRQAQGQVSCMLTGYGSDLLFGGIL    150



hit structures. 
top
6: d1jgta1 beta-​Lactam synthetase (hh: 0.991)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 1576
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.38 AHM:0.40 LBcontacta:0.99 LBcontactb:0.99 LHM:0.14
id:1.00 blosum:0.96 compass:0.68 pearson:1.00
Scaled scores:
dali:0.75 daliz:0.50 gdtts:0.56 tmscore:0.68 rmsd:0.77 AHM:0.70 LBcontacta:0.41 LBcontactb:0.60 LHM:0.48
id:0.16 blosum:0.19 compass:0.20 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 10.5 Raw score:1021.00)
Query          1 -----------DADEEVYSALVVGLRAYVAknGFRSVLIGLSGGIDSALVAAIACDALGA     49
d1jgta1        1 pglsrrilpegEAVAAVRAALEKAVAQRVT--PGDTPLVVLSGGIDSSGVAACAHRAAGE     58

Query         50 qnVYGVSMPSKYSSdhSKGDAAELARRTGLNFRTVSIE-PMFDAYMA---slglTGLAEE    105
d1jgta1       59 --LDTVSMGTDTSN--EFREARAVVDHLRTRHREITIPtTELLAQLPyavwaseSVDPDI    114

Query        106 NLQSRLRGTTLMAIsNQEGHIVLAPG-NKSELA---------------------------    137
d1jgta1      115 IEYLLPLTALYRAL-DGPERRILTGYgADIPLGgmhredrlpaldtvlahdmatfdglne    173

Query        138 vgystlygdsvGAYGPIKD-------------------vyKTSIFRLAEWRnraaaergq    178
d1jgta1      174 mspvlstlaghWTTHPYWDrevldllvsleaglkrrhgrdKWVLRAAMADA---------    224

Query        179 tppIPEASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrq    238
d1jgta1      225 ---LPAETVNR-------------------pklssfsrllldhgvaedrvheakrqvvre    262

Query        239 yppgtkisakgfgkdrrlpitnrwregh    266
d1jgta1      263 lfdltvgggrhpsevdtddvvrsvadrt    290


hit structure      alignment
FAST alignment (Normalized score: 6.65 Raw score:1846.00)
Query          1 D--------ADEEVYSALVVGLRAYVAKNGF-----RSVLIGLSGGIDSALVAAIACDAL     47
d1jgta1        1 -PGLSRRILPEGEAVAAVRAALEKAVAQ---RVTPGDTPLVVLSGGIDSSGVAACAHRAA     56

Query         48 GAQ-NVYGVSMPSKYSSDH---SKGDAAELARRTGLNFRTVS-IEPMFDAYMASLGL---     99
d1jgta1       57 ---GELDTVSMGTD-----TSNEFREARAVVDHLRTRHREITIPTTELLAQ------LPY    102

Query        100 ---------TGLAEENLQSRLRGTTLMAISN--QEGHIVLAPGNKSELAVGYSTLYGDSV    148
d1jgta1      103 AVWASESVDPDIIEYLLPLTALYRA------LDGPERRILTG------------------    138

Query        149 G-----------------------------------------------AYGPIKDVY---    158
d1jgta1      139 -YGADIPLGGMHREDRLPALDTVLAHDMATFDGLNEMSPVLSTLAGHWTTHPY----WDR    193

Query        159 --------------------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAI    198
d1jgta1      194 EVLDLLVSLEAGLKRRHGRDKWVLRAAMA------------DALPAETVN----------    231

Query        199 LELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPI    258
d1jgta1      232 ------------------------------------------------------------    232

Query        259 TNRWREGH----------------------------------------------------    266
d1jgta1      232 --------RPKLSSFSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGGGRHPSEVDTDDVV    283

Query        267 -------    267
d1jgta1      284 RSVADRT    290


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:132.17)
Query          1 ----------DA-DEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGA     49
d1jgta1        1 PGLSRRILPEGEAVAAVRAALEKAVAQRVT--PGDTPLVVLSGGIDSSGVAACAHRAAG-     57

Query         50 QNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG---------LT    100
d1jgta1       58 E-LDTVSMGTDTSN--EFREARAVVDHLRTRHREITIP--TTELLAQLPYAVWASESV--    110

Query        101 GLAEENLQSRLRGTTLMAISNQEGHIVLAP-GN--KSEL-------------A--VG-YS    141
d1jgta1      111 -DPDIIEYLLPLTALYRALD-GPERRILTGYGADIPLGGMHREDRLPALDTVLAHDMATF    168

Query        142 ---TLYGDSVG---------AYGPIK----D--V-------Y------KTSIFRLAEWRN    170
d1jgta1      169 DGL---NEMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHGRDKWVLRAAMA-DA    224

Query        171 RAAAERGQTPPIPEASITKPDY--------------------------------------    192
d1jgta1      225 ----------LPAETVNRP-KLSSFSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGGGRH    273

Query        193 -----------------PVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYK    235
d1jgta1      274 PSEVDTDDVVRSVADRT-------------------------------------------    290

Query        236 RRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1jgta1      291 -------------------------------    291


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ..................    *************************  .  ******* 
Query          2 ADEEVYSALVVGLRAYVAK--NGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPS     59
d1jgta1        9 PEGEAVAAVRAALEKAVAQRVTPGDTPLVVLSGGIDSSGVAACAHRA--AGELDTVSMG-     65

DALI match        ...  *********************  .........    ... ..............
Query         60 KYSSDHSKGDAAELARRTGLNFRTVSI--EPMFDAYMASLGLTGL-AEENLQSRLRGTTL    116
d1jgta1       66 -TDTSNEFREARAVVDHLRTRHREITIPTTELLAQLPYAVWASESVDPDIIEYLLPLTAL    124

DALI match       ... ***********......   
Query        117 MAISNQEGHIVLAPGNKSELAVGY    140
d1jgta1      125 YRALDGPERRILTGYGADIPLGGM    148



top
7: d1vl2a1 Argininosuccinate synthetase,​ N-​terminal domain (hh: 0.999)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.70  Contact: 1374
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:1.00 tmscore:0.99 rmsd:0.28 AHM:0.29 LBcontacta:0.99 LBcontactb:0.97 LHM:0.14
id:1.00 blosum:0.87 compass:0.46 pearson:0.99
Scaled scores:
dali:0.78 daliz:0.56 gdtts:0.65 tmscore:0.77 rmsd:0.84 AHM:0.76 LBcontacta:0.48 LBcontactb:0.61 LHM:0.50
id:0.11 blosum:0.16 compass:0.27 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 12.5 Raw score:953.20)
Query          1 dadeevysalvvglrayvakngFRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMPSK     60
d1vl2a1        1 ----------------------KEKVVLAYSGGLDTSVILKWLCEKGF--DVIAYVANVG     36

Query         61 ySSDHsKGDAAELARRTGL-NFRTVSIEPMFDAY-MASLG-------ltGLAEENLQSRL    111
d1vl2a1       37 -QKDD-FVAIKEKALKTGAsKVYVEDLRREFVTDyIFTALlgnamyegrYLLGTAIARPL     94

Query        112 RGTTLMAISNQEGH-IVLAPGNKselavGYST-lyGDSV--------gAYGPIK----DV    157
d1vl2a1       95 IAKRQVEIAEKEGAqYVAHGATG-----KGNDqvrFELTyaalnpnlkVISPWKdpefLA    149

Query        158 YK-TSIFRLAEWRnraaaergqtPPIPeasitkpdypvldailelyvdrdtgadaivaag    216
d1vl2a1      150 KFkTDLINYAMEK----------GIPI---------------------------------    166

Query        217 ydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1vl2a1      167 --------------------------------------------------    167


hit structure      alignment
FAST alignment (Normalized score: 7.91 Raw score:1662.00)
Query          1 DADEEVYSALVVGLRAYVAKNGF-RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPS     59
d1vl2a1        1 -----------------------KEKVVLAYSGGLDTSVILKWLCE-KGF-DVIAYVANV     35

Query         60 KYSSDHSKGDAAELARRTG-LNFRTVSIEPMFD-AYMA---SLGLTGL-------AEENL    107
d1vl2a1       36 -GQKD-DFVAIKEKALKTGASKVYVEDLRREFVTDYIFTALLGNA---MYEGRYLLGTAI     90

Query        108 QSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY------GDSVG---------AY    151
d1vl2a1       91 ARPLIAKRQVEIAEKEGAQYVAHGATGK----------GNDQVRFELT-YAALNPNLKVI    139

Query        152 GPIKDVY----------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILEL    201
d1vl2a1      140 SP-----WKDPEFLAKFKTDLINYAME---------------------------------    161

Query        202 YVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNR    261
d1vl2a1      162 ------------------------------------------------------------    162

Query        262 WREGH-----    266
d1vl2a1      162 -----KGIPI    166


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:124.53)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1vl2a1        1 ----------------------KEKVVLAYSGGLDTSVILKWLCEKGF--DVIAYVANVG     36

Query         61 YSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAY-MASLG---LT----GLAEENLQSRL    111
d1vl2a1       37 -QKDD-FVAIKEKALKTGASKVYVEDLRREFVTDYIFTALLGNAMYEGRYLLGTAIARPL     94

Query        112 RGTTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDS-VG--------AYGPIK-D--VY    158
d1vl2a1       95 IAKRQVEIAEKEGAQYVAHGATG--K---GNDQVRFELTYAALNPNLKVISPWKDPEFLA    149

Query        159 KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYD    218
d1vl2a1      150 -KFKTDLINYAME-K------G-IPI----------------------------------    166

Query        219 RELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1vl2a1      167 ------------------------------------------------    167


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match       *********************** . . *******  ..... ************* ***
Query         24 RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFR     82
d1vl2a1        2 EKVVLAYSGGLDTSVILKWLCEK-GFD-VIAYVAN--VGQKDDFVAIKEKALKTGASKVY     57

DALI match       ***********.....             **********************......   
Query         83 TVSIEPMFDAYMASLGLTGLA--------EENLQSRLRGTTLMAISNQEGHIVLAPG---    131
d1vl2a1       58 VEDLRREFVTDYIFTALLGNAMYEGRYLLGTAIARPLIAKRQVEIAEKEGAQYVAHGATG    117

DALI match                           . ***       ....**********    
Query        132 ---NKSELAVGYSTLYGDSVGAYGP-----IKDVYKTSIFRLAEWRNRAA    173
d1vl2a1      118 KGNDQVRFELTYAALNPNLKV-ISPWKDPEFLAKFKTDLINYAMEKGIPI    166



top
8: d1ct9a1 Asparagine synthetase B,​ C-​terminal domain (hh: 0.993)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 1622
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.43 AHM:0.45 LBcontacta:0.99 LBcontactb:0.98 LHM:0.14
id:1.00 blosum:0.76 compass:0.52 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.45 gdtts:0.52 tmscore:0.67 rmsd:0.77 AHM:0.70 LBcontacta:0.38 LBcontactb:0.55 LHM:0.51
id:0.09 blosum:0.14 compass:0.28 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 9.9 Raw score:992.40)
Query          1 -------------DADEEVYSALVVGLRAYVAkNGFRsVLIGLSGGIDSALVAAIACDAL     47
d1ct9a1        1 rdwfdydavkdnvTDKNELRQALEDSVKSHLM-SDVP-YGVLLSGGLDSSIISAITKKYA     58

Query         48 gaqnVYGVSMPSkySSDHSKGDAAELARRTGLNFRTVSIEP-MFDAYMA---slgltGLA    103
d1ct9a1       59 ----LHSFAVGL--PGSPDLKAAQEVANHLGTVHHEIHFTVqEGLDAIRdviyhietYDV    112

Query        104 EENLQSRLRGTTLMAISNQEGHIVLAPG-NKSE----------------------lAVGY    140
d1ct9a1      113 TTIRASTPMYLMSRKIKAMGIKMVLSGEgSDEVfggylyfhkapnakelheetvrkLLAL    172

Query        141 --stlyGDSV-------GAYGPIKD------------------vyKTSIFRLAEWRnraa    173
d1ct9a1      173 hmydcaRANKamsawgvEARVPFLDkkfldvamrinpqdkmckmeKHILRECFEAY----    228

Query        174 aergqtppIPEASITKpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtae    233
d1ct9a1      229 --------LPASVAWR-----------qkeqfsdgvgyswidtlkevaaqqvsdqqleta    269

Query        234 ykrrqyppgtkisakgfgkdrrlpiTNRW---regh    266
d1ct9a1      270 rfrfpyntptskeaylyreifeelfPLPSaaecvpg    305


hit structure      alignment
FAST alignment (Normalized score: 6.81 Raw score:1940.00)
Query          1 -------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDAL     47
d1ct9a1        1 RDWFDYDAVKDNVTDKNELRQALEDSVKSH-LMSD-VPYGVLLSGGLDSSIISAITKKY-     57

Query         48 GAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVS-IEPMFDAYMASLG--------     98
d1ct9a1       58 ---ALHSFAVGLPG--SPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIR---DVIYHIET    109

Query         99 -LTGLAEENLQSRLRGTTLMAISNQEG---HIVLAPGNK---------------------    133
d1ct9a1      110 YDVTTIRASTPMYLMSRKIKA------MGIKMVLSG---EGSDEVFGGYLYFHKAPNAKE    160

Query        134 ------SELAVGYSTLYGDSVG--------------------AYGPIKDVY---------    158
d1ct9a1      161 LHEETVRKLL------------ALHMYDCARANKAMSAWGVEARVPF----LDKKFLDVA    204

Query        159 -------------KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDR    205
d1ct9a1      205 MRINPQDKMCKMEKHILRECFEA------------YLPASVAW-----------------    235

Query        206 DTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREG    265
d1ct9a1      236 ------------------------------------------------------------    236

Query        266 H-----------------------------------------------------------    266
d1ct9a1      236 -RQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELF    294

Query        267 -----------    267
d1ct9a1      295 PLPSAAECVPG    305


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:134.55)
Query          1 -------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDAL     47
d1ct9a1        1 RDWFDYDAVKDNVTDKNELRQALEDSVKSHLM-SDV-PYGVLLSGGLDSSIISAITKKYA     58

Query         48 GAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIE-PMFDAYMASLG-----LTG    101
d1ct9a1       59 ---L-HSFAVGLP--GSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIET--Y    110

Query        102 LAEENLQSRLRGTTLMAISNQEGHIVLAPGNK-S-----------------------ELA    137
d1ct9a1      111 DVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLL    170

Query        138 VG-YSTLYGDS--V-----GAYGPIK----D--VY---K--T----SIFRLAEWRNRAAA    174
d1ct9a1      171 ALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQDKMCKMEKHILRECFE-AY-    228

Query        175 ERGQTPPIPEASITK---------------------------------------------    189
d1ct9a1      229 -----LPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEA    283

Query        190 -----------------PDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTA    232
d1ct9a1      284 YLYREIFEELFPLPSAA-------------------------------------------    300

Query        233 EYKRRQYPPGTKISAKGFGKDRRLPITN---RWREGH    266
d1ct9a1      301 --------------------------ECVPG------    305


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       *******************..  . *********************    .*******  
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1ct9a1       14 TDKNELRQALEDSVKSHLMSD--VPYGVLLSGGLDSSIISAITKKY----ALHSFAVG--     65

DALI match       .************************  ..........     . ................
Query         61 YSSDHSKGDAAELARRTGLNFRTVS--IEPMFDAYMASLGLTG-LAEENLQSRLRGTTLM    117
d1ct9a1       66 LPGSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMS    125

DALI match       ....... *******....     
Query        118 AISNQEG-HIVLAPGNKSELAVGY    140
d1ct9a1      126 RKIKAMGIKMVLSGEGSDEVFGGY    149



top
9: d1k92a1 Argininosuccinate synthetase,​ N-​terminal domain (hh: 0.998)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.68  Contact: 1335
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.32 AHM:0.35 LBcontacta:0.98 LBcontactb:0.98 LHM:0.13
id:1.00 blosum:0.70 compass:0.38 pearson:0.99
Scaled scores:
dali:0.75 daliz:0.50 gdtts:0.61 tmscore:0.74 rmsd:0.81 AHM:0.72 LBcontacta:0.43 LBcontactb:0.60 LHM:0.52
id:0.10 blosum:0.13 compass:0.21 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 11.2 Raw score:922.90)
Query          1 dadeevysalvvGLRAyvakngfRSVLIGLSGGIDSALVAAIACDALGaqNVYGVSMPSK     60
d1k92a1        1 -------ttilkHLPV------gQRIGIAFSGGLDTSAALLWMRQKGA--VPYAYTANLG     45

Query         61 Y-SSDHsKGDAAELARRTGL-NFRTVSIEPMFDAYMASLG-----------ltGLAEENL    107
d1k92a1       46 QpDEED-YDAIPRRAMEYGAeNARLIDCRKQLVAEGIAAIqcgafhnttggltYFNTTPL    104

Query        108 QSRLRGTTLMAISNQEGH-IVLAPGNKselavGYST-lyGDSV--------gAYGPIKD-    156
d1k92a1      105 GRAVTGTMLVAAMKEDGVnIWGDGSTY-----KGNDierFYRYglltnaelqIYKPWLDt    159

Query        157 --vyktSIFRLAEWRNRAAAergqtppipeasITKPDYpvldailelyvdrdtgadaiva    214
d1k92a1      160 dfidelGGRHEMSEFMIACG---------fdyKMSVEK----------------------    188

Query        215 agydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1k92a1      189 ----------------------------------------------------    189


hit structure      alignment
FAST alignment (Normalized score: 6.79 Raw score:1519.00)
Query          1 DADEEVYSALVVGLRAYVAKNGF----------RSVLIGLSGGIDSALVAAIACDALGAQ     50
d1k92a1        1 -----------------------TTILKHLPVGQRIGIAFSGGLDTSAALLWMRQ-----     32

Query         51 ---NVYGVSMPSKYSSDH------SKGDAAELARRTG-LNFRTVSIEPMFDAYMA---SL     97
d1k92a1       33 KGAVPYAYTANL------GQPDEEDYDAIPRRAMEYGAENARLIDCRKQLVAEGIAAIQC     86

Query         98 GLTG----------LAEENLQSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY--    144
d1k92a1       87 GA--FHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDGSTYK----------GN    134

Query        145 ----GDSVG---------AYGPIKD----------VYKTSIFRLAEWRNRAAAERGQTPP    181
d1k92a1      135 DIERFYRY-GLLTNAELQIYKP---WLDTDFIDELGGRHEMSEFMIA-------------    177

Query        182 IPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPP    241
d1k92a1      178 ------------------------------------------------------------    178

Query        242 GTKISAKGFGKDRRLPITNRWREGH-----------    266
d1k92a1      178 -------------------------CGFDYKMSVEK    188


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:130.18)
Query          1 ----DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVS     56
d1k92a1        1 TTIL-----------KHL---PV---GQRIGIAFSGGLDTSAALLWMRQKGA--VPYAYT     41

Query         57 MPSKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMASLG---LT--------GLAE    104
d1k92a1       42 ANLGQPDEEDYDAIPRRAMEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNT    101

Query        105 ENLQSRLRGTTLMAISNQEGH-IVLAPGNKSELAVGYSTL-YGDS--V-------GAYGP    153
d1k92a1      102 TPLGRAVTGTMLVAAMKEDGVNIWGDGS---TY--KGNDIE-RFYRYGLLTNAELQIYKP    155

Query        154 IKD---VY-KTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGA    209
d1k92a1      156 WLDTDFIDE-LGGRHEMSEFMIACG-----F-DYK--MSV-EK-----------------    188

Query        210 DAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1k92a1      189 ---------------------------------------------------------    189


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match       ***********************  . ***********.... ************* ***
Query         24 RSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGL-NFR     82
d1k92a1       11 QRIGIAFSGGLDTSAALLWMRQK--GAVPYAYTANLGQPDEEDYDAIPRRAMEYGAENAR     68

DALI match       ****************                       ***************......
Query         83 TVSIEPMFDAYMASLGLTGLAEENLQSR-----------LRGTTLMAISNQEGHIVLAPG    131
d1k92a1       69 LIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKEDGVNIWGDG    128

DALI match                              . ******           ..............    
Query        132 ------NKSELAVGYSTLYGDSVGAYGPIKDVY-------KTSIFRLAEWRNRAAAERGQ    178
d1k92a1      129 STYKGNDIERFYRYGLLTNAELQI-YKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVE    187

DALI match        
Query        179 T    179
d1k92a1      188 K    188



top
10: d1ru8a_ Putative N-​type ATP pyrophosphatase PF0828 (hh: 0.986)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 1048
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.30 AHM:0.33 LBcontacta:0.96 LBcontactb:0.94 LHM:0.20
id:1.00 blosum:0.87 compass:0.35 pearson:0.96
Scaled scores:
dali:0.72 daliz:0.44 gdtts:0.57 tmscore:0.67 rmsd:0.82 AHM:0.71 LBcontacta:0.42 LBcontactb:0.59 LHM:0.40
id:0.13 blosum:0.17 compass:0.24 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 6.9 Raw score:641.00)
Query          1 dadeevysalvvglrayvaknGFRSVLIGLSGGIDSALVAAIACDALgaqNVYGVSMPSK     60
d1ru8a_        1 ---------------------GLADVAVLYSGGKDSNYALYWAIKNR-fsVKFLVTMVSE     38

Query         61 YS-----sDHSKGdAAELARRTGLNFRTVSIEpmfdaymaslgltglaEENLQSRLRGTT    115
d1ru8a_       39 NEesymytINANL-TDLQARALGIPLVKGFTQ---------------gEKEKEVEDLKRV     82

Query        116 LMAIsnqEGHIVLAPGnkselavGYSTlyGDSVG------AYGPIKDVYKTSIFRLAEWR    169
d1ru8a_       83 LSGL---KIQGIVAGA------sKYQRkrIEKVAkelgleVYTPAWGRDAKEYMRELLNL    133

Query        170 N------------------------------------raaaergqtppipEASItkpdyp    193
d1ru8a_      134 GfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggefeTFVL------    187

Query        194 vldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkd    253
d1ru8a_      188 ---------------------------------dmplfkykivvdkakkvwepctssgkl    214

Query        254 rrlpitnrwregh    266
d1ru8a_      215 iieeahleskleh    227


hit structure      alignment
FAST alignment (Normalized score: 5.12 Raw score:1259.00)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQN-----VYGV     55
d1ru8a_        1 ---------------------GLADVAVLYSGGKDSNYALYWAIK------NRFSVKFLV     33

Query         56 SMPSKYSSDHS--------KGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLA---E    104
d1ru8a_       34 TMVSENE----ESYMYTINANLTDLQARALGIPLVKGF------------------TQGE     71

Query        105 ENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLY-----GDSVG----------    149
d1ru8a_       72 KEKEVEDLKRVLSG--LKI-QGIVA---------------GASKYQRKR-IEKVAKELGL    112

Query        150 -AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP------------------    190
d1ru8a_      113 EVYTPAWGRDAKEYMRELLN----------------------LGFKIMVVGVSAYGLDES    150

Query        191 ------------DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQ    238
d1ru8a_      151 WLGRILDESALEELITLNEK----------------------------------------    170

Query        239 YPPGTKISAKGFGKDRRLPITNRWREGH--------------------------------    266
d1ru8a_      171 ----------------------------YKVHVAGEGGEFETFVLDMPLFKYKIVVDKAK    202

Query        267 -------------------------    267
d1ru8a_      203 KVWEPCTSSGKLIIEEAHLESKLEH    227


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:109.76)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1ru8a_        1 ---------------------GLADVAVLYSGGKDSNYALYWAIKNRF-SVKFLVTMVSE     38

Query         61 YS-S---DHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTL    116
d1ru8a_       39 NEESYMYTINANLTDLQARALGIPLVKGFTQ--G-------------E-KEKEVEDLKRV     82

Query        117 MAISNQEGHIVLAPGNKSELAVGYSTL-YGDSV-G------AYGPIKDVYKTSIFRLAEW    168
d1ru8a_       83 LSGL--KIQGIVAGA---SK--Y--QRK-RIEKVAKELGLEVYTPAWGRDAKEYMRELLN    132

Query        169 RNRAAAERGQTPPIPEASITK---P-DY----------------PVLDAILELYVDRDTG    208
d1ru8a_      133 L-G----------F-K-IMVVGVSAYGLDESWLGRILDESALEELITLN-----------    168

Query        209 ADAIVAAGYDRELV----------------------------------------------    222
d1ru8a_      169 -------EKY--KVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVWEPCTSSGKLIIEEA    219

Query        223 --------VKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1ru8a_      220 HLESKLEH--------------------------------------------    227


hit structure      alignment
HHsearch alignment (Probability: 0.94 E-value:0.00)
DALI match       ************************* .  ************        .. ********
Query         22 GFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHS----KGDAAELARRT     77
d1ru8a_        1 GLADVAVLYSGGKDSNYALYWAIKN-RFSVKFLVTMVSENEESYMYTINANLTDLQARAL     59

DALI match       **********          
Query         78 GLNFRTVSIEPMFDAYMASL     97
d1ru8a_       60 GIPLVKGFTQGEKEKEVEDL     79



hit structures. 
top
11: d1mopa_ Pantothenate synthetase (Pantoate-​beta-​alanine ligase,​ PanC) (svm: 0.995)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 1002
Modified z-scores:
dali:0.99 daliz:0.93 gdtts:0.97 tmscore:0.99 rmsd:0.46 AHM:0.44 LBcontacta:0.95 LBcontactb:0.96 LHM:0.15
id:1.00 blosum:0.31 compass:0.03 pearson:0.97
Scaled scores:
dali:0.72 daliz:0.39 gdtts:0.45 tmscore:0.61 rmsd:0.78 AHM:0.74 LBcontacta:0.33 LBcontactb:0.55 LHM:0.55
id:0.09 blosum:0.09 compass:0.14 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 5.8 Raw score:745.80)
Query          1 -------dadeevysalvvglrayvaKNGFRSVLIGL-SGGI-DSALVAAIACDALgaqN     51
d1mopa_        1 ipafhpgelnvysapgdvadvsralrLTGRRVMLVPTmGALHeGHLALVRAAKRVP-gsV     59

Query         52 VYGVSMPSK---------ysSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMA------     95
d1mopa_       60 VVVSIFVNPmqfgaggdldaYPRTPDDDLAQLRAEGVeIAFTPTTAAMYPDGLRttvqpg    119

Query         96 ----slgltgLAEENLQSRLRGTTLMAISNqeGHIVLAPGNkselavGYST--------l    143
d1mopa_      120 plaaeleggpRPTHFAGVLTVVLKLLQIVR--PDRVFFGEK-----dYQQLvlirqlvad    172

Query        144 ygdsvgAYGPiKDVY---kTSIFrlaewrnraaaergqtppipeaSITK-------pdYP    193
d1mopa_      173 fnldvaVVGV-PTVReadgLAMS----------------------SRNRyldpaqraaAV    209

Query        194 VLDAILELYvDRDT------GADAIVaAGYD---relvvKTLRmvDTAEYkrrqyppgtk    244
d1mopa_      210 ALSAALTAA-AHAAtagaqaALDAAR-AVLDaapgvavdYLEL--RDIGL----------    255

Query        245 isakgfgkdrrlpITNRWR-----------------------egh    266
d1mopa_      256 ------------gPMPLNGsgrllvaarlgttrlldniaieigtf    288


hit structure      alignment
FAST alignment (Normalized score: 3.14 Raw score:869.40)
Query          1 DADEEVYSALVVGLRAYVAKNGF------------------------------RSVLIGL     30
d1mopa_        1 -----------------------IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPT     37

Query         31 S--GGIDSALVAAIACDALGAQ--NVYGVSMPS-----------KYSSDHSKGDAAELAR     75
d1mopa_       38 MGALHEGHLALVRAAKRVP---GSVVVVSIFV-NPMQFGAGGDLDAYPR-TPDDDLAQLR     92

Query         76 RTGL-NFRTVSIEPM-FDAYMASLGL------------------TGLAEENLQSRLRGTT    115
d1mopa_       93 AEGVEIAFTP-TTAAMYPDGLR----TTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQI    147

Query        116 LMAISNQEG---HIVLAPGNKSELAVGYSTLYGDSVG----------------------A    150
d1mopa_      148 ---------VRPDRVFFG-------------------EKDYQQLVLIRQLVADFNLDVAV    179

Query        151 YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKP--------------------    190
d1mopa_      180 VGV-------------------------------------PTVREADGLAMSSRNRYLDP    202

Query        191 --------DYPVLDAILELYVDRDTGADAIVAAG-----YDRELVVKTLRMVDTAEYKRR    237
d1mopa_      203 AQRAAAVALSAALTAAA-----------------HAATAGAQAALDAARAVLD-------    238

Query        238 QYPPGTKISAKGFGKDRRLPITNRWREGH-------------------------------    266
d1mopa_      239 -----------------------------AAPGVAVDYLELRDIGLGPMPLNGSGRLLVA    269

Query        267 -------------------    267
d1mopa_      270 ARLGTTRLLDNIAIEIGTF    288


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:134.27)
Query          1 ----------------------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSG     32
d1mopa_        1 IPAFHPGELNVYSAPGDVADVSRALRLT---------------------GRRVMLVPTMG     39

Query         33 -GI-DSALVAAIACDALGAQNVYGVSMPSK--------YS-SDHSKGDAAELARRTGL-N     80
d1mopa_       40 ALHEGHLALVRAAK-RVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEI     98

Query         81 FRTVSIEPMFDAYMASL-GL-----------TGLAEENLQSRLRGTTLMAISNQEGHIVL    128
d1mopa_       99 AFTPTTAAMYPDGLRTTV-QPGPLAAELEGG-PRPTHFAGVLTVVLKLLQIVR--PDRVF    154

Query        129 APGNKSELAVGYSTLYGDSVG-----------AYGPIKDVYKTSIFRLAEWRNRAAAERG    177
d1mopa_      155 FGEK--DY--Q--Q--LVLIRQLVADFNLDVAVVGVP--TVREADGLAM-----------    193

Query        178 QTPPIPEASITK-----P--DYPVLDAILELYVDRD-----TGADAIVAAGYDRE--LVV    223
d1mopa_      194 -------SSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARA-VLDAAPGVAV    245

Query        224 KTLRMVDTAEYKRR----------------------QYPPGTKISAKGFGKDRR--LPIT    259
d1mopa_      246 DYL-ELRDIGLGPMPLNGSGRLLVAARLGTTRLLDN----------IAIE--IGTF----    288

Query        260 NRWREGH    266
d1mopa_      289 -------    289


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.62)
DALI match                                
Query         53 YGVSMPSKYSSDHSKGDAAELARRT     77
d1mopa_      191 LAMSSRNRYLDPAQRAAAVALSAAL    215



top
12: d1mjha_ ​(​Hypothetical​(​ protein MJ0577 (hh: 0.952)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 1048
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.97 tmscore:0.97 rmsd:0.32 AHM:0.32 LBcontacta:0.91 LBcontactb:0.91 LHM:0.18
id:0.86 blosum:0.45 compass:0.25 pearson:0.95
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.57 tmscore:0.67 rmsd:0.80 AHM:0.72 LBcontacta:0.40 LBcontactb:0.57 LHM:0.38
id:0.04 blosum:0.11 compass:0.21 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 7.6 Raw score:589.40)
Query          1 dadeevysalvvglrayvakNGFRSVLIGLSGGIDSALVAAIACDAL--gaQNVYGVSMP     58
d1mjha_        1 --------------------VMYKKILYPTDFSETAEIALKHVKAFKtlkaEEVILLHVI     40

Query         59 S-------------KYSS-DHSKGDAAELARRTG-----LNFRTVSIepmfdaymaslgl     99
d1mjha_       41 DereikveefenelKNKLtEEAKNKMENIKKELEdvgfkVKDIIVVG-------------     87

Query        100 tglaeenlqsrLRGTTLMAISNQEGH-IVLAPGN-ksELAVGYSTLyGDSVG-------A    150
d1mjha_       88 -----------IPHEEIVKIAEDEGVdIIIMGSHgktNLKEILLGS-VTENVikksnkpV    135

Query        151 YGPIkdVYKTsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgad    210
d1mjha_      136 LVVK--RKNS--------------------------------------------------    143

Query        211 aivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1mjha_      144 --------------------------------------------------------    144


hit structure      alignment
FAST alignment (Normalized score: 3.67 Raw score:715.30)
Query          1 DADEEVYSALVVGLRAYVAKN-GFRSVLIGLSGGIDSALVAAIACDALGA------QNVY     53
d1mjha_        1 ---------------------VMYKKILYPTDFSETAEIALKHVKA----FKTLKAEEVI     35

Query         54 GVSMPSKYS-----------------SDHSKGDAAELARR---TGLNFRTVSIEPMFDAY     93
d1mjha_       36 LLHVID---EREIKVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIV-------     85

Query         94 MASLGLTGLAEEN--LQSRLRGTTLMAISNQEG---HIVLAPGNKSE-------LAVGYS    141
d1mjha_       86 -------------VGIPHEEIVKIAED------EGVDIIIM------GSHGKTNLKEILL    120

Query        142 TLY----GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDA    197
d1mjha_      121 GS-VTENVIKKS------------------------------------------------    131

Query        198 ILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLP    257
d1mjha_      132 ------------------------------------------------------------    132

Query        258 ITNRWREGH------------    266
d1mjha_      132 ---------NKPVLVVKRKNS    143


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:93.42)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--AQNVYGVSMP     58
d1mjha_        1 --------------------VMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVI     40

Query         59 SK--Y---------S--S-DHSKGDAAELARRTG---L-NFRTVSIEPMFDAYMASLGLT    100
d1mjha_       41 DEREIKVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVG-------------     87

Query        101 GLAEENLQSRLRGTTLMAISNQEGHIVLAPGN---KSELAVGYSTLYGDS-VG-----AY    151
d1mjha_       88 -------IPHEEIVKIAEDE--GVDIIIMGSHGKT-NLKEILLGS--VTENVIKKSNKPV    135

Query        152 GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADA    211
d1mjha_      136 LVVK--RKN--------------------------------S------------------    143

Query        212 IVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1mjha_      144 -------------------------------------------------------    144


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.08)
DALI match                                                                   
Query         53 YGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLR    112
d1mjha_        6 ILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKVEEFENELKNKLTEEAKNK     65

DALI match                   
Query        113 GTTLMAISNQEG    124
d1mjha_       66 MENIKKELEDVG     77



top
13: d1o97c_ Small,​ beta subunit of electron transfer flavoprotein ETFP (svm: 1.607)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 1024
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.83 tmscore:0.89 rmsd:0.52 AHM:0.48 LBcontacta:0.92 LBcontactb:0.93 LHM:0.19
id:0.94 blosum:0.45 compass:0.32 pearson:0.96
Scaled scores:
dali:0.76 daliz:0.47 gdtts:0.37 tmscore:0.43 rmsd:0.68 AHM:0.63 LBcontacta:0.42 LBcontactb:0.63 LHM:0.40
id:0.06 blosum:0.10 compass:0.22 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 5.9 Raw score:601.50)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS--------------------------GGI     34
d1o97c_        1 -----------------------MKILVAVKqtaaleedfeiredgmdvdedfmmydLNE     37

Query         35 DSALVAAIACDALG----aQNVYGVSMPSkyssDHSKGDAAELArRTGL-NFRTVSiEPM     89
d1o97c_       38 WDDFSLEEAMKIKEssdtdVEVVVVSVGP----DRVDESLRKCL-AKGAdRAVRVWdDAA     92

Query         90 FdaymaslgltglaeenLQSRLRGTTLMAISNQEGH-IVLAPGNkselavGYSTLyGDSV    148
d1o97c_       93 E---------------gSDAIVVGRILTEVIKKEAPdMVFAGVQ---ssdQAYAS-TGIS    133

Query        149 --------------------------------------------gAYGPIkdvyktsifr    164
d1o97c_      134 vasylnwphaavvadlqykpgdnkavirreleggmlqeveincpaVLTIQ------lgin    187

Query        165 LAEWRNraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvk    224
d1o97c_      188 KPRYAS------------------------------------------------------    193

Query        225 tlrmvdtaeykrrqyppgtkisakgfgkdrrlpITNRWREG-------------------    265
d1o97c_      194 -----pieevsladiglsandvgaaqsmsrvrrMYIPEKGRatmiegtiseqaakiiqii    248

Query        266 --h    266
d1o97c_      249 nef    251


hit structure      alignment
FAST alignment (Normalized score: 3.00 Raw score:776.50)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS--------------------------GGI     34
d1o97c_        1 -----------------------MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNE     37

Query         35 DSALVAAIACDALGAQ--------NVYGVSMPSKYSSDHSKGDAAELARRTG---LNFRT     83
d1o97c_       38 WDDFSLEEAMKI----KESSDTDVEVVVVSV----GPDRVDESLRKCLA---KGADRAVR     86

Query         84 VSIEPMFDAYMASLGLTGLAEENL---------QSRLRGTTLMAISNQEG-HIVLAPGNK    133
d1o97c_       87 ------------------------VWDDAAEGSDAIVVGRILTEVIKKEAPDMVFA----    118

Query        134 SELAVG-------YSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEAS    186
d1o97c_      119 ------GVQSSDQAYAS-------------------------------------------    129

Query        187 ITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKIS    246
d1o97c_      130 ------------------------------------------------------------    130

Query        247 AKGFGKDRRLPITNRWREGH----------------------------------------    266
d1o97c_      130 --------------------TGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGML    169

Query        267 ------------------------------------------------------------    267
d1o97c_      170 QEVEINCPAVLTIQLGINKPRYASPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPEKGR    229

Query        267 ----------------------    267
d1o97c_      230 ATMIEGTISEQAAKIIQIINEF    251


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:97.67)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS--------------------------GGI     34
d1o97c_        1 -----------------------MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNE     37

Query         35 DSALVAAIACDALG-A--QNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFD     91
d1o97c_       38 WDDFSLEEAMKIKESSDTDVEVVVVSVGP--DR-VDESLRKCLAK-GADRAVRVWD--DA     91

Query         92 AYMASLGLTGLAEE-NLQSRLRGTTLMAISNQEGHIVLAPGNKSE--LAVGYSTLYGDS-    147
d1o97c_       92 --A-----EG--SDAIVVGRILTEVIKKEA----PDMVFAGVQSSDQ--AYASTGISVAS    136

Query        148 -V-GAYGPIK---------------DVYK-T--------------SIFRLAEWRNRAAAE    175
d1o97c_      137 YLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGIN--KP-----    189

Query        176 RGQTPPIPE---------------------------------------------------    184
d1o97c_      190 ----RY-ASPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPEKGRATMIEGTISEQAAKI    244

Query        185 -------ASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRR    237
d1o97c_      245 IQIINEF-----------------------------------------------------    251

Query        238 QYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1o97c_      252 -----------------------------    252


hit structure      alignment
HHsearch alignment (Probability: 0.18 E-value:0.02)
DALI match                                                                   
Query          8 SALVVGLRAYVAKN-GFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHS     66
d1o97c_       41 FSLEEAMK--IKESSDTDVEVVVVSVGPDRVDESLRKCLAKGADRAVRVWDD-AAEGSDA     97

DALI match                  
Query         67 KGDAAELARRT     77
d1o97c_       98 IVVGRILTEVI    108



top
14: d1jmva_ Universal stress protein A,​ UspA (hh: 0.956)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.53  Contact: 886
Modified z-scores:
dali:0.97 daliz:0.96 gdtts:0.93 tmscore:0.94 rmsd:0.36 AHM:0.39 LBcontacta:0.91 LBcontactb:0.92 LHM:0.21
id:0.90 blosum:0.59 compass:0.63 pearson:0.96
Scaled scores:
dali:0.76 daliz:0.50 gdtts:0.56 tmscore:0.63 rmsd:0.77 AHM:0.67 LBcontacta:0.45 LBcontactb:0.66 LHM:0.32
id:0.05 blosum:0.11 compass:0.27 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 6.4 Raw score:517.70)
Query          1 dadeevysalvvglrayvaknGFRSVLIGLSGGIDSALVAAIACDALG--aqNVYGVSMP     58
d1jmva_        1 ---------------------MYKHILVAVDLSEESPILLKKAVGIAKrhdaKLSIIHVD     39

Query         59 S------------------kysSDHSKGDAAELARRTG---lNFRTVSIepmfdaymasl     97
d1jmva_       40 VnfsdlytglidvnmssmqdriSTETQKALLDLAESVDypisEKLSGSG-----------     88

Query         98 gltglaeenlqsrLRGTTLMAISNQEGH-IVLAPGNKseLAVG--YSTL----ygdsvgA    150
d1jmva_       89 -------------DLGQVLSDAIEQYDVdLLVTGHHQ--DFWSklMSSTrqvmntikidM    133

Query        151 YGPiKDVYktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgad    210
d1jmva_      134 LVV-PLRD----------------------------------------------------    140

Query        211 aivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1jmva_      141 --------------------------------------------------------    141


hit structure      alignment
FAST alignment (Normalized score: 4.82 Raw score:930.50)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ------NVYG     54
d1jmva_        1 ---------------------MYKHILVAVDLSEESPILLKKAVGI----AKRHDAKLSI     35

Query         55 VSMPSKYSS-----------------------DHSKGDAAELAR--RTGL-NFRTVSIEP     88
d1jmva_       36 IHVD-----VNFSDLYTGLIDVNMSSMQDRISTETQKALLDLAESVDYPISEKLSG----     86

Query         89 MFDAYMASLGLTGLAEENLQSR--LRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY-    144
d1jmva_       87 ----------------------SGDLGQVLSDAIEQYDVDLLVTGHH------------Q    112

Query        145 ------------GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDY    192
d1jmva_      113 DFWSKLMSSTRQVMNTIK------------------------------------------    130

Query        193 PVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGK    252
d1jmva_      131 ------------------------------------------------------------    131

Query        253 DRRLPITNRWREGH----------    266
d1jmva_      131 --------------IDMLVVPLRD    140


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:88.21)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALG--AQNVYGVSMP     58
d1jmva_        1 ---------------------MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVD     39

Query         59 SK---------------------YSSDHSKGDAAELARRT--GLNFRTVSIEPMFDAYMA     95
d1jmva_       40 VNFSDLYTGLIDVNMSSMQDRIS--TE-TQKALLDLAESVDYPISEKLSGS---------     87

Query         96 SLGLTGLAEENLQSRLRGTTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDS-VG----    149
d1jmva_       88 ------------G--DLGQVLSDAIEQYDVDLLVTGHH-QDFWSKLMS--STRQVMNTIK    130

Query        150 --AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDT    207
d1jmva_      131 IDMLV-VP-L-RD-----------------------------------------------    140

Query        208 GADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1jmva_      141 -----------------------------------------------------------    141


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.16)
DALI match                                                                   
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1jmva_       56 SMQDRISTETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQY-DVDLL--VTGHHQ    112

DALI match                                   
Query         61 YSSDHSKGDAAELARRTGLNFRTVSIEP     88
d1jmva_      113 DFWSKLMSSTRQVMNTIKIDMLVVPLRD    140



top
15: d1tq8a_ Hypothetical protein Rv1636 (hh: 0.952)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.65  Contact: 818
Modified z-scores:
dali:0.97 daliz:0.97 gdtts:0.95 tmscore:0.95 rmsd:0.30 AHM:0.35 LBcontacta:0.89 LBcontactb:0.89 LHM:0.24
id:0.93 blosum:0.87 compass:0.54 pearson:0.96
Scaled scores:
dali:0.77 daliz:0.51 gdtts:0.61 tmscore:0.67 rmsd:0.80 AHM:0.68 LBcontacta:0.43 LBcontactb:0.60 LHM:0.36
id:0.06 blosum:0.16 compass:0.26 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 6.9 Raw score:470.90)
Query          1 dadeevysalvvglrayvaKNGFRSVLIGLSGGIDSALVAAIACDALG-aQNVYGVSMPS     59
d1tq8a_        1 ------------------sLSAYKTVVVGTDGSDSSMRAVDRAAQIAGadAKLIIASAYL     42

Query         60 KysSDHSKGDAAELARRTG------LNFRTVSIepmfdaymaslgltglaeenlqsrLRG    113
d1tq8a_       43 P--TAPIYEILHDAKERAHnagaknVEERPIVG------------------------APV     76

Query        114 TTLMAISNQEGH-IVLAPGNksELAVgystlygdsvgaygpikdvyktsifrlaewrnra    172
d1tq8a_       77 DALVNLADEEKAdLLVVGNV--GLST----------------------------------    100

Query        173 aaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdta    232
d1tq8a_      101 ------------------------------------------------------------    101

Query        233 eykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1tq8a_      101 -------iagrllgsvpanvsrrakvdvlivhtt    127


hit structure      alignment
FAST alignment (Normalized score: 4.47 Raw score:821.20)
Query          1 DADEEVYSALVVGLRAYVAKN---GFRSVLIGLSGGIDSALVAAIACDALGAQ-----NV     52
d1tq8a_        1 ---------------------SLSAYKTVVVGTDGSDSSMRAVDRAAQI----AGADAKL     35

Query         53 YGVSMPSKYS----SDHSKGDAAELARRTG-LNFRTVSIEPMFDAYMASLGLTGLAEENL    107
d1tq8a_       36 IIASAYL---PTAPIYEILHDAKERAHNAGAKNVEERPIV--------------------     72

Query        108 QSR-LRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRL    165
d1tq8a_       73 ---GAPVDALVNLADEEKADLLVVGNV---------------------------------     96

Query        166 AEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKT    225
d1tq8a_       97 ------------------------------------------------------------     97

Query        226 LRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------------------    266
d1tq8a_       97 -----------------------------------------GLSTIAGRLLGSVPANVSR    115

Query        267 ------------    267
d1tq8a_      116 RAKVDVLIVHTT    127


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:89.30)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGA-QNVYGVSMPS     59
d1tq8a_        1 ------------------SLSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYL     42

Query         60 K-YSSDHSKGDAAELARRTG------LNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLR    112
d1tq8a_       43 PT--AP-IYEILHDAKERAHNAGAKNVEERPI-V--G---------------------AP     75

Query        113 GTTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNR    171
d1tq8a_       76 VDALVNLADEEKADLLVVGNV--G----L-------------------------------     98

Query        172 AAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDT    231
d1tq8a_       99 -----------------------------------------------------S-TIA-G    103

Query        232 AEYKRRQYPPGTKISAKG-FG------KDRRLPITNRWREGH    266
d1tq8a_      104 RLLGSV-PANVSRRAK-VD-VLIVHTT---------------    127


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.02)
DALI match       *************************   . . .........  .................
Query         23 FRSVLIGLSGGIDSALVAAIACDAL---GAQNVYGVSMPSKYSSDHSKGDAAELARRTGL     79
d1tq8a_        5 YKTVVVGTDGSDSSMRAVDRAAQIAGADAKL-IIASAYLPTAPIYEILHDAKERAHNAGA     63

DALI match       .......
Query         80 NFRTVSI     86
d1tq8a_       64 KNVEERP     70



hit structures. 
top
16: d1ll2a_ Glycogenin (svm: 0.738)

SCOP Superfamily: Nucleotide-​diphospho-​sugar transferases  |  SCOP Fold: Nucleotide-​diphospho-​sugar transferases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 1037
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.34 AHM:0.36 LBcontacta:0.93 LBcontactb:0.93 LHM:0.29
id:0.85 blosum:0.21 compass:0.17 pearson:0.91
Scaled scores:
dali:0.71 daliz:0.40 gdtts:0.56 tmscore:0.65 rmsd:0.79 AHM:0.71 LBcontacta:0.37 LBcontactb:0.56 LHM:0.26
id:0.02 blosum:0.06 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:554.40)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS---gGIDSALVAAIACDALGaQNVYGVSM     57
d1ll2a_        1 --------------------mtdQAFVTLTTndayAKGALVLGSSLKQHRTsRRLAVLTT     40

Query         58 PskyssdhSKGDAAELARRTGLNFRTVSIEP----MFDAYMAslgltglaEENLQSRLRG    113
d1ll2a_       41 P------qVSDTMRKALEIVFDEVITVDILDsgdsAHLTLMK--------RPELGVTLTK     86

Query        114 TTLmAISNQE-GHIVLAPGN--------------kselavgystlygdSVGA--------    150
d1ll2a_       87 LHC-WSLTQYsKCVFMDADTlvlaniddlfereelsaapdpgwpdcfnSGVFvyqpsvet    145

Query        151 ------------------------------------------------------------    151
d1ll2a_      146 ynqllhvaseqgsfdggdqgllntffnswattdirkhlpfiynlssisiysylpafkafg    205

Query        151 --ygPIKD----------------------vYKTSIFRLAEWRNRaaaergqtppIPEAs    186
d1ll2a_      206 anakVVHFlgqtkpwnytydtktksvrthpqFLNVWWDIFTTSVV---------pLLQQ-    255

Query        187 itkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkis    246
d1ll2a_      256 ------------------------------------------------------------    256

Query        247 akgfgkdrrlpitnrwregh    266
d1ll2a_      256 --------------------    256


hit structure      alignment
FAST alignment (Normalized score: 3.44 Raw score:896.40)
Query          1 DADEEVYSALVVGLRAYVAKNGF---RSVLIGLSG-----GIDSALVAAIACDALGAQ-N     51
d1ll2a_        1 -----------------------MTDQAFVTLT--TNDAYAKGALVLGSSLKQ-HRTSRR     34

Query         52 VYGVSMPSKYSSDHSKGDAAELARRTG-LNFRTVSIEPM------FDAYMASLGLTGLAE    104
d1ll2a_       35 LAVLT--TPQVSDTMRKALEIV-----FDEVITVDI---LDSGDSAHLTLMK-------R     77

Query        105 ENLQSRLRGTTLMAISNQ-EGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDV------    157
d1ll2a_       78 PELGVTLTKLHCW-SLTQYSKCVFMD----------------------------ADTLVL    108

Query        158 ------------------------------------------------------------    158
d1ll2a_      109 ANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLN    168

Query        158 ------------------------------------------------------------    158
d1ll2a_      169 TFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKT    228

Query        158 ----YKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIV    213
d1ll2a_      229 KSVRTHPQFLNVWWDIFT------------------------------------------    246

Query        214 AAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------    266
d1ll2a_      247 -----------------------------------------------------TSVVPLL    253

Query        267 --    267
d1ll2a_      254 QQ    255


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:103.49)
Query          1 DADEEVYSALVVGLRAYVA-KNGFRSVLIGLS-G-G-IDSALVAAIACDALGAQNVYGVS     56
d1ll2a_        1 ------------------MT---DQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLT     39

Query         57 MPSKYSSDHSKGDAAELARRTGLNFRTVSIE---PMFDAYMASLGLTGLAEENLQSRLRG    113
d1ll2a_       40 TP----Q--VSDTMRKALEIVFDEVITVDILDSGDSAHLTLM--KR----PE-LGVTLTK     86

Query        114 TTLMAISNQEG-HIVLAPGNK------------------SELAVG----YSTLYGDSVGA    150
d1ll2a_       87 LHCWSL-TQYSKCVFMDADTLVLANIDDLFEREELSAAP--DPGWPDCF------NSGVF    137

Query        151 -------------------------------------------------YG---------    152
d1ll2a_      138 VYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSY    197

Query        153 ------------PIKDV---YK--T------------S-IFRLAEWRNRAAAERGQTPPI    182
d1ll2a_      198 LPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSV----VPL-    252

Query        183 PE-ASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPP    241
d1ll2a_      253 LQQ---------------------------------------------------------    255

Query        242 GTKISAKGFGKDRRLPITNRWREGH    266
d1ll2a_      256 -------------------------    256


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:1.00)
DALI match                                                
Query          2 ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAI     42
d1ll2a_       11 TNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKAL     51



top
17: d1a3wa3 Pyruvate kinase,​ C-​terminal domain (svm: 0.690)

SCOP Superfamily: PK C-​terminal domain-​like  |  SCOP Fold: Pyruvate kinase C-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 933
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.96 tmscore:0.97 rmsd:0.37 AHM:0.39 LBcontacta:0.86 LBcontactb:0.90 LHM:0.20
id:0.66 blosum:0.19 compass:0.15 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.38 gdtts:0.53 tmscore:0.60 rmsd:0.76 AHM:0.66 LBcontacta:0.33 LBcontactb:0.53 LHM:0.39
id:-0.01 blosum:0.05 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 5.9 Raw score:475.00)
Query          1 ----DADEEVY--sALVVGLRAYVAKNGFRSVLIGLSGgidsALVAAIACDALGaqNVYG     54
d1a3wa3        1 dmrnCTPKPTStteTVAASAVAAVFEQKAKAIIVLSTS----GTTPRLVSKYRPncPIIL     56

Query         55 VSMpskyssdhSKGDAAELaRRTG-LNFRTVSIEPMfdaymaslgltglaeeNLQSRLRG    113
d1a3wa3       57 VTR--------CPRAARFS-HLYRgVFPFVFEKEPV----------------SDWTDDVE     91

Query        114 TTLMAISNQEG----------HIVLAPGNKSElavgystlygdsVGAYgpikdvyktsif    163
d1a3wa3       92 ARINFGIEKAKefgilkkgdtYVSIQGFKAGA--------ghsnTLQV------------    131

Query        164 rlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvv    223
d1a3wa3      132 ------------------------------------------------------------    132

Query        224 ktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1a3wa3      132 ----------------------------------------stv    134


hit structure      alignment
FAST alignment (Normalized score: 4.47 Raw score:844.00)
Query          1 DADE----------EVYSALVVGLRAYVAKNGFRSVLIGLSGGID-SALVAAIACDALGA     49
d1a3wa3        1 ----DMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLS-----TSGTTPRLVSK----     47

Query         50 Q-----NVYGVSMPSKYSSDH-SKGDAAELARRT-GLNFRTVSIEPMFDAYMASLGLTGL    102
d1a3wa3       48 -YRPNCPIILVT---------RCPRAARF-SHLYRGVFPFVFE-----------------     79

Query        103 A-----EENLQSRLRGTTLMAISNQE-------GHIVLAPGNKSELAVGYSTLYGDSVGA    150
d1a3wa3       80 -KEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYVSIQGFKA-----------------    121

Query        151 YGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGAD    210
d1a3wa3      122 ------------------------------------------------------------    122

Query        211 AIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH----    266
d1a3wa3      122 --------------------------------------------------------GAGH    125

Query        267 ---------    267
d1a3wa3      126 SNTLQVSTV    134


hit structure      alignment
TMalign alignment (TM-score: 0.32 Raw score:86.08)
Query          1 ---DADEEVYSA----L--VVGLRAYVAKNGFRSVLIGLS-GGIDSALVAAIACDALGAQ     50
d1a3wa3        1 DMR--NCTPKPTSTTETVAASAVA-AVFEQ-KAKAIIVLSTSGTTPRLVSKY-R--P---     50

Query         51 NVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSR    110
d1a3wa3       51 NCPIILVTR--CPR-AARFSHLY---R-G-VFPFVFE--KE--P----V---SDWTDDVE     91

Query        111 LRGTTLMA-IS---NQE--GHIVLAPGNKSELAVGYSTLYGDSVGAY--GPIKDVYKTSI    162
d1a3wa3       92 ARINFGIEKAKEFGILKKGDTYVSIQG---FK-AGAGH-S-NTLQVSTV-----------    134

Query        163 FRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELV    222
d1a3wa3      135 ------------------------------------------------------------    135

Query        223 VKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1a3wa3      135 --------------------------------------------    135


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.43)
DALI match                           
Query         37 ALVAAIACDALGAQNVYGVS     56
d1a3wa3       17 AASAVAAVFEQKAKAIIVLS     36



top
18: d1efvb_ Small,​ beta subunit of electron transfer flavoprotein ETFP (svm: 1.924)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.26  Contact: 1095
Modified z-scores:
dali:0.98 daliz:0.95 gdtts:0.87 tmscore:0.92 rmsd:0.70 AHM:0.59 LBcontacta:0.96 LBcontactb:0.95 LHM:0.21
id:0.98 blosum:0.48 compass:0.31 pearson:0.98
Scaled scores:
dali:0.74 daliz:0.43 gdtts:0.35 tmscore:0.44 rmsd:0.62 AHM:0.64 LBcontacta:0.44 LBcontactb:0.59 LHM:0.44
id:0.08 blosum:0.10 compass:0.23 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 6.1 Raw score:606.90)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS--------------------------GGI     34
d1efvb_        1 -----------------------LRVLVAVKrvidyavkirvkpdrtgvvtdgvkhsMNP     37

Query         35 DSALVAAIACDALG---aQNVYGVSMPSkyssdhSKGDAAELARRTGL-NFRTVSIE--P     88
d1efvb_       38 FCEIAVEEAVRLKEkklvKEVIAVSCGP-----aQCQETIRTALAMGAdRGIHVEVPpaE     92

Query         89 MFDaymaslgltglaeenLQSRLRGTTLMAISNQEGH-IVLAPGnkselavgYSTLyGDS    147
d1efvb_       93 AER---------------LGPLQVARVLAKLAEKEKVdLVLLGK---qaiddDCNQ-TGQ    133

Query        148 V-----------------------------------------gAYGPIKDVyktsifrLA    166
d1efvb_      134 MtagfldwpqgtfasqvtlegdklkvereidggletlrlklpaVVTADLRL------nEP    187

Query        167 EWrnraaaerGQTP-----------pipeasitkpdypvldailelyvdRDTGadaivaa    215
d1efvb_      188 RY------atLPNImkakkkkievikpgdlgvdltsklsvisvedppqrTAGV------k    235

Query        216 gYDRELVVKTLRMvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1efvb_      236 vETTEDLVAKLKE----------------------------------igri    252


hit structure      alignment
FAST alignment (Normalized score: 3.33 Raw score:861.30)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS--------------------------GGI     34
d1efvb_        1 -----------------------LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNP     37

Query         35 DSALVAAIACDALGAQ-------NVYGVSMPSKYSSDHSKGDAAELARRTG--LNFRTVS     85
d1efvb_       38 FCEIAVEEAVRL----KEKKLVKEVIAVSC----GPAQCQETIRTALAM--GADRGIHVE     87

Query         86 IEPMFDAYMASLGLTGLAEENL---------QSRLRGTTLMAISNQEG-HIVLAPGNKSE    135
d1efvb_       88 ----------------------VPPAEAERLGPLQVARVLAKLAEKEKVDLVLL------    119

Query        136 LAVG-------YSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASIT    188
d1efvb_      120 ----GKQAIDDDCNQ-TGQM----------------------------------------    134

Query        189 KPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAK    248
d1efvb_      135 ------------------------------------------------------------    135

Query        249 GFGKDRRLPITNRWREGH------------------------------------------    266
d1efvb_      135 ------------------TAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPA    176

Query        267 ------------------------------------------------------------    267
d1efvb_      177 VVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKV    236

Query        267 ----------------    267
d1efvb_      237 ETTEDLVAKLKEIGRI    252


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:79.17)
Query          1 ---------------------------------DAD--EEVY-SAL-VVGLRAYVAKNGF     23
d1efvb_        1 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKH--SMN--PFC-EIAVEEAVRLKEKKLV     55

Query         24 RSVLIGLSGG-IDSALVAAIACDALGAQNVYGVSMPSKYSSDHSK-GDAAELARRTGLNF     81
d1efvb_       56 KEVIAVSCGPAQCQETIRTALAMGA---DRGIHV-E---VPPAEAE--------------     94

Query         82 RTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYS    141
d1efvb_       95 --------------------R-LGPLQVARVLAKLAEKEK--VDLVLLGKQAIDD-DCNQ    130

Query        142 TLYGDSVG----------------------------------------AYGPIKDV---Y    158
d1efvb_      131 T--GQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTA-DLRLNE-    186

Query        159 KTSIFRL-AEWRNRAAAERGQTPP------------------------IPEASITKPDYP    193
d1efvb_      187 ------PR--YA--TLP-NIMKAKKKKIEVIKPGDLGVDLTSKLSVIS--------VE--    225

Query        194 VLDAILELYVDRDTGADAIVAAG-------------------YDRELVVKTLRMVDTAEY    234
d1efvb_      226 DP-------------P--QRTAGVKVETTEDLVAKLKEIGRI------------------    252

Query        235 KRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1efvb_      253 --------------------------------    253


hit structure      alignment
HHsearch alignment (Probability: 0.16 E-value:0.03)
DALI match                                                                   
Query          8 SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSD-HS     66
d1efvb_       41 IAVEEAVR--LKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGP     98

DALI match                  
Query         67 KGDAAELARRT     77
d1efvb_       99 LQVARVLAKLA    109



top
19: d1t57a_ Hypothetical protein MTH1675 (svm: 0.668)

SCOP Superfamily: PK C-​terminal domain-​like  |  SCOP Fold: Pyruvate kinase C-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 992
Modified z-scores:
dali:0.97 daliz:0.93 gdtts:0.94 tmscore:0.96 rmsd:0.44 AHM:0.47 LBcontacta:0.94 LBcontactb:0.92 LHM:0.22
id:0.92 blosum:0.55 compass:0.64 pearson:0.98
Scaled scores:
dali:0.70 daliz:0.37 gdtts:0.47 tmscore:0.56 rmsd:0.71 AHM:0.62 LBcontacta:0.38 LBcontactb:0.50 LHM:0.39
id:0.03 blosum:0.10 compass:0.17 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.8 Raw score:501.90)
Query          1 ---------dadeeVYSALVVGLRAYVAKNGFRSVLIGLSGgidsALVAAIACDALGaQN     51
d1t57a_        1 mekkicyfeepgkeNTERVLELVGERADQLGIRNFVVASVS----GETALRLSEMVE-GN     55

Query         52 VYGVSMPSK---YSSDhSKGD-AAELARRTGLNFRTVSI--ePMFDAYMASLGLtglaEE    105
d1t57a_       56 IVSVTHHAGfreKGQL-ELEDeARDALLERGVNVYAGSHalsGVGRGISNRFGG---vTP    111

Query        106 NL----------qsrlrgTTLMAISNQ-------eGHIVLAPGnkselavgystlygdsV    148
d1t57a_      112 VEimaetlrmvsqgfkvcVEIAIMAADaglipvdeEVIAIGGT-----------awgadT    160

Query        149 GAYgpikdvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtg    208
d1t57a_      161 ALV---------------------------------------------------------    163

Query        209 adaivaagydrelvvktlrmvdtaeykrrqyPPGTkisakgfgkdrrlpitnrwregh    266
d1t57a_      164 ----------------ltpahmnsvfdlrihEVIA-------------------mprp    186


hit structure      alignment
FAST alignment (Normalized score: 3.32 Raw score:738.10)
Query          1 DAD------------EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDS--ALVAAIACDA     46
d1t57a_        1 ---MEKKICYFEEPGKENTERVLELVGERADQLGIRNFVVAS------VSGETALRLSEM     51

Query         47 LGAQ--NVYGVSMPSKYSSDH-------------SKGDAAELARRTGLNFRTVSI-----     86
d1t57a_       52 V---EGNIVSVT---------HHAGFREKGQLELEDEARDALL-ERGVNVYAG--SHALS     96

Query         87 EPMFDAYMASLGLTGLAEENLQ-----------------------SRLRGTTLMAI----    119
d1t57a_       97 GVGRGISNR-------------FGGVTPVEIMAETLRMVSQGFKVCVEIAIMAAD-AGLI    142

Query        120 SNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQT    179
d1t57a_      143 PVDEEVIAIG--------------------------------------------------    152

Query        180 PPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQY    239
d1t57a_      153 ------------------------------------------------------------    153

Query        240 PPGTKISAKGFGKDRRLPITNRWREGH---------------------------------    266
d1t57a_      153 ---------------------------GTAWGADTALVLTPAHMNSVFDLRIHEVIAMPR    185

Query        267 -    267
d1t57a_      186 P    186


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:96.37)
Query          1 ---------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD     45
d1t57a_        1 MEKKICYFEEPGKEN------TERVLELVGERADQLGIRNFVVASVS---GE-TALRLSE     50

Query         46 ALGAQNVYGVSMPSKYSS--DHSKGD-AAELARRTGLNFRTVSIEPMFDAYMASL-GLTG    101
d1t57a_       51 MVE-GNIVSVTHHAGFREKGQLELEDEARDALLERGVNVYAGSHALSGVGRGISNRFGG-    108

Query        102 LAE--ENL--QSRL---------RG-TTLMA--I----SNQE-GHIVLAPGNKSELAVGY    140
d1t57a_      109 -VTPV--EIM--AETLRMVSQGFKVCVEIAIMAADAGLIPVDEEVIAIGGT---------    154

Query        141 STLYGDSVGAY----------------GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPE    184
d1t57a_      155 -AWG-ADTALVLTPAHMNSVFDLRIHE---------------------------------    179

Query        185 ASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTK    244
d1t57a_      180 ------------------------------------------------------VIAM--    183

Query        245 ISAKGFGKDRRLPITNRWREGH    266
d1t57a_      184 -----P-R-----P--------    186


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.04)
DALI match       *****************.    ********** .***********.... ..........
Query         16 AYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELAR     75
d1t57a_       25 ERADQLGIRNFVVASVSG----ETALRLSEMV-EGNIVSVTHHAGFREKGQLELEDEARD     79

DALI match       ..
Query         76 RT     77
d1t57a_       80 AL     81



top
20: d1jila_ Tyrosyl-​tRNA synthetase (TyrRS) (svm: 1.015)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 1049
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.97 tmscore:0.98 rmsd:0.37 AHM:0.35 LBcontacta:0.92 LBcontactb:0.95 LHM:0.20
id:0.83 blosum:0.11 compass:0.29 pearson:0.98
Scaled scores:
dali:0.73 daliz:0.41 gdtts:0.50 tmscore:0.64 rmsd:0.79 AHM:0.74 LBcontacta:0.35 LBcontactb:0.58 LHM:0.41
id:0.01 blosum:0.05 compass:0.22 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 6.1 Raw score:653.80)
Query          1 ---dadeeVYSAL-----vvglrayvAKNGFRSVLIGLS-----ggIDSALVAAIACDAL     47
d1jila_        1 tnvliedlKWRGLiyqqtdeqgiedlLNKEQVTLYCGADptadslhIGHLLPFLTLRRFQ     60

Query         48 G-aqNVYGVSMP--SKYS----------------SDHSKGDAAELARRTG-------LNF     81
d1jila_       61 EhghRPIVLIGGgtGMIGdpsgkseervlqteeqVDKNIEGISKQMHNIFefgtdhgAVL    120

Query         82 RTVS--IEPMfdAYMASL----------------------gltGLAEENLQSRLRGTTLM    117
d1jila_      121 VNNRdwLGQI--SLISFLrdygkhvgvnymlgkdsiqsrlehgISYTEFTYTILQAIDFG    178

Query        118 AISNQEGH-IVLAPGNkselavgystlyGDSV--------------gAYGPiKDVY----    158
d1jila_      179 HLNRELNCkIQVGGSD---------qwgNITSgielmrrmygqtdayGLTI-PLVTksdg    228

Query        159 ----------------------------------ktsifrLAEW----------------    168
d1jila_      229 kkfgksesgavwldaektspyefyqfwinqsdedvikflkYFTFlgkeeidrleqsknea    288

Query        169 --------rnRAAAerGQTPpipeasitkpdypvldailelyvdrdtgadaivaagydre    220
d1jila_      289 phlreaqktlAEEV--TKFI----------------------------------------    306

Query        221 lvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1jila_      307 -----------------------------hgedalndairisqalf    323


hit structure      alignment
FAST alignment (Normalized score: 2.35 Raw score:689.80)
Query          1 DADEEVYSA------------------LVVGLRAYVAKNGF--RSVLIGLSG--------     32
d1jila_        1 ---------TNVLIEDLKWRGLIYQQTDEQGIEDLLNK---EQVTLYCG---ADPTADSL     45

Query         33 ---GIDSALVAAIACDALGAQ-NVYGVSMPSKYS--------------------------     62
d1jila_       46 HIGHLLPFLTLRRFQE-----HGHRPIVLI----GGGTGMIGDPSGKSEERVLQTEEQVD     96

Query         63 --SDHSKGDAAELARRTGL-------NFRTVSIEPMFDAYMASLGLTG------------    101
d1jila_       97 KNIEGISKQMHNI------FEFGTDHGAVLVNNRDWLGQ---------ISLISFLRDYGK    141

Query        102 ---------------------LAEENLQSRLRGTTLMAISNQEGHIVLA---PGNKSELA    137
d1jila_      142 HVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNC----KIQVGGS----    193

Query        138 VGYSTLY-GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLD    196
d1jila_      194 -------DQWGN------------------------------------------------    198

Query        197 AILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRL    256
d1jila_      199 ------------------------------------------------------------    199

Query        257 PITNRWREGH--------------------------------------------------    266
d1jila_      199 ----------ITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSP    248

Query        267 ------------------------------------------------------------    267
d1jila_      249 YEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHG    308

Query        267 ---------------    267
d1jila_      309 EDALNDAIRISQALF    323


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:121.20)
Query          1 ------DADEEVYSALV--VG--L--RAYVAKNGFRSVLIGLSG----G-IDSALVAAIA     43
d1jila_        1 TNVLIE---DLKWRGLIYQ-QTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTL     56

Query         44 CDALG-AQNVYGVSMPS--K------------YS----S-DHSKGDAAELARRTG-----     78
d1jila_       57 RRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDH    116

Query         79 -LNFRTVS--IEPMFDAYMASL-----------------------GLTGLAEENLQSRLR    112
d1jila_      117 GAVLVNNRDWLGQI-SLISFLRDYGKHVGVNYMLGKDSIQSRLEH--GISYTEFTYTILQ    173

Query        113 GTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDS-VG------------AYGPIKDVYK    159
d1jila_      174 AIDFGHLNRELNCKIQVGGS--DQ--W--G--NITSGIELMRRMYGQTDAYGLTI--PLV    223

Query        160 TS-----IF-----------------------------R---LAEWRN------------    170
d1jila_      224 TKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQ    283

Query        171 -------------RAAAERGQTPP----------------IPEASITKPDYPVLDAILEL    201
d1jila_      284 SKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQALF--------------------    323

Query        202 YVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNR    261
d1jila_      324 ------------------------------------------------------------    324

Query        262 WREGH    266
d1jila_      324 -----    324


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.47)
DALI match                                                                   
Query        163 FRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVA--AGYDRE    220
d1jila_      203 IELMRRMYGQTDAYGLTIPLVTKSDGKK-FGKSESGAVWLDAEKTSPYEFYQFWINQSDE    261

DALI match                
Query        221 LVVKTLRMV    229
d1jila_      262 DVIKFLKYF    270



hit structures. 
top
21: d1fo8a_ N-​acetylglucosaminyltransferase I (cs: 2.665)

SCOP Superfamily: Nucleotide-​diphospho-​sugar transferases  |  SCOP Fold: Nucleotide-​diphospho-​sugar transferases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.29  Contact: 861
Modified z-scores:
dali:0.97 daliz:0.93 gdtts:0.91 tmscore:0.94 rmsd:0.59 AHM:0.56 LBcontacta:0.89 LBcontactb:0.95 LHM:0.22
id:0.50 blosum:0.03 compass:0.29 pearson:0.79
Scaled scores:
dali:0.73 daliz:0.40 gdtts:0.41 tmscore:0.49 rmsd:0.67 AHM:0.62 LBcontacta:0.32 LBcontactb:0.59 LHM:0.41
id:-0.03 blosum:0.01 compass:0.05 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:525.80)
Query          1 dadeevysalvvglrayvakNGFRSVLIGLSgGIDSALVAAIACDAL---gaQNVYGVSM     57
d1fo8a_        1 --------------------LAVIPILVIACdRSTVRRCLDKLLHYRpsaelFPIIVSQD     40

Query         58 PskySSDHSKGDAAElARRTgLNFRTVSIEPmfDAYMAsLGLTGlAEENLQSRLRGTTLM    117
d1fo8a_       41 C---GHEETAQVIAS-YGSA-VTHIRQPDLS--NIAVQ-PDHRK-FQGYYKIARHYRWAL     91

Query        118 AISNQE----GHIVLAPG---------------------------------------nks    134
d1fo8a_       92 GQIFHNfnypAAVVVEDDlevapdffeyfqatypllkadpslwcvsawndngkeqmvdss    151

Query        135 elavgystlygdSVGA---------------------------------------ygPIK    155
d1fo8a_      152 kpellyrtdffpGLGWlllaelwaelepkwpkafwddwmrrpeqrkgracvrpeisrTMT    211

Query        156 Dvyktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaa    215
d1fo8a_      212 F-----------------------------------------------------------    212

Query        216 gydrelvvktlrmvdtaeykrrqyppgTKIS-----------------------------    246
d1fo8a_      213 ---------------------glkfikLNQQfvpftqldlsylqqeaydrdflarvygap    251

Query        247 ----------------------------akgfgkdRRLPIT-------------------    259
d1fo8a_      252 qlqvekvrtndrkelgevrvqytgrdsfkafakalGVMDDLksgvpragyrgivtflfrg    311

Query        260 --nRWREGH----------    266
d1fo8a_      312 rrvHLAPPQtwdgydpswt    330


hit structure      alignment
FAST alignment (Normalized score: 2.91 Raw score:862.90)
Query          1 DADEEVYSALVVGLRAYVAKNGF---RSVLIGLSGGIDSALVAAIACDA--LGAQ--NVY     53
d1fo8a_        1 -----------------------LAVIPILVIACDRSTVRRCLDKLLH-YRPSAELFPII     36

Query         54 GVSMPSKY--SSDHSKGDAAELARRT---GLNFRTVSIEPMFDAYMAS--------LGLT    100
d1fo8a_       37 VSQ-----DCGHEETAQVIAS-----YGSAVTHIRQP-----------DLSNIAVQPDHR     75

Query        101 GLAEENLQSRLRGTTLMAISNQ----EGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKD    156
d1fo8a_       76 K-FQGYYKIARHYRWALGQIFHNFNYPAAVVVED--------------------------    108

Query        157 VYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAG    216
d1fo8a_      109 ------------------------------------------------------------    109

Query        217 YDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH----------    266
d1fo8a_      109 --------------------------------------------------DLEVAPDFFE    118

Query        267 ------------------------------------------------------------    267
d1fo8a_      119 YFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELE    178

Query        267 ------------------------------------------------------------    267
d1fo8a_      179 PKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGLKFIKLNQQFVPFTQLDLSYLQQEA    238

Query        267 ------------------------------------------------------------    267
d1fo8a_      239 YDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPR    298

Query        267 --------------------------------    267
d1fo8a_      299 AGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT    330


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:114.19)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS-----GGIDSALVAAIACDALGAQNVYGV     55
d1fo8a_        1 --------------L---A----VIPILVIACDRSTVRRCLDKLLHY-RP-SAELFPIIV     37

Query         56 SMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG-LTGLAEENLQSRLRGT    114
d1fo8a_       38 SQDCG-HEE--TAQVIA-SYG-SAVTHIRQPDLS-N-IA-VQPDHRK-FQGYYKIARHYR     88

Query        115 TLMAIS-NQEGH-IVLAP------------------------------GNKSEL------    136
d1fo8a_       89 WALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMV    148

Query        137 ----------AVGYSTLYGDSVGAY-----------------------------GPIKDV    157
d1fo8a_      149 DSSKPELLYRTDFFPG-L-GWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRA--CVRP    204

Query        158 YKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPV-LD--------------------    196
d1fo8a_      205 EISRTM-----------------------TFGLKFIKL-NQQFVPFTQLDLSYLQQEAYD    240

Query        197 --AILELYVD-RD----TG-ADAIVAAG-------------------YDRELVVKTLRMV    229
d1fo8a_      241 RD------FLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKA-FAKALGVMDDLK    293

Query        230 DTAEYKRR-------------QYPPGTKISAKG----FGKDR-RLPITNRWREGH    266
d1fo8a_      294 SGVPRAGYRGIVTFLFRGRRV-----------HLAPP----QTWDGYDPSWT---    330


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.40)
DALI match                              
Query          6 VYSALVVGLRAYVAKNGFRSVLI     28
d1fo8a_       83 IARHYRWALGQIFHNFNYPAAVV    105



top
22: d1o58a_ O-​acetylserine sulfhydrylase (Cysteine synthase) (svm: 1.490)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.24  Contact: 862
Modified z-scores:
dali:0.96 daliz:0.93 gdtts:0.91 tmscore:0.94 rmsd:0.54 AHM:0.56 LBcontacta:0.91 LBcontactb:0.95 LHM:0.30
id:0.94 blosum:0.52 compass:0.23 pearson:0.94
Scaled scores:
dali:0.73 daliz:0.40 gdtts:0.42 tmscore:0.53 rmsd:0.71 AHM:0.66 LBcontacta:0.35 LBcontactb:0.59 LHM:0.31
id:0.05 blosum:0.11 compass:0.20 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 6.3 Raw score:550.20)
Query          1 dadEEVYSA----------------------------------lvvgLRAYvAKNGFR--     24
d1o58a_        1 ---HHMMERligstpivrldsidsriflkleknnpggsvkdrpalfmILDA-EKRGLLkn     56

Query         25 SVLIGLSGGiDSALVAAIACDALGaqNVYGVSMPSkyssdhSKGDAAELARRTGLNFRTV     84
d1o58a_       57 GIVEPTSGN-MGIAIAMIGAKRGH--RVILTMPET------MSVERRKVLKMLGAELVLT    107

Query         85 SIEpmfdaymaslgltglaeenlQSRLRGTTLMAISNQEGHIVLAPGnkselavgystly    144
d1o58a_      108 PGE-------------------lGMKGAVEKALEISRETGAHMLNQF-------------    135

Query        145 gdsvgaygpiKDVYKTsifrlaewrnraaaergqtppipeasitkpdYPVLdailelyvd    204
d1o58a_      136 ------enpyNVYSHQ----------------------------fttGPEI---------    152

Query        205 rdtgadaivaAGYDREL-----------------------VVKTlrMVDT----------    231
d1o58a_      153 ------lkqmDYQIDAFvagvgtggtisgvgrvlkgffgnGVKI--VAVEpakspvlsgg    204

Query        232 ---------aeykrRQYP----------------------pgtkisakgfgkdrrlpitn    260
d1o58a_      205 qpgkhaiqgigagfVPKIldrsvidevitvedeeayemarylakkegllvgissganvaa    264

Query        261 rwREGH-----------------------    266
d1o58a_      265 alKVAQklgpdarvvtvapdhaerylsil    293


hit structure      alignment
FAST alignment (Normalized score: 3.50 Raw score:977.90)
Query          1 DADEEV------------------------------------YSALVVGLRAYVAKNG--     22
d1o58a_        1 ------HHMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLL     54

Query         23 FRSVLIGLSGGIDSALVAAIACDALGAQ---NVYGVSMPSKYSSDHSKGDAAELARRTGL     79
d1o58a_       55 KNGIVEPTS-GNMGIAIAMIGAK-----RGHRVILTMP--ETMSVERRKVLK----MLGA    102

Query         80 NFRTVSIEPMFDAYMASLGLTGLAEEN---LQSRLRGTTLMAISNQEGHIVLAPGNKSEL    136
d1o58a_      103 ELVLT----------------------PGELGMKGAVEKALEISRETGAHMLNQ------    134

Query        137 AVGYSTLYGDSVGAY---GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYP    193
d1o58a_      135 ---------------FENPYNVY-------------------------------------    142

Query        194 VLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKD    253
d1o58a_      143 ------------------------------------------------------------    143

Query        254 RRLPITNRWREGH-----------------------------------------------    266
d1o58a_      143 -------------SHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVK    189

Query        267 ------------------------------------------------------------    267
d1o58a_      190 IVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKK    249

Query        267 --------------------------------------------    267
d1o58a_      250 EGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL    293


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:111.63)
Query          1 -D-ADEEVY-----------------------------S--AL-VVGLRAYVAKNGFRSV     26
d1o58a_        1 HHMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKR--GLLKNGI     58

Query         27 LIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSI     86
d1o58a_       59 VEPTSGN-MGIAIAMIGAKR-GH-RVILTMPE---TM-S--VERRKVLKMLGA-ELVLTP    108

Query         87 EPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGD    146
d1o58a_      109 G--E----------------LGMKGAVEKALEISRETGAHMLNQ---------------F    135

Query        147 SVGAYGPIKDVYK-TSI-FR-----------LAEWRNRAAAERGQTPPIPEASITKPDYP    193
d1o58a_      136 E---NPYNVYSHQFTTGP-EILKQMDYQIDA-------------------------FVAG    166

Query        194 -----VL-DAILELYVDRDTGADAIVAAGYDRELVVKT--------LRM-----------    228
d1o58a_      167 VGTGGTISGVGRVLK--GFFGN-GV---------KIVAVEPAKSPV--LSGGQPGKHAIQ    212

Query        229 ------VDTAEYKRRQYPPGTKISAKGFGKDRRL-PITNRWREG----------------    265
d1o58a_      213 GIGAGF----VPKI--L----------D----RSV------IDEVITVEDEEAYEMARYL    246

Query        266 -----------------------------------------------H    266
d1o58a_      247 AKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL-    293


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.06)
DALI match                                                              
Query          2 ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVS     56
d1o58a_      235 EDEEAYEMARYLAKKE-------GLLVGISSGANVAAALKVAQKLGPDARVVTVA    282



top
23: d1j0aa_ 1-​aminocyclopropane-​1-​carboxylate deaminase (svm: 0.705)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 981
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.97 tmscore:0.98 rmsd:0.38 AHM:0.41 LBcontacta:0.94 LBcontactb:0.95 LHM:0.21
id:0.96 blosum:0.24 compass:0.17 pearson:0.96
Scaled scores:
dali:0.71 daliz:0.39 gdtts:0.52 tmscore:0.64 rmsd:0.78 AHM:0.70 LBcontacta:0.36 LBcontactb:0.54 LHM:0.41
id:0.05 blosum:0.07 compass:0.19 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:607.90)
Query          1 -----------------------------------------DADEEVY------salvVG     13
d1j0aa_        1 mhpkifallakfprvelipwetpiqylpnisreigadvyikRDDLTGLgiggnkirklEY     60

Query         14 LRAYVAKNGFRSVLIGLS-GGIDSALVAAIACDALGaqNVYGVSMPskySSDHskGDAAE     72
d1j0aa_       61 LLGDALSKGADVVITVGAvHSNHAFVTGLAAKKLGL--DAILVLRG---KEEL--KGNYL    113

Query         73 LARRTGLNFRTVSIEpmfdaymaslgltglaeenlQSRLRGTTLMAISNQEG-----HIV    127
d1j0aa_      114 LDKIMGIETRVYDAK--------------------DSFELMKYAEEIAEELKregrkPYV    153

Query        128 LA-PGNKselavgystlygdsvgaygpIKDVYktsifrlaewrnraaaergqtppipeas    186
d1j0aa_      154 IPpGGAS------------------piGTLGY--------vravgeiatqsevkfdsivv    187

Query        187 itkpdypvldailELYVdRDTGAdaivaagydrelvvkTLRM------vdtaEYKRRQYp    240
d1j0aa_      188 aagsggtlaglslGLSI-LNEDI---------------RPVGiavgrfgevmTSKLDNL-    230

Query        241 pgtkisakGFGK-DRRL-------------------------------------------    256
d1j0aa_      231 -----ikeAAELlGVKVevrpelydysfgeygkitgevaqiirkvgtregiildpvytgk    285

Query        257 ------------------------------pitnrwregh    266
d1j0aa_      286 afyglvdlarkgelgekilfihtggisgtfhygdkllsll    325


hit structure      alignment
FAST alignment (Normalized score: 3.52 Raw score:1034.00)
Query          1 DADE---------------------------------------------------EVYSA      9
d1j0aa_        1 ----MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIR     56

Query         10 LVVGLRAYVAKNGFRSVLIGLSG--GIDSALVAAIACDALGAQ---NVYGVSMPSKYSSD     64
d1j0aa_       57 KLEYLLGDALSKGADVVITVGA-VHSNHAFVTGLAAKK-----LGLDAILVL--------    102

Query         65 HS-----KGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENL--QSRLRGTTLM    117
d1j0aa_      103 --RGKEELKGNYLLDKIMGIETRVYD----------------------AKDSFELMKYAE    138

Query        118 AISNQ-----EGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRA    172
d1j0aa_      139 EIAEELKREGRKPYVI--------------------------------------------    154

Query        173 AAERGQTPPIPEASITKPDY---------------------------------------P    193
d1j0aa_      155 --------------------PPGGASPIGTLGYVRAVGEIATQSEVKFDSIVVAAGSGGT    194

Query        194 VLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKD    253
d1j0aa_      195 LAGLSLGL-SILNE----------------------------------------------    207

Query        254 RRLPITNRWREGH-----------------------------------------------    266
d1j0aa_      208 -------------DIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGVKVEVRPELYDYSFG    254

Query        267 ------------------------------------------------------------    267
d1j0aa_      255 EYGKITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARKGELGEKILFIHTGGISGT    314

Query        267 -----------    267
d1j0aa_      315 FHYGDKLLSLL    325


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:88.80)
Query          1 ------DADEEV------------------------------------------------      6
d1j0aa_        1 MHPKIFALLAKFPRVELIPWETPIQYLPNISREIGADVYIKRDDLTGLGIGGNKIRKLEY     60

Query          7 ------------------------------------------------------------      7
d1j0aa_       61 LLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKGNYLLDKIMGI    120

Query          7 --------------------------------------------Y--SALVVGLRAYVAK     20
d1j0aa_      121 ETRVYDAKDSFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQS-E    179

Query         21 NGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELAR-----     75
d1j0aa_      180 VKFDSIVVAAGSGGTLAGLSLGLSILNE-DIRPVGIAVGR-FGEVMTSKLDNLIKEAAEL    237

Query         76 ----RTGLNFRTVSIEPM--FDAYM-ASL-------------GLTGLAEENLQS-RLRGT    114
d1j0aa_      238 LGVKVEVRPELYDYSFGEYGKITGEV-AQIIRKVGTREGIIL--------DPVYTGKAFY    288

Query        115 TLMAISN-Q-EG--HIVLAPGNKSELAVGYST-----------LYGDSVGAYGPIKDVYK    159
d1j0aa_      289 GLVDLARKGELGEKILFIHTG---G---ISGTFHYGDKLLSLL-----------------    325

Query        160 TSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDR    219
d1j0aa_      326 ------------------------------------------------------------    326

Query        220 ELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1j0aa_      326 -----------------------------------------------    326


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.29)
DALI match        ********************................. ...  ....   ****. ...
Query         11 VVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA     70
d1j0aa_       58 LEYLLGDALSKGADVVITVGAVHSNHAFVTGLAAKKLGLDAI--LVLR--GKEELKGNYL    113

DALI match       ...............
Query         71 AELARRTGLNFRTVS     85
d1j0aa_      114 LDKIMGIETRVYDAK    128



top
24: d1ga8a_ Galactosyltransferase LgtC (cs: 2.629)

SCOP Superfamily: Nucleotide-​diphospho-​sugar transferases  |  SCOP Fold: Nucleotide-​diphospho-​sugar transferases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.20  Contact: 945
Modified z-scores:
dali:0.96 daliz:0.92 gdtts:0.95 tmscore:0.96 rmsd:0.39 AHM:0.39 LBcontacta:0.88 LBcontactb:0.93 LHM:0.21
id:0.95 blosum:0.48 compass:0.25 pearson:0.94
Scaled scores:
dali:0.70 daliz:0.35 gdtts:0.49 tmscore:0.58 rmsd:0.76 AHM:0.68 LBcontacta:0.35 LBcontactb:0.60 LHM:0.34
id:0.05 blosum:0.09 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:489.50)
Query          1 dadeevysalvvglrayvakngfRSVLIGL---SGGIdSALVAAIACDAL--gaQNVYGV     55
d1ga8a_        1 -----------------------MDIVFAAddnYAAY-LCVAAKSVEAAHpdteIRFHVL     36

Query         56 SMPskyssdhSKGDAAELARRT-----GLNFRTVSIEPMFDAYmaslgltglAEENlqSR    110
d1ga8a_       37 DAG------iSEANRAAVAANLrggggNIRFIDVNPEDFAGFP--------lNIRH--IS     80

Query        111 LRGTTLMAI--sNQEG--HIVLAPG--------------------nkseLAVG-------    139
d1ga8a_       81 ITTYARLKLgeyIADCdkVLYLDIDvlvrdsltplwdtdlgdnwlgasiDLFVerqegyk    140

Query        140 ------ystlygdSVGA-------------------------------------------    150
d1ga8a_      141 qkigmadgeyyfnAGVLlinlkkwrrhdifkmssewveqykdvmqyqdqdilnglfkggv    200

Query        151 -----------------------------------ygPIKD-------------vYKTSI    162
d1ga8a_      201 cyansrfnfmptnyafmasrhtdplyrdrtntvmpvaVSHYcgpakpwhrdctawGAERF    260

Query        163 FRLAEWRNraaaergqtppipEASITKpdypvldailelyvdrdtgadaivaagydrelv    222
d1ga8a_      261 TELAGSLT----------tvpEEWRGK---------------------------------    277

Query        223 vktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1ga8a_      278 -------------------------------------------l    278


hit structure      alignment
FAST alignment (Normalized score: 2.79 Raw score:758.30)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSG---GIDSALVAAIACDALGA-----QNV     52
d1ga8a_        1 -----------------------MDIVFAAD-DNYAAYLCVAAKSVEAA---HPDTEIRF     33

Query         53 YGVSMPSKY--SSDHSKGDAAELARRT------GLNFRTVSIEPMFDAYMASLGLTGLAE    104
d1ga8a_       34 HVLD-----AGISEANR---AAVAAN-LRGGGGNIRFIDVNPED----------------     68

Query        105 E-----------NLQSRLRGTTLMAISNQ---EGHIVLAPGNKSELAVGYSTLYGDSVGA    150
d1ga8a_       69 -FAGFPLNIRHISITT-YARLKLGEYI--ADCDKVLYLDI--------------------    104

Query        151 YGPIKDVYKTSI------------------------------------------------    162
d1ga8a_      105 ------------DVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGEYYF    152

Query        163 ------------------------------------------------------------    163
d1ga8a_      153 NAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFKGGVCYANSRFNFMPT    212

Query        163 --------------------------------------------FRLAEWRNRAAAERGQ    178
d1ga8a_      213 NYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAG-------    265

Query        179 TP---PIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYK    235
d1ga8a_      266 --SLTTVPEEWR------------------------------------------------    275

Query        236 RRQYPPGTKISAKGFGKDRRLPITNRWREGH---    266
d1ga8a_      276 -------------------------------GKL    278


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:99.98)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS---GGIDSALVAAIACDALGAQNVYGVSM     57
d1ga8a_        1 ------------------------MDIVFAADDNYAAYLCVAAKSVEAAHPDTEIRFHVL     36

Query         58 PSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAE-ENLQSRLRGTTL    116
d1ga8a_       37 DAG-ISEANRAAVAANLRGGGGNIRFIDVN--PEDFA--G-FPLNIRHISITTYA-RLKL     89

Query        117 MA-ISNQEGHIVLAPGNK------------------------------------------    133
d1ga8a_       90 GEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGE    149

Query        134 ---SELAVGYSTLYGDSVGA----------------------------------------    150
d1ga8a_      150 YYF------------NAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFK    197

Query        151 ---------YG-----------------------------PIKD----VYK-T-------    160
d1ga8a_      198 GGVCYANSRFNFMPTNYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGA    257

Query        161 S-IFRLAEWRNRAAAERGQTPPIPEA-SITKPDYPVLDAILELYVDRDTGADAIVAAGYD    218
d1ga8a_      258 ERFTELAG-SL---------T--TVPEEWRG-KL--------------------------    278

Query        219 RELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1ga8a_      279 ------------------------------------------------    279


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.33)
DALI match       . ............  .........    .  .......................
Query         34 IDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEP     88
d1ga8a_       12 AAYLCVAAKSVEAAHPDTEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVNP     66



top
25: d1a49a3 Pyruvate kinase,​ C-​terminal domain (svm: 0.691)

SCOP Superfamily: PK C-​terminal domain-​like  |  SCOP Fold: Pyruvate kinase C-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.50  Contact: 838
Modified z-scores:
dali:0.96 daliz:0.93 gdtts:0.93 tmscore:0.95 rmsd:0.38 AHM:0.40 LBcontacta:0.89 LBcontactb:0.91 LHM:0.19
id:0.97 blosum:0.68 compass:0.35 pearson:0.97
Scaled scores:
dali:0.70 daliz:0.38 gdtts:0.49 tmscore:0.56 rmsd:0.76 AHM:0.67 LBcontacta:0.38 LBcontactb:0.58 LHM:0.45
id:0.07 blosum:0.11 compass:0.21 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 5.2 Raw score:440.10)
Query          1 ------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGgidsALVAAIACDALGaqNVYG     54
d1a49a3        1 elarssSHSTDLMEAMAMGSVEASYKCLAAALIVLTES----GRSAHQVARYRPraPIIA     56

Query         55 VSMpskyssdhsKGDAAELARRTG-LNFRTVSIEPmfdaymaslgltglaEENLQS-RLR    112
d1a49a3       57 VTR---------NHQTARQAHLYRgIFPVVCKDPV--------------qEAWAEDvDLR     93

Query        113 GTTLMAISNQE-------GHIVLAPGNkselavgystlygdsvgaygpikdvyktsifrl    165
d1a49a3       94 VNLAMNVGKARgffkkgdVVIVLTGWR---------------------------------    120

Query        166 aewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvkt    225
d1a49a3      121 ------------------------------------------------------------    121

Query        226 lrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1a49a3      121 --------------------------pgsgftntmrvvpvp    135


hit structure      alignment
FAST alignment (Normalized score: 4.32 Raw score:818.10)
Query          1 DADE----------EVYSALVVGLRAYVAKNGFRSVLIGLSGGIDS--ALVAAIACDALG     48
d1a49a3        1 ----ELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLT------ESGRSAHQVAR---     47

Query         49 AQ-----NVYGVSMPSKY-SSDHSKGDAAELARR--TGLNFRTVSIEPMFDAYMASLGLT    100
d1a49a3       48 --YRPRAPIIAV------TRNHQTARQAH-----LYRGIFPVVCK-DPVQ----------     83

Query        101 GLA-EENLQSRLRGTTLMAISNQE-------GHIVLAPGNKSELAVGYSTLYGDSVGAYG    152
d1a49a3       84 ---EAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLT-----------------------    117

Query        153 PIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAI    212
d1a49a3      118 ------------------------------------------------------------    118

Query        213 VAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH------    266
d1a49a3      118 ------------------------------------------------------GWRPGS    123

Query        267 ------------    267
d1a49a3      124 GFTNTMRVVPVP    135


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:87.91)
Query          1 -----DADEEVY-SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYG     54
d1a49a3        1 ELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLT-ES---GRSAHQVARYRPRAPIIA     56

Query         55 VSMPSKYSSDHSKGDAAELARRTG-LNFRTVSIEPMFDAYMASLGLTGLAEENL-QS-RL    111
d1a49a3       57 VT-R-------NHQTARQ-AHLYRGIFPVVCKDP--V-------------QEAWAEDVDL     92

Query        112 RGTTLMAISNQ---EG----HIVLAPGNKSELAVGYSTLYGD-SVGAYGPIKDVYKTSIF    163
d1a49a3       93 RVNLAMNVG-KARGFFKKGDVVIVLTG----W---R-PG--SG------FTN--------    127

Query        164 RLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVV    223
d1a49a3      128 ------------------------------------------------------------    128

Query        224 KTLRMVDTAEYKRRQYPPG----TKISAKGFGKDRRLPITNRWREGH    266
d1a49a3      128 ---------------TMRVVPVP------------------------    135


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.45)
DALI match                           
Query         37 ALVAAIACDALGAQNVYGVS     56
d1a49a3       17 AMGSVEASYKCLAAALIVLT     36



hit structures. 
top
26: d1od6a_ Phosphopantetheine adenylyltransferase (svm: 1.593)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.52  Contact: 934
Modified z-scores:
dali:0.97 daliz:0.95 gdtts:0.95 tmscore:0.96 rmsd:0.34 AHM:0.32 LBcontacta:0.91 LBcontactb:0.91 LHM:0.20
id:0.95 blosum:0.35 compass:0.26 pearson:0.92
Scaled scores:
dali:0.73 daliz:0.43 gdtts:0.55 tmscore:0.63 rmsd:0.78 AHM:0.73 LBcontacta:0.43 LBcontactb:0.61 LHM:0.38
id:0.07 blosum:0.07 compass:0.19 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 6.0 Raw score:506.10)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS---GGIDSALVAAIACDALGaqNVYGVSM     57
d1od6a_        1 -----------------------MHVVYPGSfdpLTNGHLDVIQRASRLFE--KVTVAVL     35

Query         58 PSkYSSD---HSKGDAAELARRTG-LNFRTVSIepmfdaymaslgltglaeenlqsrlrg    113
d1od6a_       36 EN-QYLFsaeERLAIIREATAHLAnVEAATFSG---------------------------     67

Query        114 tTLMAISNQEGH-IVLAPGNKSELavGYST--------lygdsvGAYGPIkdvykTSIF-    163
d1od6a_       68 -LLVDFVRRVGAqAIVKGLRAVSD--YEYElqmahlnrqlypglETLFIL---aaTRYSf    121

Query        164 -rlaewrnraaaergqtppiPEASITKpdypvldailelyvdrdtgadaivaagydrelv    222
d1od6a_      122 vsstmvkeiaryggdvsklvPPATLRA---------------------------------    148

Query        223 vktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1od6a_      149 -------------------------------------lkaklgq    155


hit structure      alignment
FAST alignment (Normalized score: 3.30 Raw score:670.10)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS----GGIDSALVAAIACDALGAQ-NVYGV     55
d1od6a_        1 -----------------------MHVVYPG-SFDPLTNGHLDVIQRASRLF---EKVTVA     33

Query         56 SMPSKYS---SDHSKGDAAELARRT-GLNFRTVSIEPMFDAYMASLGLTGLAEENL----    107
d1od6a_       34 VL-ENQYLFSAEERLAIIREATAHLANVEAATF-----------------------SGLL     69

Query        108 --------------------QSRLRGTTLMAISNQ-EGHIVLAP--GNKSELAVGYSTLY    144
d1od6a_       70 VDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLF-ILAATR----------    118

Query        145 GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVD    204
d1od6a_      119 ------------------------------------------------------------    119

Query        205 RDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE    264
d1od6a_      119 ------------------------------------------------------------    119

Query        265 GH-------------------------------------    266
d1od6a_      119 --YSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ    155


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:89.59)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGL-S--GGIDSALVAAIACDALGAQNVYGVSM     57
d1od6a_        1 -----------------------MHVVYPGSFDPLTNGHLDVIQRASRLFE--KVTVAVL     35

Query         58 PSKYSSD--HSKGDAAELARRTG-LNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGT    114
d1od6a_       36 ENQYLFSAEERLAIIREATAHLANVEAATF-S------------------------G--L     68

Query        115 TLMAISNQ-EGHIVLAPGNKSELAVGYSTLYGDSVG-----------AYGPIKDVYKTSI    162
d1od6a_       69 L-VDFVRRVGAQAIVKGLRAVSDY-E--Y--ELQMAHLNRQLYPGLETLFIL--A-A-TR    118

Query        163 FR--------------------LAEWRNRAAAERGQTPPIPEASIT-K------PDYPVL    195
d1od6a_      119 YSFVSSTMVKEIARYGGDVSKL-----------------VPPATLRALKAKLGQ------    155

Query        196 DAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRR    255
d1od6a_      156 ------------------------------------------------------------    156

Query        256 LPITNRWREGH    266
d1od6a_      156 -----------    156


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.49)
DALI match       ..... ..................          
Query         55 VSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEP     88
d1od6a_       31 TVAVLENQYLFSAEERLAIIREATAHLANVEAAT     64



top
27: d1rq2a1 Cell-​division protein FtsZ (svm: 0.859)

SCOP Superfamily: Tubulin nucleotide-​binding domain-​like  |  SCOP Fold: Tubulin nucleotide-​binding domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.24  Contact: 787
Modified z-scores:
dali:0.93 daliz:0.92 gdtts:0.91 tmscore:0.92 rmsd:0.33 AHM:0.35 LBcontacta:0.89 LBcontactb:0.87 LHM:0.24
id:0.94 blosum:0.57 compass:0.32 pearson:0.92
Scaled scores:
dali:0.73 daliz:0.45 gdtts:0.51 tmscore:0.61 rmsd:0.80 AHM:0.73 LBcontacta:0.39 LBcontactb:0.55 LHM:0.40
id:0.06 blosum:0.10 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:501.90)
Query          1 ------------------------------------------------------------      1
d1rq2a1        1 avikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstgadpe     60

Query          1 ---dadeeVYSALVVGLRAYvakngfRSVLIGLS-----GGIDSALVAAIACDALGaqNV     52
d1rq2a1       61 vgrkaaedAKDEIEELLRGA------DMVFVTAGegggtGTGGAPVVASIARKLGA--LT    112

Query         53 YGVSMPSKY-----SSDHSKGDAAELARrtgLNFRTVSIEPmFDAYMAsLGLTGLAEENL    107
d1rq2a1      113 VGVVTRPFSfegkrRSNQAENGIAALRE-scDTLIVIPNDR-LLQMGD-AAVSLMDAFRS    169

Query        108 QSRLRGTTLMAISNQEGhivlapgnkselavgystlygdsvgaygpikdvyktsifrlae    167
d1rq2a1      170 ADEVLLNGVQGITDLIT-------------------------------------------    186

Query        168 wrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlr    227
d1rq2a1      187 ------------------------------------------------------------    187

Query        228 mvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1rq2a1      187 ---------------------------------tpglin    192


hit structure      alignment
FAST alignment (Normalized score: 4.23 Raw score:955.10)
Query          1 DA----------------------------------------------------------      2
d1rq2a1        1 --AVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTGAD     58

Query          3 -------DEEVYSALVVGLRAYVAKNGFRSVLIGLSG-------GIDSALVAAIACDALG     48
d1rq2a1       59 PEVGRKAAEDAKDEIEELLRG------ADMVFVTA--GEGGGTGTGGAPVVASIARK---    107

Query         49 AQ---NVYGVS-MPSKYSSDHSKGDAAELARRTG-----LNFRTVSIEPMFDAYMASLGL     99
d1rq2a1      108 --LGALTVGVVTRPFSFEGKRRSNQAENGIAA--LRESCDTLIVIPNDRLLQMGDA----    159

Query        100 TGLA--EENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDV    157
d1rq2a1      160 ----AVSLMDAFRSADEVLLNGVQG-----------------------------------    180

Query        158 YKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGY    217
d1rq2a1      181 ------------------------------------------------------------    181

Query        218 DRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-----------    266
d1rq2a1      181 -------------------------------------------------ITDLITTPGLI    191

Query        267 -    267
d1rq2a1      192 N    192


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:94.97)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSK     60
d1rq2a1        1 ----------------------AVIKVVGIG-GGGVNAVNRMIEQGLK-GVEFIAIN---     33

Query         61 YSSDHSKGDAAELARRTGLNFRTVSIEPMF-----DAYMASLGLTGLAEENLQSRLRGTT    115
d1rq2a1       34 -T---DAQALLMSD----ADVKLDVGR--DSTGAD-----------PEVGRKAAEDAKDE     72

Query        116 LMAISNQEGHIVLAPGNKSEL-AVGYSTLYGDS-VG---------AYGPIKDVYKTSIFR    164
d1rq2a1       73 IEELLR-GADMVFVTAGEGGGT---GTG--GAPVVASIARKLGALTVGVV--TRPF----    120

Query        165 LAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVK    224
d1rq2a1      121 --------------------------SFEGKR-RS-------------------------    128

Query        225 TLRMVDTAEYKRRQYP-PGTKIS-------------------------------------    246
d1rq2a1      129 NQ-AE-NGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLIT    186

Query        247 ------AKGFGKDRRLPITNRWREGH    266
d1rq2a1      187 TPGLIN--------------------    192


hit structure      alignment
HHsearch alignment (Probability: 0.23 E-value:0.01)
DALI match         ............    . ....................  ..... ............
Query          4 EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIA--CDALGAQNVYGVSMPSKY     61
d1rq2a1       63 RKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSF    122

DALI match       ..............  
Query         62 SSDHSKGDAAELARRT     77
d1rq2a1      123 EGKRRSNQAENGIAAL    138



top
28: d1p5ja_ L-​serine dehydratase (svm: 1.485)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 940
Modified z-scores:
dali:0.95 daliz:0.92 gdtts:0.91 tmscore:0.94 rmsd:0.51 AHM:0.54 LBcontacta:0.91 LBcontactb:0.92 LHM:0.29
id:0.93 blosum:0.22 compass:0.16 pearson:0.93
Scaled scores:
dali:0.72 daliz:0.38 gdtts:0.43 tmscore:0.52 rmsd:0.71 AHM:0.65 LBcontacta:0.36 LBcontactb:0.54 LHM:0.36
id:0.05 blosum:0.07 compass:0.18 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:554.60)
Query          1 --------------------------DADEEVY-----salvvGLRAYVAKNGFRSVLIG     29
d1p5ja_        1 geplhvktpirdsmalskmagtsvylKMDSAQPsgsfkirgigHFCKRWAKQGCAHFVCS     60

Query         30 LSgGIDSALVAAIACDALGaqNVYGVSMPSkyssdhSKGDAAELARRTGLNFRTVSIepm     89
d1p5ja_       61 SA-GNAGMAAAYAARQLGV--PATIVVPGT------TPALTIERLKNEGATCKVVGE---    108

Query         90 fdaymaslgltglaeenlQSRLRGTTLMAISNQEG-HIVLAPG----------nkselav    138
d1p5ja_      109 ------------------LLDEAFELAKALAKNNPgWVYIPPFddpliweghasivkelk    150

Query        139 gystlygdsvgaygpiKDVYktsifrlaewrnraaaergqtppipeasitkpdypvldAI    198
d1p5ja_      151 etlwekpgaialsvggGGLL----------------------cgvvqglqecgwgdvpVI    188

Query        199 LElyvdrdtgadaivaagydrelvvktLRMVD---------tAEYK-------------R    236
d1p5ja_      189 AM------------------------eTFGAHsfhaattagkLVSLpkitsvakalgvkT    224

Query        237 RQYppgtkisakgFGKDR--rlpitnrwREGH----------------------------    266
d1p5ja_      225 VGS---------qALKLFqehpifseviSDQEavaaiekfvddekilvepacgaalaavy    275

Query        267 --------------------------------------------    267
d1p5ja_      276 shviqklqlegnlrtplpslvvivcggsnislaqlralkeqlgm    319


hit structure      alignment
FAST alignment (Normalized score: 3.28 Raw score:955.80)
Query          1 DADEE-------------------------------------VYSALVVGLRAYVAKNGF     23
d1p5ja_        1 -----GEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRW-AKQGC     54

Query         24 RSVLIGLSGGIDSALVAAIACDALGAQ---NVYGVSMPSKYSSDHSKGDAAELARRTGLN     80
d1p5ja_       55 AHFVCSS-AGNAGMAAAYAARQ-----LGVPATIVV--PGTTPALTIERLKN----EGAT    102

Query         81 FRTVSIEPMFDAYMASLGLTGLAEENL--QSRLRGTTLMAISNQE-GHIVLAPGNKSELA    137
d1p5ja_      103 CKVV-----------------------GELLDEAFELAKALAKNNPGWVYIP--------    131

Query        138 VGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDA    197
d1p5ja_      132 ------------------------------------------------------------    132

Query        198 ILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLP    257
d1p5ja_      132 ------------------------------------------------------------    132

Query        258 ITNRWREGH---------------------------------------------------    266
d1p5ja_      132 ---------PFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQECGW    182

Query        267 ------------------------------------------------------------    267
d1p5ja_      183 GDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEV    242

Query        267 ------------------------------------------------------------    267
d1p5ja_      243 ISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGG    302

Query        267 -----------------    267
d1p5ja_      303 SNISLAQLRALKEQLGM    319


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:110.05)
Query          1 -----DAD-----------------------EE---V-YSALVVGLRAYVAKNGFRSVLI     28
d1p5ja_        1 GEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQ-GCAHFVC     59

Query         29 GLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEP     88
d1p5ja_       60 SSA-GNAGMAAAYAARQL-G-VPATIVVPG---T---TPALTIERLKNEGATCKVVG-E-    108

Query         89 MFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLYGDS    147
d1p5ja_      109 -------------------LLDEAFELAKALAKNNPGWVYIPPF---------------D    134

Query        148 VGAYGPIKDVY-KTS--------------IFRLAEWRNRAAAERGQTPPIPEASITKPDY    192
d1p5ja_      135 --DPLIWEGHAS--IVKELKETLWEKPGA-------------------------------    159

Query        193 PVLDA-----ILE-LYV--D-----RDTGADAIVAAGYD--REL--VVKTLRMVD-TAEY    234
d1p5ja_      160 IALSVGGGGL-LCG-VVQGLQECGWGDVPV--I----AMET--FGA--HSFHAATTAGKL    207

Query        235 -----------------KRRQYPPGTKISAKGFGKDRRLP----ITNRWRE---------    264
d1p5ja_      208 VSLPKITSVAKALGVKTVGS-Q----------ALK-LFQEHPIF-----SEVISDQEAVA    250

Query        265 ----------------------------------G-H-----------------------    266
d1p5ja_      251 AIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQL    310

Query        267 ---------    267
d1p5ja_      311 RALKEQLGM    319


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.04)
DALI match                                                                   
Query          2 ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIAC-------DALGAQNVYG     54
d1p5ja_      244 SDQEAVAAIEKFVDDE-------KILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLV    296

DALI match                                
Query         55 VSMPSKYSSDHSKGDAAELARRTGL     79
d1p5ja_      297 VIVC--GGSNISLAQLRALKEQLGM    319



top
29: d1vi2a1 Putative shikimate dehydrogenase YdiB (svm: 0.714)

SCOP Superfamily: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Fold: NAD(P)-​binding Rossmann-​fold domains  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.22  Contact: 971
Modified z-scores:
dali:0.95 daliz:0.91 gdtts:0.93 tmscore:0.94 rmsd:0.39 AHM:0.42 LBcontacta:0.90 LBcontactb:0.91 LHM:0.18
id:0.85 blosum:0.47 compass:0.41 pearson:0.96
Scaled scores:
dali:0.71 daliz:0.38 gdtts:0.49 tmscore:0.57 rmsd:0.75 AHM:0.66 LBcontacta:0.39 LBcontactb:0.56 LHM:0.43
id:0.02 blosum:0.09 compass:0.26 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 5.2 Raw score:541.70)
Query          1 dadeevySALVVGLRAYvaKNGF--RSVLIGLSgGIDSALVAAIACDALGaQNVYGVSMP     58
d1vi2a1        1 -----dgTGHIRAIKES--GFDIkgKTMVLLGA-GGASTAIGAQGAIEGL-KEIKLFNRR     51

Query         59 skyssDHSKGDAAELARRTG------LNFRTVSIepmfdaymaslgltglaeenlqsrlr    112
d1vi2a1       52 -----DEFFDKALAFAQRVNentdcvVTVTDLAD--------------------------     80

Query        113 gTTLMAISNqEGHIVLAPgnksELAV-GYSTLY------gdsvgAYGPikdvyktsifrl    165
d1vi2a1       81 qQAFAEALA-SADILTNG-tkvGMKPlENESLVndisllhpgllVTEC------------    126

Query        166 aewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvkt    225
d1vi2a1      127 ------------------------------------------------------------    127

Query        226 lrmvdtaeyKRRQY---------------ppGTKI-----------------SAKG--fG    251
d1vi2a1      127 -------vyNPHMTkllqqaqqagcktidgyGMLLwqgaeqftlwtgkdfplEYVKqvmG    179

Query        252 KDRrlpitnrwregh    266
d1vi2a1      180 FGA------------    182


hit structure      alignment
FAST alignment (Normalized score: 3.26 Raw score:716.60)
Query          1 DADEEVYSAL-VVGLRAYVAKNGFR---SVLIG-LSGGIDSALVAAIACDALGAQN---V     52
d1vi2a1        1 ----------DGTGHIRAIKESGF-DIKGKTMVLLGAGGASTAIGAQGAI------EGLK     43

Query         53 YGVSMPSKYSS-DHSKGDAAELARR----TGLNFRTVSIEPMFDAYMASLGLTGLAEENL    107
d1vi2a1       44 EIKLFNR----RDEFFDKALAFAQRVNENTDCVVTVTDLA--------------------     79

Query        108 QSRLRGTTLMAISNQEG--HIVLA---PGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSI    162
d1vi2a1       80 -DQQAFAEALA------SADILTNGTKVGMKP----------------------------    104

Query        163 FRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELV    222
d1vi2a1      105 ------------------------------------------------------------    105

Query        223 VKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH----------------    266
d1vi2a1      105 --------------------------------------------LENESLVNDISLLHPG    120

Query        267 ------------------------------------------------------------    267
d1vi2a1      121 LLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGF    180

Query        267 --    267
d1vi2a1      181 GA    182


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:100.86)
Query          1 DADEEVYSALVVGLRAY-VAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPS     59
d1vi2a1        1 -----DGTGHIRAIKESGFDI--KGKTMVLLGAGGASTAIGAQGAI-EG--LKEIKLFNR     50

Query         60 KYSS-DHSKGDAAELAR-RTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLM    117
d1vi2a1       51 -RDEFFDKALAFAQRVNENTDCVVTVTDLA-D---------------------QQ-AF-A     85

Query        118 AISNQEGHIVLAPGNKSELAVGYSTLYGDS----V---GAYGPIKDVYKTSIFRLAEWRN    170
d1vi2a1       86 EALA-SADILTNGTK--VGMKPLENESLVNDISLLHPGLLVTECVY--------------    128

Query        171 RAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVD    230
d1vi2a1      129 ----------------------------------------------------------N-    129

Query        231 TAEYKR-RQ-Y------PPG--TK-I-------------------SAK-GFGKDRRLPIT    259
d1vi2a1      130 -PHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGF-GA-----    182

Query        260 NRWREGH    266
d1vi2a1      183 -------    183


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.11)
DALI match        **********. ....********............  ... ****          ***
Query          7 YSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHS     66
d1vi2a1        2 GTGHIRAIKESGFDIKGKTMVLLGAGGASTAIGAQGA--IEGLKEIK-----LFNRRDEF     54

DALI match       ************      
Query         67 KGDAAELARRTGLNFRTV     84
d1vi2a1       55 FDKALAFAQRVNENTDCV     72



top
30: d1e0ta3 Pyruvate kinase,​ C-​terminal domain (svm: 0.690)

SCOP Superfamily: PK C-​terminal domain-​like  |  SCOP Fold: Pyruvate kinase C-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.58  Contact: 822
Modified z-scores:
dali:0.96 daliz:0.96 gdtts:0.94 tmscore:0.94 rmsd:0.36 AHM:0.43 LBcontacta:0.90 LBcontactb:0.91 LHM:0.23
id:0.80 blosum:0.47 compass:0.39 pearson:0.95
Scaled scores:
dali:0.72 daliz:0.44 gdtts:0.55 tmscore:0.60 rmsd:0.76 AHM:0.64 LBcontacta:0.42 LBcontactb:0.61 LHM:0.38
id:0.01 blosum:0.07 compass:0.20 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 5.6 Raw score:427.20)
Query          1 dadeeVYSALVVGLRAYVAKNGFRSVLIGLSGgidsALVAAIACDALGaqNVYGVSMpsk     60
d1e0ta3        1 -----ITEAVCRGAVETAEKLDAPLIVVATQG----GKSARAVRKYFPdaTILALTT---     48

Query         61 yssdhsKGDAAELARRTG-LNFRTVSIepmfdaymaslgltglaeenlQSRLRGTTLMAI    119
d1e0ta3       49 ------NEKTAHQLVLSKgVVPQLVKE-------------------itSTDDFYRLGKEL     83

Query        120 SNQE-------gHIVLAPGNKselavgystlygdsvgaygpikdvyktsifrlaewrnra    172
d1e0ta3       84 ALQSglahkgdvVVMVSGALV---------------------------------------    104

Query        173 aaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdta    232
d1e0ta3      105 ------------------------------------------------------------    105

Query        233 eykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1e0ta3      105 ---------------------psgttntasvhvl    117


hit structure      alignment
FAST alignment (Normalized score: 4.49 Raw score:791.90)
Query          1 DADEEV-YSALVVGLRAYVAKNGFRSVLIGLSGGIDS--ALVAAIACDALGAQ-----NV     52
d1e0ta3        1 ------ITEAVCRGAVETAEKLDAPLIVVAT------QGGKSARAVRK-----YFPDATI     43

Query         53 YGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENL----Q    108
d1e0ta3       44 LALT-----TNEKTAHQLVL---SKGVVPQLV-----------------------KEITS     72

Query        109 SRLRGTTLMAISNQ-------EGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTS    161
d1e0ta3       73 TDDFYRLGKELALQSGLAHKGDVVVMVSG-------------------------------    101

Query        162 IFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDREL    221
d1e0ta3      102 ------------------------------------------------------------    102

Query        222 VVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH---------------    266
d1e0ta3      102 ---------------------------------------------ALVPSGTTNTASVHV    116

Query        267 -    267
d1e0ta3      117 L    117


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:80.99)
Query          1 -DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDA-LGAQNVYGVSMP     58
d1e0ta3        1 I-----TE-AVCRGAVETAEKLDAPLIVVATQG----GKSARAVRKYFPD-ATILALT-T     48

Query         59 SKYSSDHSKGDAAELARRTG-LNFRTVSIEPMFDAYMASLGLTGLAEENLQSR-LRG-TT    115
d1e0ta3       49 -------NEKTAHQ-LVLSKGVVPQLVKE---------------------ITSTDDFYRL     79

Query        116 LMAISNQ----E---G-HIVLAPGNKSELAVGYST-LYGDSVGAYGPIKDVYKTSIFRLA    166
d1e0ta3       80 GKELA-LQSGLAHKGDVVVMVSGAL--V----P-SG----------TTN-----------    110

Query        167 EWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTL    226
d1e0ta3      111 ------------------------------------------------------------    111

Query        227 RMVDTAEYKRRQYPP----GTKISAKGFGKDRRLPITNRWREGH    266
d1e0ta3      111 ------------TASVHVL-------------------------    117


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.10)
DALI match                                   
Query         52 VYGVSMPSKYSSDHSKGDAAELARRTGL     79
d1e0ta3       62 VVPQLVKEITSTDDFYRLGKELALQSGL     89



hit structures. 
top
31: d1o97d1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain (svm: 1.564)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 954
Modified z-scores:
dali:0.95 daliz:0.94 gdtts:0.89 tmscore:0.90 rmsd:0.55 AHM:0.50 LBcontacta:0.89 LBcontactb:0.88 LHM:0.18
id:0.95 blosum:0.62 compass:0.36 pearson:0.92
Scaled scores:
dali:0.72 daliz:0.41 gdtts:0.45 tmscore:0.49 rmsd:0.65 AHM:0.60 LBcontacta:0.41 LBcontactb:0.57 LHM:0.38
id:0.07 blosum:0.11 compass:0.18 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:520.00)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS-----GGIDSALVAAIACDAL--gaQNVY     53
d1o97d1        1 -----------------------SKILVIAEhrrndLRPVSLELIGAANGLKksgeDKVV     37

Query         54 GVSMPSkYSSDhSKGDAAelaRRTGLNFRTVSIEpmfdaymaslgltglaeenlQSRLRG    113
d1o97d1       38 VAVIGS-QADA-FVPALS---VNGVDELVVVKGS----------------sidfDPDVFE     76

Query        114 TTLMAISNQEGH-IVLAPGNkselavgYSTLyGDSV------------------------    148
d1o97d1       77 ASVSALIAAHNPsVVLLPHS-------VDSLgYASSlasktgygfatdvyiveyqgdelv    129

Query        149 ---------------------gaYGPIKDVyktsifrlaewrnraaaergqtpPIPEasi    187
d1o97d1      130 atrggynqkvnvevdfpgkstvvLTIRPSV---------------------fkPLEG---    165

Query        188 tkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisa    247
d1o97d1      166 -----------------------------------------------agspvvsnvdaps    178

Query        248 kgfgkdrrlpITNRwregh    266
d1o97d1      179 vqsrsqnkdyVEVG-----    192


hit structure      alignment
FAST alignment (Normalized score: 3.25 Raw score:734.60)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS-------GGIDSALVAAIACDA--LGAQ-     50
d1o97d1        1 -----------------------SKILVI--AEHRRNDLRPVSLELIGAANG-LKKSGED     34

Query         51 NVYGVSMPSKYSSDHSKGDAAELARRTG----LNFRTVSIEPMFDAYMASLGLTGLAEEN    106
d1o97d1       35 KVVVAV-IGSQ-ADAFVPALS-------VNGVDELVVVK---------------------     64

Query        107 L------QSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLYGDSVGAYGPIK----    155
d1o97d1       65 -GSSIDFDPDVFEASVSALIAAHNPSVVLL--------------------------PHSV     97

Query        156 --------------------------------------------------------DVYK    159
d1o97d1       98 DSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRP    157

Query        160 TSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDR    219
d1o97d1      158 SV----------------------------------------------------------    159

Query        220 ELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------------    266
d1o97d1      160 -----------------------------------------------FKPLEGAGSPVVS    172

Query        267 --------------------    267
d1o97d1      173 NVDAPSVQSRSQNKDYVEVG    192


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:93.55)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS-----GGIDSALVAAIACDAL--GAQNVY     53
d1o97d1        1 -----------------------SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVV     37

Query         54 GVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRG    113
d1o97d1       38 VAVIGSQ-ADA--FV--PALSVNGVDELVVVKGS--SI-------------DF-DPDVFE     76

Query        114 TTLMAISNQEGH-IVLAPGNKSELAVGYSTLYGDS-VG-----AYGPIKD----------    156
d1o97d1       77 ASVSALIAAHNPSVVLLPH---S----VDSLGYASSLASKTGYGFATDVYIVEYQGDELV    129

Query        157 -------------------------VYKTSIFRLAEWRNRAAAERGQTPPIP--------    183
d1o97d1      130 ATRGGYNQKVNVEVDFPGKSTVVLTIRP--S-VFK--PL---------EGAGSPVVSNVD    175

Query        184 -----------------EASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTL    226
d1o97d1      176 APSVQSRSQNKDYVEVG-------------------------------------------    192

Query        227 RMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1o97d1      193 ----------------------------------------    193


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.07)
DALI match                                                                   
Query         11 VVGLRAYVAKNGFRSVLIGLSGGI--DSALVAAIACDALGAQNVYGVSMPSKYSSDHSKG     68
d1o97d1       45 ADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLP---HSVDSLG    101

DALI match                    
Query         69 DAAELARRTGLNF     81
d1o97d1      102 YASSLASKTGYGF    114



top
32: d1efva1 Large,​ alpha subunit of electron transfer flavoprotein ETFP,​ N-​terminal domain (svm: 1.771)

SCOP Superfamily: Adenine nucleotide alpha hydrolases-​like  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.37  Contact: 1025
Modified z-scores:
dali:0.97 daliz:0.96 gdtts:0.95 tmscore:0.96 rmsd:0.32 AHM:0.32 LBcontacta:0.93 LBcontactb:0.90 LHM:0.18
id:0.87 blosum:0.35 compass:0.28 pearson:0.94
Scaled scores:
dali:0.72 daliz:0.43 gdtts:0.56 tmscore:0.65 rmsd:0.79 AHM:0.72 LBcontacta:0.44 LBcontactb:0.58 LHM:0.37
id:0.03 blosum:0.07 compass:0.20 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 5.5 Raw score:517.80)
Query          1 dadeevysalvvglrayvakngfRSVLIGLS-----GGIDSALVAAIACDALGaqNVYGV     55
d1efva1        1 -----------------------QSTLVIAEhandsLAPITLNTITAATRLGG--EVSCL     35

Query         56 SMPSKyssdHSKGDAAELarRTGLNFRTVSIEPmfdaymaslgltglaeENLQSRLRGTT    115
d1efva1       36 VAGTK--cdKVAQDLCKV--AGIAKVLVAQHDV---------------yKGLLPEELTPL     76

Query        116 LMAISNQEGH-IVLAPGNKselavgystlyGDSV--------------------------    148
d1efva1       77 ILATQKQFNYtHICAGASA-------fgknLLPRvaaklevapisdiiaikspdtfvrti    129

Query        149 ---------------gAYGPIkdvyktsIFRLAewrnraaaergqtpPIPEasitkpdyp    193
d1efva1      130 yagnalctvkcdekvkVFSVR-------GTSFD-------------aAATS---------    160

Query        194 vldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkd    253
d1efva1      161 ---------------------------------------------ggsassekasstspv    175

Query        254 rrlpitnrwregh    266
d1efva1      176 eisewldqkltks    188


hit structure      alignment
FAST alignment (Normalized score: 3.36 Raw score:751.40)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS------GGIDSALVAAIACDALGAQ--NV     52
d1efva1        1 -----------------------QSTLVIA-EHANDSLAPITLNTITAATRL----GGEV     32

Query         53 YGVSMPSKYSSDHSKGDAAELARRTG----LNFRTVSIEPMFDAYMASLGLTGLAEENL-    107
d1efva1       33 SCLV-AGTK-CDKVAQDLCK------VAGIAKVLVAQH---------------------D     63

Query        108 -----QSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY--------GDSVGAYGP    153
d1efva1       64 VYKGLLPEELTPLILATQKQFNYTHICA---------------GASAFGKNLLPR-----    103

Query        154 IKDVYKTSIFR----------------------------------------------LAE    167
d1efva1      104 -----------VAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGT    152

Query        168 WRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLR    227
d1efva1      153 S-----------------------------------------------------------    153

Query        228 MVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH---------------------    266
d1efva1      154 ---------------------------------------FDAAATSGGSASSEKASSTSP    174

Query        267 --------------    267
d1efva1      175 VEISEWLDQKLTKS    188


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:94.63)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS-----GGIDSALVAAIACDALGAQNVYGV     55
d1efva1        1 -----------------------QSTLVIAEHANDSLAPITLNTITAATRLGG--EVSCL     35

Query         56 SMPSKYSSDHSKGDAAELARRTGL-NFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGT    114
d1efva1       36 VAGT--K-C--DKVAQDLCKVAGIAKVLVAQHD--VY------------KG-LLPEELTP     75

Query        115 TLMAISNQEGHIVLAPGNKSELAVGYSTLYGDS-VG----A-YGPIK----------DV-    157
d1efva1       76 LILATQKQFNYTHICAGA--S----AFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTI    129

Query        158 --Y-----------------KTSIFRLAEWRNRAAAERGQTPPIPE--------------    184
d1efva1      130 YAGNALCTVKCDEKVKVFSV--RGT-SF--DA----------AATSGGSASSEKASSTSP    174

Query        185 --------------ASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVD    230
d1efva1      175 VEISEWLDQKLTKS----------------------------------------------    188

Query        231 TAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1efva1      189 ------------------------------------    189


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.13)
DALI match                                                                   
Query         22 GFRSVLIGLSGGID---SALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTG     78
d1efva1       53 GIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAG---ASAFGKNLLPRVAAKLE    109

DALI match          
Query         79 LNF     81
d1efva1      110 VAP    112



top
33: d1vl1a_ 6-​phosphogluconolactonase (svm: 0.646)

SCOP Superfamily: NagB/​RpiA/​CoA transferase-​like  |  SCOP Fold: NagB/​RpiA/​CoA transferase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.28  Contact: 543
Modified z-scores:
dali:0.90 daliz:0.86 gdtts:0.89 tmscore:0.91 rmsd:0.38 AHM:0.38 LBcontacta:0.90 LBcontactb:0.92 LHM:0.15
id:0.92 blosum:0.63 compass:0.30 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.45 tmscore:0.52 rmsd:0.75 AHM:0.70 LBcontacta:0.41 LBcontactb:0.63 LHM:0.47
id:0.06 blosum:0.13 compass:0.22 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.3 Raw score:386.10)
Query          1 ---------DADEEVYSALVVGLRAYVAknGFRSVLIG-lsggidsalvaaiacdaLGAQ     50
d1vl1a_        1 ktviylledGYVDFVVEKIRTKMEKLLE--EKDKIFVVlaggrtplpvyeklaeqkFPWN     58

Query         51 NVYGVS-mpsKYSSD---HSKGDAAE-LARRTGL---NFRTVS-iEPMFDaymaslgltg    101
d1vl1a_       59 RIHFFLsderYVPLDsdqSNFRNINEvLFSRAKIpsgNVHYVDtsLPIEK----------    108

Query        102 laeenlqsrLRGTTLMAISNqeghivLAPGNksELAVGYSTL------------------    143
d1vl1a_      109 ------aceKYEREIRSATD---qfdLAILG--MGPDGHVASifdletgnkdnlvtftdp    157

Query        144 -------------ygDSVGAYGPIkdVYKT-----------------------------S    161
d1vl1a_      158 sgdpkvprvtltfraLNTSLYVLF--LIRGkekinrlteilkdtplpayfvrgkektvwF    215

Query        162 IFRlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydrel    221
d1vl1a_      216 VGK---------------------------------------------------------    218

Query        222 vvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1vl1a_      219 ---------------------------------------------    219


hit structure      alignment
FAST alignment (Normalized score: 3.49 Raw score:841.50)
Query          1 D----------ADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDA--LG     48
d1vl1a_        1 -KTVIYLLEDGYVDFVVEKIRTKMEKLL--EEKDKIFVVLAGGRTPLPVYEKLAE-QKFP     56

Query         49 AQNVYGVSMPSKYSSD------------HSKGDAAE-LARRTGLNFRTVSIEPMFDAYMA     95
d1vl1a_       57 WNRIHFFL--------SDERYVPLDSDQSNFRNINEVLFSRAKI----------------     92

Query         96 SLGLT------------GLAEENLQSRLRGTTLMAISNQEGHI-----VLAPGNKSELAV    138
d1vl1a_       93 -----PSGNVHYVDTSLPIEKACEKYEREIRS-----------ATDQFDLAILG------    130

Query        139 GYSTLY-----------------------------------------GDSVGAYGPIKDV    157
d1vl1a_      131 ------MGPDGHVASIFDLETGNKDNLVTFTDPSGDPKVPRVTLTFRALNTSLYV-----    179

Query        158 YKTSIFRLAEWRNRAAAERGQTPPIPEASITK------PDYPVLDAILELYVDRDTGADA    211
d1vl1a_      180 --------------------------------LFLIRGKEKINRLTEIL-----------    196

Query        212 IVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-----    266
d1vl1a_      197 -------------------------------------------------------KDTPL    201

Query        267 -----------------    267
d1vl1a_      202 PAYFVRGKEKTVWFVGK    218


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:117.30)
Query          1 --------DAD-EEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQN     51
d1vl1a_        1 KTVIYLLEDGYVDFVVEKIRTKMEKLLEE-KDKIFVVLAGGRTPLPVYEKLAEQKFPWNR     59

Query         52 VYGVS-MPSKYSS-DH-S-KGDAAEL-ARRTGLNF--R-TVSIEPMFDAYMASLGLTGLA    103
d1vl1a_       60 IHFFLSDERYVPLDSDQSNFRNINEVLFSRAKIPSGNVHYVDTSLPIEK-----------    108

Query        104 EENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTL--------------------    143
d1vl1a_      109 ----A-CEKYEREIRSAT--DQFDLAILG--MGPDGHVASIFDLETGNKDNLVTFTDPSG    159

Query        144 -------YGDS-VG--AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYP    193
d1vl1a_      160 DPKVPRVTLTFRALNTSLYVLF-L-IR--------------------------------G    185

Query        194 VLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYP-PGTKISAKG--F    250
d1vl1a_      186 KEKINRL-T-----------------------EILKDTPLPAYFVRGKEKTVWF--VGK-    218

Query        251 GKDRRLPITNRWREGH    266
d1vl1a_      219 ----------------    219


hit structure      alignment
HHsearch alignment (Probability: 0.27 E-value:0.01)
DALI match       ...................    ********                  ********** 
Query          1 DADEEVYSALVVGLRAYVAK--NGFRSVLIGLSGGID-SALVAAIACDALGAQNVYGVSM     57
d1vl1a_        6 LLEDGYVDFVVEKIRTKMEKLLEEKDKIFVVLAGGRTPLPVYEKLAEQKFPWNRIHFFLS     65

DALI match         .............     
Query         58 PSKYSSDHSKGDAAELARRT     77
d1vl1a_       66 DERYVPLDSDQSNFRNINEV     85



top
34: d1tuba1 Tubulin alpha-​subunit (cs: 2.517)

SCOP Superfamily: Tubulin nucleotide-​binding domain-​like  |  SCOP Fold: Tubulin nucleotide-​binding domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 815
Modified z-scores:
dali:0.93 daliz:0.89 gdtts:0.92 tmscore:0.93 rmsd:0.35 AHM:0.37 LBcontacta:0.84 LBcontactb:0.83 LHM:0.31
id:0.96 blosum:0.60 compass:0.28 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.37 gdtts:0.48 tmscore:0.59 rmsd:0.80 AHM:0.74 LBcontacta:0.30 LBcontactb:0.43 LHM:0.33
id:0.06 blosum:0.11 compass:0.19 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:500.20)
Query          1 ------------------------------------------------------------      1
d1tuba1        1 mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk     60

Query          1 ------------------------------------------------dadeEVYSALVV     12
d1tuba1       61 hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkEIIDLVLD    120

Query         13 GLRAYVAKN-GFRSVLIGLS-----GGIDSALVAAIACDALGAQNVYGVSMPSKY-----     61
d1tuba1      121 RIRKLADQCtGLQGFSVFHSfgggtGSGFTSLLMERLSVDYGKKSKLEFSIYPAPqvsta    180

Query         62 sSDHSKGDAAELARRTGLNFRTV-SIEPMFDAYMA-SLGLTglAEENLQSRLRGTTLMAI    119
d1tuba1      181 vVEPYNSILTTHTTLEHSDCAFMvDNEAIYDICRRnLDIER--PTYTNLNRLIGQIVSSI    238

Query        120 SNQEGhivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaergqt    179
d1tuba1      239 TASLR-------------------------------------------------------    243

Query        180 ppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqy    239
d1tuba1      244 ------------------------------------------------------------    244

Query        240 ppgtkisakgfgkdrrlpitnrwregh    266
d1tuba1      244 -------------------------fd    245


hit structure      alignment
FAST alignment (Normalized score: 4.46 Raw score:1140.00)
Query          1 D-----------------------------------------------------------      1
d1tuba1        1 -MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG     59

Query          2 --------------------------------------------------ADEEVYSALV     11
d1tuba1       60 KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL    119

Query         12 VGLRAYVAKN-GFRSVLIGLSG-----GIDSALVAAIACDALGAQ-NVYGVSMP-SKYS-     62
d1tuba1      120 DRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVD-YGKKSKLEFSIYPAPQVS    178

Query         63 ---SDHSKGDAAELARRTG-LNFRTVSIEPMFDAYMASLGLTGLA--EENLQSRLRGTTL    116
d1tuba1      179 TAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIE---RPTYTNLNRLIGQIV    235

Query        117 MAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAER    176
d1tuba1      236 SSITAS------------------------------------------------------    241

Query        177 GQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKR    236
d1tuba1      242 ------------------------------------------------------------    242

Query        237 RQYPPGTKISAKGFGKDRRLPITNRWREGH----    266
d1tuba1      242 ------------------------------LRFD    245


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:102.21)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNV--------     52
d1tuba1        1 ---------------------MR-ECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPS     38

Query         53 ------------------------Y-GVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIE     87
d1tuba1       39 DKTIGGGDDSFNTFFSETGAGKHVPRAVFVD---LEPTVIDEVRTGTYR-QLFHPEQLIT     94

Query         88 ------------PMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEG-H-IVLAPGNK    133
d1tuba1       95 GKEDAANNYARG-------------HYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHS-    140

Query        134 SEL--AVGYSTL-YGDS-VG------AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIP    183
d1tuba1      141 FGGGT--GSGFTSLLMERLSVDYGKKSKLEFS-IYPAP----------------------    175

Query        184 EASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGT    243
d1tuba1      176 ------QVSTAVV-E--------------------------PY-NSILTTHTTLEHSDCA    201

Query        244 KIS-----------------------------------------AKGFGKDRRLPITNRW    262
d1tuba1      202 FMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFD----------------    245

Query        263 REGH    266
d1tuba1      246 ----    246


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.15)
DALI match       ..................
Query         26 VLIGLSGGIDSALVAAIA     43
d1tuba1      137 VFHSFGGGTGSGFTSLLM    154



top
35: d1o98a1 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain (cs: 2.508)

SCOP Superfamily: 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain  |  SCOP Fold: 2,​3-​Bisphosphoglycerate-​independent phosphoglycerate mutase,​ substrate-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.29  Contact: 900
Modified z-scores:
dali:0.94 daliz:0.90 gdtts:0.87 tmscore:0.91 rmsd:0.42 AHM:0.45 LBcontacta:0.90 LBcontactb:0.92 LHM:0.20
id:0.86 blosum:0.16 compass:0.17 pearson:0.92
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.41 tmscore:0.51 rmsd:0.73 AHM:0.65 LBcontacta:0.37 LBcontactb:0.57 LHM:0.38
id:0.03 blosum:0.06 compass:0.19 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:504.20)
Query          1 ---------dADEEVYSAL-VVGLRAYVAKnGFRSVLIG--------lsgGIDSALVAAI     42
d1o98a1        1 qsltriniaiREGEFDRNEtFLAAMNHVKQ-HGTSLHLFgllsdggvhshIHHLYALLRL     59

Query         43 ACDALGaQNVYGVSMPSK-----YSSDHSKGDAAELARRTG-LNFRTVSIepmfdaymas     96
d1o98a1       60 AAKEGV-KRVYIHGFLDGrdvgpQTAPQYIKELQEKIKEYGvGEIATLSG------ryys    112

Query         97 lgltGLAEENLQSRLRGT-------------------------------------tlmaI    119
d1o98a1      113 mdrdKRWDRVEKAYRAMVygegptyrdpleciedsykhgiydefvlpsvivredgrpvaT    172

Query        120 SNQeGHIVLAPGNkselavGYST-------------------lygdsvgAYGP-------    153
d1o98a1      173 IQD-NDAIIFYNF-----rPDRAiqisntftnedfrefdrgpkhpkhlfFVCLthfsetv    226

Query        154 ---iKDVYktsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgad    210
d1o98a1      227 agyvAFKP----------------------------------------------------    234

Query        211 aivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1o98a1      235 --------------------------------------------------------    235


hit structure      alignment
FAST alignment (Normalized score: 3.94 Raw score:982.60)
Query          1 DA-----------DEEVY-SALVVGLRAYVAKNGFRSVLIGLSG----------GIDSAL     38
d1o98a1        1 --QSLTRINIAIREGEFDRNETFLAAMNHVKQHG-TSLHLFG--LLSDGGVHSHIHHLYA     55

Query         39 VAAIACDALG--AQNVYGVSMPSKYS--------SDHSKGDAAELARRT-GLN-FRTVSI     86
d1o98a1       56 LLRLAAK---EGVKRVYIHGFLD---GRDVGPQTAPQYIKELQEKIKEYGVGEIATLSG-    108

Query         87 EPMFDAYMASLGLTGLAE---------ENLQSRLRGTTLMAISNQ---------------    122
d1o98a1      109 ------------------RYYSMDRDKRWDRVEKAYRAMV-----YGEGPTYRDPLECIE    145

Query        123 -----------------------------EGHIVLAPGNKSELAVGYSTLY--------G    145
d1o98a1      146 DSYKHGIYDEFVLPSVIVREDGRPVATIQDNDAIIFYN-------------FRPDRAIQI    192

Query        146 DSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDR    205
d1o98a1      193 SNT---------------------------------------------------------    195

Query        206 DTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREG    265
d1o98a1      196 ------------------------------------------------------------    196

Query        266 H---------------------------------------    266
d1o98a1      196 -FTNEDFREFDRGPKHPKHLFFVCLTHFSETVAGYVAFKP    234


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:111.23)
Query          1 -------DA--DEEVYSAL-VVGLRAYVAKNGFRSVLIGLSGGI----DSA-LVAAIACD     45
d1o98a1        1 QSLTRINIAIREGEFDRNETFLAAMNHVKQ-HGTSLHLFGLLSDGGVHSHIHHLYALLRL     59

Query         46 AL--GAQNVYGVSMPSKY--SSDHSKGDAAELARRTG----LNFRTVSIE-PMF---DAY     93
d1o98a1       60 AAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRY--YSMD---    114

Query         94 MASLGLTGLAEENLQSRLRGTTLMA-----------------------------------    118
d1o98a1      115 -------RDKR-WDRVEKAYRAMVYGEGPTYRDPLECIEDSYKHGIYDEFVLPSVIVRED    166

Query        119 -----ISNQEGHIVLAPGNKSELAVGYSTLYGDSVG-----------------A-YGPIK    155
d1o98a1      167 GRPVATIQD-NDAIIFYNF--RP---DRAIQISNTFTNEDFREFDRGPKHPKHLFFVCLT    220

Query        156 DVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAA    215
d1o98a1      221 H-----------------------------------------------------------    221

Query        216 GYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH    266
d1o98a1      222 -------------------FSETVAGYVAFK--P-----------------    234


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.38)
DALI match                                       
Query         12 VGLRAYVAKNGFRSV-LIGLSGGIDSALVAAI     42
d1o98a1       54 YALLRLAAKEGVKRVYIHGFLDGRDVGPQTAP     85



hit structures. 
top
36: d1w2w.1 Putative methylthioribose-​1-​phosphate isomerase Ypr118W (cs: 2.505)

SCOP Superfamily: NagB/​RpiA/​CoA transferase-​like  |  SCOP Fold: NagB/​RpiA/​CoA transferase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 1077
Modified z-scores:
dali:0.95 daliz:0.88 gdtts:0.96 tmscore:0.97 rmsd:0.34 AHM:0.34 LBcontacta:0.82 LBcontactb:0.86 LHM:0.20
id:0.81 blosum:0.14 compass:0.11 pearson:0.91
Scaled scores:
dali:0.67 daliz:0.32 gdtts:0.50 tmscore:0.62 rmsd:0.79 AHM:0.70 LBcontacta:0.28 LBcontactb:0.44 LHM:0.35
id:0.01 blosum:0.04 compass:0.13 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:606.70)
Query          1 ------------------------------------------------------------      1
d1w2w.1        1 msleaivfdrsepenvsvkvldqlllpyttkyvpihtiddgysviksmqvrgapaiaivg     60

Query          1 ------------------------------------------------------------      1
d1w2w.1       61 slsvltevqlikhnptsdvatlyslvnwestktvlnkrldfllssrptavnlsnslveik    120

Query          1 ----------------------------dadeEVYSALVVGLRAYVAK--NGFRSVLIGL     30
d1w2w.1      121 nilksssdlkafdgslynyvcelidedlannmKMGDNGAKYLIDVLQKdgFKDEFAVLTI    180

Query         31 SGGI--------DSALVAAIACDALG-------aqNVYGVSMPskySSDHS-KGDAAELA     74
d1w2w.1      181 CNTGslatsgygTALGVIRSLWKDSLaktdkcprmGHVFPLET---RPYNQgSRLTAYEL    237

Query         75 RRTGLNFRTVSIepmfdaymaslgltglaeenlqsrlrgtTLMAISNQE--GHIVLAPGN    132
d1w2w.1      238 VYDKIPSTLITD---------------------------sSIAYRIRTSpiPIKAAFVGA    270

Query        133 ksELAV--GYSTL----yGDSVG-----AYGPIkdVYKTsifrlaewrnraaaergqtpp    181
d1w2w.1      271 -dRIVRngDTANKigtlqLAVICkqfgiKFFVV--APKT---------------------    306

Query        182 ipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlRMVDTA---------    232
d1w2w.1      307 ------------------------------------------tidNVTETGddiiveern    324

Query        233 ----------------------------------------------eyKRRQYPPG----    242
d1w2w.1      325 peefkvvtgtvinpengslilnesgepitgkvgiapleinvwnpafdiTPHELIDGiite    384

Query        243 tKISAkgfGKDRRlpitnrwregh    266
d1w2w.1      385 eGVFT---KNSSG---efqleslf    402


hit structure      alignment
FAST alignment (Normalized score: 2.97 Raw score:972.00)
Query          1 D-----------------------------------------------------------      1
d1w2w.1        1 -MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIV     59

Query          2 ------------------------------------------------------------      2
d1w2w.1       60 GSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEI    119

Query          2 ------------------------------ADEEVYSALVVGLRAYVAKNG-FRSVLIGL     30
d1w2w.1      120 KNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVL-    178

Query         31 SGG-------------IDSALVAAIACDALGAQN-----------VYGVSM-PSKYSSDH     65
d1w2w.1      179 ---TICNTGSLATSGYGTALGVIRSLWKD-----SLAKTDKCPRMGHVFPLETRP--YNQ    228

Query         66 SKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE--------------------    105
d1w2w.1      229 GSRLTAYELVYDKIPSTLIT--------------------DSSIAYRIRTSPIPIKAAFV    268

Query        106 -------------NLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYG-------    145
d1w2w.1      269 GADRIVRNGDTANKIGTLQLAVICKQ----FGIKFFVVAPKTT----------IDNVTET    314

Query        146 ------------------------------------------------------------    146
d1w2w.1      315 GDDIIVEERNPEEFKVVTGTVINPENGSLILNESGEPITGKVGIAPLEINVWNPAFDITP    374

Query        146 DSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDR    205
d1w2w.1      375 HELIDGI-----------------------------------------------------    381

Query        206 DTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREG    265
d1w2w.1      382 ------------------------------------------------------------    382

Query        266 H---------------------    266
d1w2w.1      382 -ITEEGVFTKNSSGEFQLESLF    402


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:125.54)
Query          1 ------------------------------------------------------------      1
d1w2w.1        1 MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVG     60

Query          1 ------------------------------------------------------------      1
d1w2w.1       61 SLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIK    120

Query          1 -------------------------D--AD-EEVYSALVVGLRAYVAKN-G-FRSVLIGL     30
d1w2w.1      121 NILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTI    180

Query         31 SGGI--------DSALVAAIACDALGA-Q-----NVYGVSMPSKYSSDHSKGDAAELARR     76
d1w2w.1      181 CNTGSLATSGYGTALGVIRSLWKDSLAKTDKCPRMGHVFPLET-RPYNQGSRLTAYELVY    239

Query         77 TGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSEL    136
d1w2w.1      240 DKIPSTLITD------------------------SSIAYRIRTS-PIPIKAAFVGADRIV    274

Query        137 --AVGYST-LY--GDSVG----AYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASI    187
d1w2w.1      275 RNGDTANKIGTLQLAVICKQFGIKFFVV-APKT---------------------------    306

Query        188 TKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDT----------------    231
d1w2w.1      307 ----T---I-DN----------------------V--TETGDDIIVEERNPEEFKVVTGT    334

Query        232 ------------------------------------AEYKRRQYPPGTKISAKGFGKDRR    255
d1w2w.1      335 VINPENGSLILNESGEPITGKVGIAPLEINVWNPAFDITPHELIDGIITEEGVFTKNSSG    394

Query        256 L-------PITNRWREGH    266
d1w2w.1      395 EFQLESLF----------    402


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.92)
DALI match                                                            
Query         63 SDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTT    115
d1w2w.1       72 KHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSS-RPTAVNLSNSLVEIKNIL    123



top
37: d1f2da_ 1-​aminocyclopropane-​1-​carboxylate deaminase (cs: 2.500)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 959
Modified z-scores:
dali:0.97 daliz:0.93 gdtts:0.96 tmscore:0.97 rmsd:0.38 AHM:0.44 LBcontacta:0.93 LBcontactb:0.95 LHM:0.31
id:0.93 blosum:0.42 compass:0.22 pearson:0.96
Scaled scores:
dali:0.73 daliz:0.39 gdtts:0.49 tmscore:0.61 rmsd:0.79 AHM:0.71 LBcontacta:0.36 LBcontactb:0.57 LHM:0.30
id:0.04 blosum:0.11 compass:0.19 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:562.20)
Query          1 ----dadeEVYS----------------------------------------alvvGLRA     16
d1f2da_        1 agvakfakYPLTfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleYIVP     60

Query         17 YVAKNGFRSVLIGL-SGGIDSALVAAIACDALGaqNVYGVSMPSKYS-----sDHSKGDA     70
d1f2da_       61 DIVEGDYTHLVSIGgRQSNQTRMVAALAAKLGK--KCVLIQEDWVPIpeaekdVYNRVGN    118

Query         71 AELARRTGLNFRTVSIEpmfdaymaslgltglaeenlqSRLRgTTLMAISNQEG-----H    125
d1f2da_      119 IELSRIMGADVRVIEDG-------------------fdIGMR-KSFANALQELEdaghkP    158

Query        126 IVLAPGnkselavgystlygdsvgaygpIKDVYktsifrlaewrnraaaergqtppipea    185
d1f2da_      159 YPIPAG----------------csehkyGGLGF---------------------------    175

Query        186 sitkpdypvldaiLELYvdrdtgadaivaAGYDreLVVK---------------------    224
d1f2da_      176 ---------vgfaDEVI-------nqeveLGIK--FDKIvvccvtgsttagilagmaqyg    217

Query        225 --tLRMV----------dtaeYKRRqyppgtkisakgFGKDRRLPITN------------    260
d1f2da_      218 rqdDVIAidasftsektkeqtLRIA--------nntaKLIGVEHEFKDftldtrfaypcy    269

Query        261 ------------------------------------------------------------    261
d1f2da_      270 gvpnegtieairtcaeqegvltdpvyegksmqglialikedyfkpganvlyvhlggapal    329

Query        261 ------rwregh    266
d1f2da_      330 sayssffptkta    341


hit structure      alignment
FAST alignment (Normalized score: 2.48 Raw score:747.00)
Query          1 DADE------------------------------------------------EVYSALVV     12
d1f2da_        1 ----AGVAKFAKYPLTFGPSPISNLNRLSQHLGSKVNVYAKREDCNSGLAFGGNKLRKLE     56

Query         13 GLRAYVAKNGFRSVLIGLS-GGIDSALVAAIACDALGAQ---NVYGVSMPSKYS------     62
d1f2da_       57 YIVPDIVEGDYTHLVSIGGRQSNQTRMVAALAAK-----LGKKCVLIQED----WVPIPE    107

Query         63 --SDHSK-GDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQ-------SRLR    112
d1f2da_      108 AEKDVYNRVGNIELSRIMGADVRVIE-----------------------DGFDIGMRKSF    144

Query        113 GTTLMAISN-QEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNR    171
d1f2da_      145 ANALQELEDAGHKPYPI-------------------------------------------    161

Query        172 AAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDT    231
d1f2da_      162 ------------------------------------------------------------    162

Query        232 AEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-------------------------    266
d1f2da_      162 -----------------------------------PAGCSEHKYGGLGFVGFADEVINQE    186

Query        267 ------------------------------------------------------------    267
d1f2da_      187 VELGIKFDKIVVCCVTGSTTAGILAGMAQYGRQDDVIAIDASFTSEKTKEQTLRIANNTA    246

Query        267 ------------------------------------------------------------    267
d1f2da_      247 KLIGVEHEFKDFTLDTRFAYPCYGVPNEGTIEAIRTCAEQEGVLTDPVYEGKSMQGLIAL    306

Query        267 -----------------------------------    267
d1f2da_      307 IKEDYFKPGANVLYVHLGGAPALSAYSSFFPTKTA    341


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:121.16)
Query          1 ---------DADEEV---------------------------Y--------SALVVGLRA     16
d1f2da_        1 AGVAKFAKYPLTFGPSPISNLNRLSQHLGSKVNVYAKREDCNSGLAFGGNKLRKLEYIVP     60

Query         17 YVAKNGFRSVLIGLS-GGIDSALVAAIACDALGAQNVYGVSMPSKYSS---D-HSKG-DA     70
d1f2da_       61 DIVEGDYTHLVSIGGRQSNQTRMVAALAAKLGK--KCVLIQEDWVPIPEAEKDVYNRVGN    118

Query         71 AELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEG-----H    125
d1f2da_      119 IELSRIMGADVRVIEDG-----------------F--DIG-MRKSFANALQELEDAGHKP    158

Query        126 IVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVY-KTS---------------IFRLAEWR    169
d1f2da_      159 YPIPAGC-------------SE-HKYG-GLGFVG-FADEVINQEVELGIKFD--------    194

Query        170 NRAAAERGQTPPIPEASITKPDYPVLDA------I--LE-LYVDRDTGADAIVAAGYDRE    220
d1f2da_      195 -----------------------KIVVCCVTGSTTAGILAGMAQYGRQD--D--------    221

Query        221 LVVKT-------LRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWR----------    263
d1f2da_      222 VIAIDASFTSEK--TKEQTLRIANNT---------AKLIGVEHEF-KDFTLDTRFAYPCY    269

Query        264 ------------------------------------------------------------    264
d1f2da_      270 GVPNEGTIEAIRTCAEQEGVLTDPVYEGKSMQGLIALIKEDYFKPGANVLYVHLGGAPAL    329

Query        264 ------------EGH    266
d1f2da_      330 SAYSSFFPTKTA---    341


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.08)
DALI match         ******************.................. ...  ........        
Query         11 VVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA     70
d1f2da_       55 LEYIVPDIVEGDYTHLVSIGGRQSNQTRMVAALAAKLGKKCV--LIQEDWVPIPEAEKDV    112

DALI match             ***************
Query         71 ------AELARRTGLNFRTVS     85
d1f2da_      113 YNRVGNIELSRIMGADVRVIE    133



top
38: d1j09a2 Glutamyl-​tRNA synthetase (GluRS) (svm: 0.775)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.17  Contact: 973
Modified z-scores:
dali:0.96 daliz:0.93 gdtts:0.93 tmscore:0.95 rmsd:0.42 AHM:0.39 LBcontacta:0.89 LBcontactb:0.91 LHM:0.21
id:0.91 blosum:0.37 compass:0.13 pearson:0.94
Scaled scores:
dali:0.70 daliz:0.35 gdtts:0.44 tmscore:0.55 rmsd:0.76 AHM:0.71 LBcontacta:0.33 LBcontactb:0.51 LHM:0.40
id:0.03 blosum:0.08 compass:0.15 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:561.80)
Query          1 dadeevysalvvglrayvakngFRSVLIGLS----GGIDSALVAAIACDALG--aqNVYG     54
d1j09a2        1 ----------------------MVVTRIAPSptgdPHVGTAYIALFNYAWARrnggRFIV     38

Query         55 VSMPSKY--SSDHSKGDAAELAR--RTGLNFR---------TVSI--EPMFDAYMAS---     96
d1j09a2       39 RIEDTDRarYVPGAEERILAALKwlGLSYDEGpdvggphgpYRQSerLPLYQKYAEEllk     98

Query         97 ---------------------------------------------LGLT-----------    100
d1j09a2       99 rgwayrafetpeeleqirkekggydgrarnippeeaeerarrgepHVIRlkvprpgttev    158

Query        101 ----------------GLAE----enLQSR-LRGTTLMAISnqegHIVLAPGNKselavG    139
d1j09a2      159 kdelrgvvvydnqeipDVVLlksdgyPTYHlANVVDDHLMG----VTDVIRAEE----wL    210

Query        140 YST--------lygdsvGAYGPIkdVYKT---------------------sifrlaEWRN    170
d1j09a2      211 VSTpihvllyrafgweaPRFYHM--PLLRnpdktkiskrkshtsldwykaegflpeALRN    268

Query        171 R---------aaaERGQTppipeasitkpdypvldailelyvdrdtgadaivaagydrel    221
d1j09a2      269 YlclmgfsmpdgrEIFTL------------------------------------------    286

Query        222 vvktlrmvdtaeykrrqyppgTKISakgfgkdrrlpitnrwregh    266
d1j09a2      287 ----------eefiqaftwerVSLG----------------gpvf    305


hit structure      alignment
FAST alignment (Normalized score: 2.38 Raw score:677.30)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLS----GGIDSALVAAIACDALGAQ------     50
d1j09a2        1 ----------------------MVVTRIAPSPTGDPHVGTAYIALFNYAW----ARRNGG     34

Query         51 NVYGVSMPSKY------SSDHSKGDAAELARRTGLNFRTV--------------------     84
d1j09a2       35 RFIVRIE----DTDRARYVPGAEERILAALKWLG------LSYDEGPDVGGPHGPYRQSE     84

Query         85 ---SIEPMFDAYMA--SLGLTGLAEENLQSR-----------------------------    110
d1j09a2       85 RLPLYQKYAEELLKRGWAYRA----------FETPEELEQIRKEKGGYDGRARNIPPEEA    134

Query        111 ---------------------------------------------------LRGTTLMAI    119
d1j09a2      135 EERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPDVVLLKSDGYPTYHLANVVD    194

Query        120 SNQEG-HIVLAPGNKSELAVGYSTLYGDSVGAYGPIK-----------------------    155
d1j09a2      195 DHLMGVTDVIR--------------------------AEEWLVSTPIHVLLYRAFGWEAP    228

Query        156 --------------DVYKTSIFRLAEW------RNRAAAERGQTPPIPEASITKPDYPVL    195
d1j09a2      229 RFYHMPLLRNPDKTKISK---------RKSHTSLDWYKA---------------------    258

Query        196 DAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRR    255
d1j09a2      259 ------------------------------------------------------------    259

Query        256 LPITNRWREGH-----------------------------------------------    266
d1j09a2      259 -----------EGFLPEALRNYLCLMGFSMPDGREIFTLEEFIQAFTWERVSLGGPVF    305


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:100.66)
Query          1 ---------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD     45
d1j09a2        1 MVVTRIAPSPTGDPH---V-GTAYIALFNYAWARRNGGRFI-------------------     37

Query         46 ALGAQNVYGVSMPSKYSSDHSKGDAAELARRTG------------LN--------FR--T     83
d1j09a2       38 -------VRIEDT----DRAR-YV-PGAEERILAALKWLGLSYDEGPDVGGPHGPYRQSE     84

Query         84 VS--IEPMFDAYMASL-GL-T------------------G--------------------    101
d1j09a2       85 RLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGGYDGRARNIPPEEAEERARRGEPH    144

Query        102 ---LA-------------------------EENL-------Q-SRLRGTTLMAISNQEGH    125
d1j09a2      145 VIRLKVPRPGTTEVKDELRGVVVYDNQEIPDVVLLKSDGYPTYHLANVVDDHLMG----V    200

Query        126 IVLAPGNKSELAVGYSTLYGDS--------VGAYGPIKDVY-----KTSIF-RLAEWRNR    171
d1j09a2      201 TDVIR-AEEWL--V-STPIHVLLYRAFGWEAPRFY-HMPLLRNPDKTKISKRKSHTSLDW    255

Query        172 AAAERGQ--------------------------------TPPIPEASITKPDYPVLDAIL    199
d1j09a2      256 YKAEGFLPEALRNYLCLMGFSMPDGREIFTLEEFIQAFT---------------------    294

Query        200 ELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKG--FGKDRRLP    257
d1j09a2      295 -----------------------------------------WERVSLGGPVF--------    305

Query        258 ITNRWREGH    266
d1j09a2      306 ---------    306


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.23)
DALI match                                 
Query        204 DRDTGADAIVAAGYDRELVVKTLRMV    229
d1j09a2      248 KSHTSLDWYKAEGFLPEALRNYLCLM    273



top
39: d1pkla3 Pyruvate kinase,​ C-​terminal domain (svm: 0.691)

SCOP Superfamily: PK C-​terminal domain-​like  |  SCOP Fold: Pyruvate kinase C-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.57  Contact: 886
Modified z-scores:
dali:0.95 daliz:0.92 gdtts:0.92 tmscore:0.94 rmsd:0.38 AHM:0.40 LBcontacta:0.90 LBcontactb:0.90 LHM:0.27
id:0.74 blosum:0.35 compass:0.37 pearson:0.94
Scaled scores:
dali:0.68 daliz:0.35 gdtts:0.47 tmscore:0.54 rmsd:0.74 AHM:0.66 LBcontacta:0.38 LBcontactb:0.55 LHM:0.31
id:0.00 blosum:0.07 compass:0.16 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 5.1 Raw score:426.80)
Query          1 -------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGgidsALVAAIACDAL     47
d1pkla3        1 neyvffnsikklqHIPMSADEAVCSSAVNSVYETKAKAMVVLSNT----GRSARLVAKYR     56

Query         48 GaqNVYGVSMpskyssdhsKGDAAELARRTG-LNFRTVSIEPMFdaymaslgltglaeen    106
d1pkla3       57 PncPIVCVTT---------RLQTCRQLNITQgVESVFFDADKLG--------------hd     93

Query        107 LQSRLRGTTLMAISNQE-------gHIVLAPGnkselavgystlygdsVGAYgpikdvyk    159
d1pkla3       94 EGKEHRVAAGVEFAKSKgyvqtgdyCVVIHAA---------------nQTRI--------    130

Query        160 tsifrlaewrnraaaergqtppipeasitkpdypvldailelyvdrdtgadaivaagydr    219
d1pkla3      131 ------------------------------------------------------------    131

Query        220 elvvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwregh    266
d1pkla3      131 -------------------------------------------llve    134


hit structure      alignment
FAST alignment (Normalized score: 4.33 Raw score:816.80)
Query          1 DADE-----------------EVYSALVVGLRAYVAKNGFRSVLIGLSGGIDS--ALVAA     41
d1pkla3        1 ----NEYVFFNSIKKLQHIPMSADEAVCSSAVNSVYETKAKAMVVLS------NTGRSAR     50

Query         42 IACDALGAQ-----NVYGVSMPSKYSSDHSKGDAAELARRT-GLNFRTVSIEPMFDAYMA     95
d1pkla3       51 LVAK-----YRPNCPIVCVT-----TRLQTCRQ----LNITQGVESVFFDADK-------     89

Query         96 SLGLTGLAEENL-----QSRLRGTTLMAISNQE-------GHIVLAPGNKSELAVGYSTL    143
d1pkla3       90 ------------LGHDEGKEHRVAAGVEFAKSKGYVQTGDYCVVIH--------------    123

Query        144 YGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYV    203
d1pkla3      124 ------------------------------------------------------------    124

Query        204 DRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWR    263
d1pkla3      124 ------------------------------------------------------------    124

Query        264 EGH-----------    266
d1pkla3      124 ---AANQTRILLVE    134


hit structure      alignment
TMalign alignment (TM-score: 0.32 Raw score:84.13)
Query          1 ------------DADEE-VY--SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACD     45
d1pkla3        1 NEYVFFNSIKKL--QHIPMSADEAVCSSAVNSVYETKAKAMVVLSNT---GR-SARLVAK     54

Query         46 ALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE    105
d1pkla3       55 YRPNCPIVCVT-T-------RLQTCRQ-LNITQGVESVFFDADKL-------------GH     92

Query        106 NLQSRLRGTTLMAISNQ--EG----HIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYK    159
d1pkla3       93 DEGKEHRVAAGVEFAKSKGYVQTGDYCVVIHAAN------------Q--TRI--------    130

Query        160 TSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDR    219
d1pkla3      131 ------------------------------------------------------------    131

Query        220 ELVVKTLRMVDTAEYKRRQYP---PGTKISAKGFGKDRRLPITNRWREGH    266
d1pkla3      131 --------------------LLVE--------------------------    134


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.42)
DALI match                           
Query         37 ALVAAIACDALGAQNVYGVS     56
d1pkla3       24 CSSAVNSVYETKAKAMVVLS     43



top
40: d1e5xa_ Threonine synthase (svm: 0.724)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.26  Contact: 865
Modified z-scores:
dali:0.96 daliz:0.94 gdtts:0.94 tmscore:0.95 rmsd:0.38 AHM:0.40 LBcontacta:0.92 LBcontactb:0.94 LHM:0.28
id:0.95 blosum:0.28 compass:0.55 pearson:0.92
Scaled scores:
dali:0.75 daliz:0.43 gdtts:0.49 tmscore:0.58 rmsd:0.79 AHM:0.72 LBcontacta:0.38 LBcontactb:0.58 LHM:0.36
id:0.06 blosum:0.06 compass:0.07 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:581.70)
Query          1 ------------------------------------------------------------      1
d1e5xa_        1 ietavkpphrtednirdenavnpfsakyvpfnaapgstesysldeivyrglldvehdmea     60

Query          1 ------------------------DADEE-------------------------------      5
d1e5xa_       61 lkrfdgaywrdlfdsrvgkstwpyGSGVWskkewvlpeiddddivsafegnsnlfwaerf    120

Query          6 --------------------------vysALVVGLRAYVAK-NGFRSVLIGLSgGIDSAL     38
d1e5xa_      121 gkqflgmndlwvkhcgishtgsfkdlgmtVLVSQVNRLRKMkRPVVGVGCAST-GDTSAA    179

Query         39 VAAIACDALGaqNVYGVSMPSkyssdhSKGDAaELARRTGLNFRTVSIepmfdaymaslg     98
d1e5xa_      180 LSAYCASAGI--PSIVFLPAN----kiSMAQL-VQPIANGAFVLSIDT------------    220

Query         99 ltglaeenlQSRLRGTTLMAISNQEGHIVLApgnkselavgystlygdsvgayGPIKDVY    158
d1e5xa_      221 ---------DFDGCMKLIREITAELPIYLAN----------------------SLNSLRL    249

Query        159 ktsifrlaewrnraaaergqtppipeasitkPDYP-----VLDAILELYvDRDT--gaDA    211
d1e5xa_      250 ---------egqktaaieilqqfdwqvpdwvIVPGgnlgnIYAFYKGFK-XCQElglvDR    299

Query        212 IV--------------------------aagydrelVVKTLR------------------    227
d1e5xa_      300 IPrmvcaqaananplylhyksgwkdfkpvsidravyALKKCNgiveeateeelmdamaqa    359

Query        228 -----------------------------------------------------mvdtaey    234
d1e5xa_      360 dstgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdma    419

Query        235 krrqyppgtkisakgfgkdrrlpitnrwregh    266
d1e5xa_      420 crfsnppvdvkadfgavmdvlksylgsntlts    451


hit structure      alignment
FAST alignment (Normalized score: 2.77 Raw score:958.30)
Query          1 DA----------------------------------------------------------      2
d1e5xa_        1 --IETAVKPPHRTEDNIRDENAVNPFSAKYVPFNAAPGSTESYSLDEIVYRGLLDVEHDM     58

Query          3 ------------------------------------------------------------      3
d1e5xa_       59 EALKRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAE    118

Query          3 -------------------------DEEVYSALVVGLRAYVA-KNGFRSVLIGLSGGIDS     36
d1e5xa_      119 RFGKQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGC-ASTGDTS    177

Query         37 ALVAAIACDALGAQ---NVYGVSMPSKY---SSDHSKGDAAELARRTGLNFRTVSIEPMF     90
d1e5xa_      178 AALSAYCAS-----AGIPSIVFLP----ANKISMAQLVQPI----ANGAFVLSI------    218

Query         91 DAYMASLGLTGLAEENL--QSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSV    148
d1e5xa_      219 -----------------DTDFDGCMKLIREITAELPIYL---------------------    240

Query        149 GAY-----GPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYV    203
d1e5xa_      241 ---ANSLNSLRLE-----------------------------------------------    250

Query        204 DRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWR    263
d1e5xa_      251 ------------------------------------------------------------    251

Query        264 EGH---------------------------------------------------------    266
d1e5xa_      251 ---GQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKXCQELGLVDRIPRMVCAQ    307

Query        267 ------------------------------------------------------------    267
d1e5xa_      308 AANANPLYLHYKSGWKDFKPVSIDRAVYALKKCNGIVEEATEEELMDAMAQADSTGMFIC    367

Query        267 ------------------------------------------------------------    267
d1e5xa_      368 PHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQSKIDYHSNAIPDMACRFSNPPV    427

Query        267 ------------------------    267
d1e5xa_      428 DVKADFGAVMDVLKSYLGSNTLTS    451


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:93.73)
Query          1 ---------------------DADEEVYSALV----------VGLRAYV-----------     18
d1e5xa_        1 IETAVKPPHRTEDNIRDENAV---NPF-SAKYVPFNAAPGSTESYSLDEIVYRGLLDVEH     56

Query         19 ------------------------------------------------------------     19
d1e5xa_       57 DMEALKRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFW    116

Query         19 -------------------------AKNGFRSVLIGLSG-GI-DSALVAAIACDALG-A-     49
d1e5xa_      117 AERFGKQFLGMNDLWVKHCGISHTG-------------SFKDLGMTVLVSQVNRLRKMKR    163

Query         50 QNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPM------------------FD     91
d1e5xa_      164 PVVGVGCAST--G--DTSAALSAYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSID    219

Query         92 AYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVL-APGNKSELAVGYSTLYGDSVGA    150
d1e5xa_      220 TD--------------F-DGCMKLIREITAELPIYLANSLNS------------------    246

Query        151 YGPIKDVYKTSIFRL-------------AEWRNRAAAERGQTPPIPEASITKPD------    191
d1e5xa_      247 --LRL-EGQKTAAIEILQQFDWQVPDWV------------------------IVPGGNLG    279

Query        192 YPVLDAILEL--YVDR-----DTGADAIVAAGYDREL--------V-VKTLRMVDTAEYK    235
d1e5xa_      280 NIYAFYKGFKXC--QELGLVD--------RIPRMVCAQAANANPLYLHYKSGWKDFKPVS    329

Query        236 RRQY--PPGTKISAKGF-------------------------------------------    250
d1e5xa_      330 ID-RAV---------YALKKCNGIVEEATEEELMDAMAQADSTGMFICPHTGVALTALFK    379

Query        251 ------------------------------------------------------------    251
d1e5xa_      380 LRNQGVIAPTDRTVVVSTAHGLKFTQSKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDV    439

Query        251 ------------GKDRRLPITNRWREGH    266
d1e5xa_      440 LKSYLGSNTLTS----------------    451


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.26)
DALI match        ************........... ************** . ...  .....   .  ..
Query          8 SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSK     67
d1e5xa_      149 TVLVSQVNRLRKMKRPVVGVGCASTGDTSAALSAYCASA-GIPSI--VFLPANKISMAQL    205

DALI match       ... .
Query         68 GDAAE     72
d1e5xa_      206 VQPIA    210



hit structures. 
top
41: d1jzta_ Hypothetical protein YNL200c (YNU0 YEAST) (cs: 2.427)

SCOP Superfamily: YjeF N-​terminal domain-​like  |  SCOP Fold: YjeF N-​terminal domain-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.19  Contact: 1039
Modified z-scores:
dali:0.95 daliz:0.90 gdtts:0.93 tmscore:0.94 rmsd:0.38 AHM:0.35 LBcontacta:0.89 LBcontactb:0.93 LHM:0.15
id:0.80 blosum:0.09 compass:0.28 pearson:0.91
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.46 tmscore:0.56 rmsd:0.74 AHM:0.69 LBcontacta:0.36 LBcontactb:0.60 LHM:0.45
id:0.02 blosum:0.05 compass:0.13 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:532.60)
Query          1 ----------------------DADEEVYSALVVGLRAYVAKNGF----------rSVLI     28
d1jzta_        1 lkvvssklaaeidkelmgpqigFTLQQLMELAGFSVAQAVCRQFPlrgktetekgkHVFV     60

Query         29 GLsGGIDSALVAAIAcDALG--aQNVYGVSMpskyssdhskgdaaELARRTGLNFRTVSI     86
d1jzta_       61 IAgPGNNGGDGLVCA-RHLKlfgYNPVVFYP-krsertefykqlvHQLNFFKVPVLSQDE    118

Query         87 epmfdaymaslgltglaeenlqsrlrgTTLMAisNQEGHIVLA-PGNKSElaVGYS----    141
d1jzta_      119 ------------------------gnwLEYLK--PEKTLCIVDaIFGFSF--KPPMrepf    150

Query        142 TLYG-------dsvgAYGPIKdvyktsifrlaewrnraaaergqtppipeasitkpdypv    194
d1jzta_      151 KGIVeelckvqniipIVSVDV---------------------------------------    171

Query        195 ldailelyvdrdtgadaivaagydrelvvktlrmvdtAEYKrRQYP-PGTK-ISAKGFGK    252
d1jzta_      172 ---------------------------ptgwdvdkgpISQP-SINPaVLVSlTVPKPCSS    203

Query        253 D--------------------------rrlpitnrwregh    266
d1jzta_      204 Hirenqtthyvggrfiprdfankfgfepfgyestdqilkl    243


hit structure      alignment
FAST alignment (Normalized score: 3.00 Raw score:762.30)
Query          1 ----------------------DADEEVYSALVVGLRAYVAKNGF-------------RS     25
d1jzta_        1 LKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCR---QFPLRGKTETEKGKH     57

Query         26 VLIGLSGGI---DSALVAAIACDALGAQ---NVYGVSMPSKYSSDHSKGD----------     69
d1jzta_       58 VFVIAGPGNNGGDGLVCARHLKL-----FGYNPVVFY-------------PKRSERTEFY     99

Query         70 --AAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEE----------------------    105
d1jzta_      100 KQLVHQLNFFKVPVL-----------------------SQDEGNWLEYLKPEKTLCIVDA    136

Query        106 ----------NLQSRLRGTTLMAISNQEGHIVLAPGNKS-------ELAVGYSTLYGDS-    147
d1jzta_      137 IFGFSFKPPMREPFKGIVEELCKVQN--IIPIVS-----VDVPTGWDVDK---------G    180

Query        148 -------VGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILE    200
d1jzta_      181 PISQPSINPAVL------------------------------------------------    192

Query        201 LYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITN    260
d1jzta_      193 ------------------------------------------------------------    193

Query        261 RWREGH---------------------------------------------------    266
d1jzta_      193 ------VSLTVPKPCSSHIRENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL    243


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:101.79)
Query          1 --------------------------DAD-EEVYSALVVGLRAYVAK--N---GF-RSVL     27
d1jzta_        1 LKVVSSKLAAEIDKELMGPQIGFTLQ-QLMELAGFSVAQAVCRQFPLRGKTETEKGKHVF     59

Query         28 IGLSGGIDSALVAAIACDALG-AQNVYGVSMPSKYSSDHSKGDAAELARRTG---LNFRT     83
d1jzta_       60 VIAGPGNNGGDGLVCARHLKLFGYNPVVFYPK----RSERTEFYKQLVHQLNFFKVPVLS    115

Query         84 VS--------------------------IEPMFDAYMASLGLTGLAEENLQ-SRLRGTTL    116
d1jzta_      116 QDEGNWLEYLKPEKTLCIVDAIFGFSFK------------------PPMREPFKGIVEEL    157

Query        117 MAISNQEGHIVLAPGNK--SELAVGYSTL-YGDSVGAYGPIKDVYKTSIFRLAEWRNRAA    173
d1jzta_      158 CKVQN--IIPIVSVDVPTG-WDVDKGPISQ-PSINPAVL--VSLT---------------    196

Query        174 AERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAE    233
d1jzta_      197 --------------------------V--P------------------------KP--CS    202

Query        234 YKRRQ-YPPGTKI----------------SAK------GFGKDRRLPITNRWREGH    266
d1jzta_      203 SHIRENQTTHYVGGRFIPRDFANKFGFEPFGYESTDQILKL---------------    243


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.52)
DALI match       *******************              ****** ************..... ..
Query          2 ADEEVYSALVVGLRAYVAK----------NGFRSVLIGLSGGIDSALVAAIACDALGAQN     51
d1jzta_       24 TLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGDGLVCARHLKLFGY     83

DALI match       ......              ***************      
Query         52 VYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDA     92
d1jzta_       84 NPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQDEGNWLEY    124



top
42: d1j1ua_ Tyrosyl-​tRNA synthetase (TyrRS) (svm: 1.021)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 952
Modified z-scores:
dali:0.97 daliz:0.91 gdtts:0.92 tmscore:0.95 rmsd:0.55 AHM:0.46 LBcontacta:0.93 LBcontactb:0.95 LHM:0.18
id:0.70 blosum:0.15 compass:0.16 pearson:0.96
Scaled scores:
dali:0.72 daliz:0.37 gdtts:0.39 tmscore:0.49 rmsd:0.72 AHM:0.71 LBcontacta:0.34 LBcontactb:0.56 LHM:0.46
id:-0.01 blosum:0.07 compass:0.17 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 5.3 Raw score:573.00)
Query          1 dadeevysALVVG-----lrayvAKNGF----RSVLIGLS----ggIDSALVAAIACDAL     47
d1j1ua_        1 ----mdefEMIKRntseiiseeeLREVLkkdeKSAYIGFEpsgkihLGHYLQIKKMIDLQ     56

Query         48 G-aqNVYGVSMP-------SKYS--SDHSKGDAAELARR--TGLNFRTVS----------     85
d1j1ua_       57 NagfDIIILLADlhaylnqKGELdeIRKIGDYNKKVFEAmgLKAKYVYGSefqldkdytl    116

Query         86 ---------------iepmfdaymASLGLtglAEENLQSRLRGTTLMAIsnqEGHIVLAP    130
d1j1ua_      117 nvyrlalkttlkrarrsmeliareDENPK---VAEVIYPIMQVNDIHYL---GVDVAVGG    170

Query        131 GnkselavgystlygDSVG------------AYGPIKdVYKTsifrlaewrnraaaergq    178
d1j1ua_      171 M------------eqRKIHmlarellpkkvvCIHNPV-LTGL------------------    199

Query        179 tppipeaSITK------pdypvLDAIleLYVD----------------------------    204
d1j1ua_      200 dgegnfiAVDDspeeirakikkAYCP-aGVVEgnpimeiakyfleypltikrpekfggdl    258

Query        205 ----------rDTGADAivAAGYdrelvvktlrmvdtaeykrrqyppgtkisakgfgkdr    254
d1j1ua_      259 tvnsyeeleslFKNKEL--HPMD-----------------------------lknavaee    287

Query        255 rlpitnrwregh    266
d1j1ua_      288 likilepirkrl    299


hit structure      alignment
FAST alignment (Normalized score: 2.63 Raw score:742.30)
Query          1 DADEEVYSALVVG---------------LRAYVAKNGF--------RSVLIGLSG-----     32
d1j1ua_        1 -------------MDEFEMIKRNTSEIISEEEL-----REVLKKDEKSAYIGFE-PSGKI     41

Query         33 ---GIDSALVAAIACDALGAQ---NVYGVSMPSKYS-----------SDHSKGDAAELAR     75
d1j1ua_       42 HLGHYLQIKKMIDLQN-----AGFDIIILLA-----DLHAYLNQKGELDEIRKIGDYNKK     91

Query         76 R-----TGLNFRTVS---------IEPMFDAYMASLGLTG--------------------    101
d1j1ua_       92 VFEAMGLKAKYVY--GSEFQLDKDYTLNVYRLAL------KTTLKRARRSMELIAREDEN    143

Query        102 -LAEENLQSRLRGTTLMAISNQEG---HIVLAPGNKSELAVGYSTLYGDSVG--------    149
d1j1ua_      144 PKVAEVIYPIMQVNDIHY------LGVDVAVG--------------------GMEQRKIH    177

Query        150 ------------AYGPIKDV-------------------------------------YKT    160
d1j1ua_      178 MLARELLPKKVVCIHNP---VLTGLDGEGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPI    234

Query        161 SIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRE    220
d1j1ua_      235 MEIAKY------------------------------------------------------    240

Query        221 LVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH--------------    266
d1j1ua_      241 ----------------------------------------------FLEYPLTIKRPEKF    254

Query        267 ---------------------------------------------    267
d1j1ua_      255 GGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRL    299


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:108.52)
Query          1 -----DADEEVYSALVVGL-RAY-VAKNGF----RSVLIGLS-G--GI-DSALVAAIACD     45
d1j1ua_        1 MDEFE-----MIKRNTSEII-SEEELREVLKKDEKSAYIGFEPSGKIHLGHYLQIKKMID     54

Query         46 ALG-AQNVYGVSMP---S---KYS--SD-HSKGDAAELARR--TGLNFRTVS-IEP----     88
d1j1ua_       55 LQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDY    114

Query         89 M---FDA--Y----MASL-------------GLTGLAEENLQSRLRGTTLMAISNQ-EGH    125
d1j1ua_      115 TLNV--YRLALKTT---LKRARRSMELIARE--DENPK-VAE-VIYPIMQVNDIHYLGVD    165

Query        126 IVLAPGNKSELAVGYSTLYGDSVG------------AYGPIKDVYKT-----SIFRLAEW    168
d1j1ua_      166 VAVGGM----------E--QRKIHMLARELLPKKVVCIHNPV-LTGLDGEGN-----FI-    206

Query        169 RNRAAAERGQTPPIPEA-SI-TK--PD--YPVLDAI-LELYVD-----------------    204
d1j1ua_      207 -------------AVDDS-PEEIRA-KIKKAY-CPAG-VVEGNPIMEIAKYFLEYPLTIK    249

Query        205 --------------RDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKI--SA-    247
d1j1ua_      250 RPEKFGGDLTVNSY----------------------------------------EELESL    269

Query        248 ------------------------------KGFGKDRRLPITNRWREGH    266
d1j1ua_      270 FKNKELHPMDLKNAVAEELIKILEPIRKRL-------------------    299


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.85)
DALI match                      ......                   
Query        191 DYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVD    230
d1j1ua_      259 TVNSYEELESLFKNKELHPMDL-----KNAVAEELIKILE    293



top
43: d1nzja_ Glutamyl-​Q tRNA-​Asp synthetase YadB (svm: 0.722)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.15  Contact: 913
Modified z-scores:
dali:0.96 daliz:0.92 gdtts:0.92 tmscore:0.95 rmsd:0.39 AHM:0.36 LBcontacta:0.89 LBcontactb:0.92 LHM:0.18
id:0.84 blosum:0.06 compass:0.13 pearson:0.92
Scaled scores:
dali:0.71 daliz:0.37 gdtts:0.44 tmscore:0.56 rmsd:0.77 AHM:0.73 LBcontacta:0.35 LBcontactb:0.53 LHM:0.42
id:0.02 blosum:0.01 compass:0.13 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:556.20)
Query          1 dadeevysalvvglrayvaknGFRSVLIGLS----gGIDSALVAAIACDALG--aqNVYG     54
d1nzja_        1 ---------------------TQYIGRFAPSpsgelHFGSLIAALGSYLQARarqgRWLV     39

Query         55 VSMPSKY--SSDHSKGDAAELAR--RTGLN-fRTVS--IEPMFDAYMASL----------     97
d1nzja_       40 RIEDIDPprEVPGAAETILRQLEhyGLHWDgdVLWQsqRHDAYREALAWLheqglsyyct     99

Query         98 ---------------------------GLTG---------------------------LA    103
d1nzja_      100 ctrariqsiggiydghcrvlhhgpdnaAVRIrqqhpvtqftdqlrgiihadeklaredFI    159

Query        104 EE----nLQSR-LRGTTLMAISnqegHIVLAPGNK----selavgystlygdsvgAYGPI    154
d1nzja_      160 IHrrdglFAYNlAVVVDDHFQG----VTEIVRGADlieptvrqislyqlfgwkvpDYIHL    215

Query        155 KdVYKT--------sifRLAEW----rnraaAERGQTPpipeasitkpdypvldailely    202
d1nzja_      216 P-LALNalpkgdprpvlIAALQflgqqaeahWQDFSVE----------------------    252

Query        203 vdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgTKISakgfgkdrrlpitnrw    262
d1nzja_      253 --------------------------qilqsavknwrltaVPES----------------    270

Query        263 regh    266
d1nzja_      271 -aiv    273


hit structure      alignment
FAST alignment (Normalized score: 1.92 Raw score:517.00)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSG----------GIDSALVAAIACDALGAQ     50
d1nzja_        1 ---------------------TQYIGRFAP--SPSGELHFGSLIAALGSYLQARA-----     32

Query         51 ---NVYGVSMPS--KYS-SDHSKGDAAELAR-RTGLN-FRTVSIEP---MFDAYMASLGL     99
d1nzja_       33 RQGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHW-DGDVLWQSQRHDAYREALAW---     88

Query        100 TGLAEEN-----------------------------------------------------    106
d1nzja_       89 -------LHEQGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTD    141

Query        107 --------------------------LQSRLRGTTLMAISNQEGHIVLAP-------GNK    133
d1nzja_      142 QLRGIIHADEKLAREDFIIHRRDGLFAYNLAVVVDDHF------------QGVTEIVRGA    189

Query        134 SELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNR----------------------    171
d1nzja_      190 DLI-----------------------------------EPTVRQISLYQLFGWKVPDYIH    214

Query        172 --------------------------AAAERGQTPPIPEASITKPDYPVLDAILELYVDR    205
d1nzja_      215 LPLALNALPKGDPRPVLIAALQFLGQQAEA------------------------------    244

Query        206 DTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREG    265
d1nzja_      245 ------------------------------------------------------------    245

Query        266 H-----------------------------    266
d1nzja_      245 -HWQDFSVEQILQSAVKNWRLTAVPESAIV    273


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:94.40)
Query          1 ---------------DADEEVYSALVVGLRAYVAKNGFRSVLIGLSG----GI--DSA-L     38
d1nzja_        1 TQYIGRFAPSPSGEL--HF-GSLIAALGSYLQARARQGRWLVRIEDIDPPREVPG-AAET     56

Query         39 VAAIAC-DALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVS-IEPMFDAYMAS     96
d1nzja_       57 ILRQLEHYGLHWDGDVLWQ----------S--------------QRHDAYREALAWLHEQ     92

Query         97 L-GL-T------------------------------G-----------------------    101
d1nzja_       93 GLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHADEK    152

Query        102 ---LAEENL------QSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDS-----    147
d1nzja_      153 LAREDFIIHRRDGLFAYNLAVVVDDHFQG---VTEIVR-GADLI--E-PTVRQISLYQLF    205

Query        148 ---VGAYGPIKDVYKTSIFRLAEWRNRAAAER----------------------------    176
d1nzja_      206 GWKVPDYIH-LPLA--L--N--A-L--PK-GDPRPVLIAALQFLGQQAEAHWQDFSVEQI    254

Query        177 --------GQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRM    228
d1nzja_      255 LQSAVKNW----------------------------------------------------    262

Query        229 VDTAEYKRRQYPPGTKISAKGFG-KDRRLPITNRWREGH    266
d1nzja_      263 ------------RLTAVP-ESAIV---------------    273


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.52)
DALI match        ................ .    .......       ************..... ..
Query         32 GGIDSALVAAIACDALGAQNVYGVSMPSKYSS-----DHSKGDAAELARRTGLNFRT     83
d1nzja_       18 GSLIAALGSYLQARARQGR----WLVRIEDIDPPREVPGAAETILRQLEHYGLHWDG     70



top
44: d1v7ca_ Threonine synthase (svm: 0.721)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 926
Modified z-scores:
dali:0.95 daliz:0.94 gdtts:0.93 tmscore:0.94 rmsd:0.46 AHM:0.52 LBcontacta:0.93 LBcontactb:0.92 LHM:0.43
id:0.95 blosum:0.42 compass:0.29 pearson:0.95
Scaled scores:
dali:0.71 daliz:0.39 gdtts:0.46 tmscore:0.55 rmsd:0.71 AHM:0.60 LBcontacta:0.39 LBcontactb:0.55 LHM:0.14
id:0.05 blosum:0.06 compass:0.21 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 5.8 Raw score:519.30)
Query          1 DADE-----------------eVYSA----------------------------------      9
d1v7ca_        1 MRPPlieryrnllpvsektpviSLLEgstpliplkgpeearkkgirlyakyeglnptgsf     60

Query         10 ---lvVGLRAYVAKNGFRSVLIGLSGGiDSALVAAIACDALGaqNVYGVSMPSkyssdhS     66
d1v7ca_       61 kdrgmTLAVSKAVEGGAQAVACASTGN-TAASAAAYAARAGI--LAIVVLPAG-----yV    112

Query         67 KGDAAELARRTGLNFRTVSIepmfdaymaslgltglaeenlQSRLRGTTLMAISNQEGHI    126
d1v7ca_      113 ALGKVAQSLVHGARIVQVEG---------------------NFDDALRLTQKLTEAFPVA    151

Query        127 VLApgnkselavgystlygdsvGAYG-PIKDVyktsifrlaewrnraaaergqtppipea    185
d1v7ca_      152 LVN-------------------SVNPhRLEGQ----------------------------    164

Query        186 sitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtKI    245
d1v7ca_      165 ----------------------------------------------------------KT    166

Query        246 SAKGfgKDRR--------------------------------------------------    255
d1v7ca_      167 LAFE-vVDELgdaphyhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaapl    225

Query        256 ------------------------------------------------------------    256
d1v7ca_      226 vlgrpverpetlatairignpaswqgavrakeesggvieavtdeeilfayrylareegif    285

Query        256 -------------------------------------------------------lpitn    260
d1v7ca_      286 cepasaaamagvfkllregrlepestvvltltghglkdpataervaelpppvparleava    345

Query        261 rwregh    266
d1v7ca_      346 aaagll    351


hit structure      alignment
FAST alignment (Normalized score: 3.05 Raw score:933.00)
Query          1 DADEEV------------------------------------------------------      6
d1v7ca_        1 ------MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGL     54

Query          7 ------YSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQ---NVYGVSM     57
d1v7ca_       55 NPTGSFKDRGMTLAVSKAVEGGAQAVACAST-GNTAASAAAYAAR-----AGILAIVVLP    108

Query         58 PSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENL--QSRLRGTT    115
d1v7ca_      109 -AGYVALGKVAQSL----VHGARIVQV-----------------------EGNFDDALRL    140

Query        116 LMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYG------PIKDVYKTSIFRLAEWR    169
d1v7ca_      141 TQKLTEAFPVAL-------------------------VNSVNPHRLE-------------    162

Query        170 NRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMV    229
d1v7ca_      163 ------------------------------------------------------------    163

Query        230 DTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH-----------------------    266
d1v7ca_      163 -------------------------------------GQKTLAFEVVDELGDAPHYHALP    185

Query        267 ------------------------------------------------------------    267
d1v7ca_      186 VGNAGNITAHWMGYKAYHALGKAKRLPRMLGFQAAGAAPLVLGRPVERPETLATAIRIGN    245

Query        267 ------------------------------------------------------------    267
d1v7ca_      246 PASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREGR    305

Query        267 ----------------------------------------------    267
d1v7ca_      306 LEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL    351


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:109.96)
Query          1 DADEEVYS-------------ALV------------------------------------     11
d1v7ca_        1 MR-PPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGS     59

Query         12 ------VGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDH     65
d1v7ca_       60 FKDRGMTLAVSKAVEGGAQAVACASTGN-TAASAAAYAARA-G-ILAIVVLPA---GY--    111

Query         66 SKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGH    125
d1v7ca_      112 VALGKVAQSLVHGARIVQVEGN--------------------FD-DALRLTQKLTEAFPV    150

Query        126 IVLAPGNKSELAVGYSTLYGDSVGAYGP-IKDVYKTS-----------IFRLAEWRNRAA    173
d1v7ca_      151 ALVN----------------S-VNPHRLEGQKTLAFEVVDELGDAPHY------------    181

Query        174 AERGQTPPIPEASITKPDY-------PVLD--AILELYV-D----RDTGADAIVAAGYDR    219
d1v7ca_      182 ----------------HALPVGNAGN---ITA-HWMGYKAYHALGKAKRL----------    211

Query        220 ELVVKTL-------------------------------RMVDTAEYKRRQYPPGTKISAK    248
d1v7ca_      212 --PRMLGFQAAGAAPLVLGRPVERPETLATAIRIGNPA-----SWQGAV-----------    253

Query        249 GFGKDRRLPI-TNRWRE-------------------------------------------    264
d1v7ca_      254 --------RAK-EESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKLLREG    304

Query        265 -GH--------------------------------------------    266
d1v7ca_      305 RLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL    351


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.03)
DALI match        *********************  .............. ...  .....  .   .....
Query         11 VVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA     70
d1v7ca_       65 MTLAVSKAVEGGAQAVACASTG--NTAASAAAYAARAGILAI--VVLPAGYVALGKVAQS    120

DALI match       ...
Query         71 AEL     73
d1v7ca_      121 LVH    123



top
45: d1qopb_ Tryptophan synthase,​ beta-​subunit (svm: 0.724)

SCOP Superfamily: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Fold: Tryptophan synthase beta subunit-​like PLP-​dependent enzymes  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 951
Modified z-scores:
dali:0.96 daliz:0.94 gdtts:0.96 tmscore:0.97 rmsd:0.37 AHM:0.36 LBcontacta:0.94 LBcontactb:0.94 LHM:0.43
id:0.76 blosum:0.20 compass:0.22 pearson:0.96
Scaled scores:
dali:0.73 daliz:0.42 gdtts:0.53 tmscore:0.63 rmsd:0.80 AHM:0.75 LBcontacta:0.38 LBcontactb:0.58 LHM:0.20
id:-0.00 blosum:0.05 compass:0.17 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:587.10)
Query          1 --------------------------------------------DADEEVYS--------      8
d1qopb_        1 ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfADLLKNYAgrptaltk     60

Query          9 ---------------------------alvvGLRAYVAKNGFRSVLIGLSGGIDSALVAA     41
d1qopb_       61 cqnitagtrttlylkredllhggahktnqvlGQALLAKRMGKSEIIAETGAGQHGVASAL    120

Query         42 IACDALGaqNVYGVSMPSkyssdHSKGDAAELARRTGLNFRTVSIEPmfdaymaslgltg    101
d1qopb_      121 ASALLGL--KCRIYMGAK---dvERQSPNVFRMRLMGAEVIPVHSGS-------------    162

Query        102 laeenlqSRLRGTTLMAISNQEG--HIVLAPGNkselavgystlygdsvgaygpiKDVYk    159
d1qopb_      163 -----atLKDACNEALRDWSGSYetAHYMLGTA-------------agphpyptiVREF-    203

Query        160 tsifrlaewrnraaaergqtppipeasitkPDYP------vldAILELYvdrDTGA----    209
d1qopb_      204 --------qrmigeetkaqildkegrlpdaVIACvgggsnaigMFADFI---NDTSvgli    252

Query        210 -------------------------------------------daivaagydrelvvktl    226
d1qopb_      253 gvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisagldfpsvgpqh    312

Query        227 RMVDTA--------------------------------------eykrrqyppgtkisak    248
d1qopb_      313 AYLNSIgradyvsitddealeafktlcrhegiipalesshalahalkmmreqpekeqllv    372

Query        249 gfgkdrrlpitnrwregh    266
d1qopb_      373 vnlsgrgdkdiftvhdil    390


hit structure      alignment
FAST alignment (Normalized score: 2.96 Raw score:951.70)
Query          1 DADE--------------------------------------------------------      4
d1qopb_        1 ----TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPT     56

Query          5 ---------------------------EVYSALVVGLRAYVAKNGFRSVLIGLSG--GID     35
d1qopb_       57 ALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAET--GAGQH    114

Query         36 SALVAAIACDALGAQ---NVYGVSMPSKYSSDHS------KGDAAELARRTGLNFRTVSI     86
d1qopb_      115 GVASALASAL-----LGLKCRIYMG---------AKDVERQSPNVFRMRLMGAEVIPVH-    159

Query         87 EPMFDAYMASLGLTGLAEENL----QSRLRGTTLMAISNQ--EGHIVLAPGNKSELAVGY    140
d1qopb_      160 ---------------------SGSATLKDACNEALRDWSGSYETAHYMLG----------    188

Query        141 STLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILE    200
d1qopb_      189 ------------------------------------------------------------    189

Query        201 LYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITN    260
d1qopb_      189 ------------------------------------------------------------    189

Query        261 RWREGH------------------------------------------------------    266
d1qopb_      189 ------TAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFAD    242

Query        267 ------------------------------------------------------------    267
d1qopb_      243 FINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAG    302

Query        267 ------------------------------------------------------------    267
d1qopb_      303 LDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMR    362

Query        267 ----------------------------    267
d1qopb_      363 EQPEKEQLLVVNLSGRGDKDIFTVHDIL    390


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:117.13)
Query          1 ------------------------------------------------DA-DEEV-----      6
d1qopb_        1 TTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTK     60

Query          7 --------------------Y-----SALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAA     41
d1qopb_       61 CQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASAL    120

Query         42 IACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTG    101
d1qopb_      121 ASALLGL--KCRIYMGAK--DVERQ-SPNVFRMRLMGAEVIPVHS--GSA----------    163

Query        102 LAEENLQSRLRGTTLMAISNQE--GHIVLAPGNKSELAVGYSTLYGDSVGAYG-PIK-DV    157
d1qopb_      164 ------TLKDACNEALRDWSGSYETAHYMLGT----A---------AGPHPYPTIVREFQ    204

Query        158 YKTS-----------------IFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLD----    196
d1qopb_      205 RMIGEETKAQILDKEGRLPDA-------------------------------VIACVGGG    233

Query        197 -AILELYVDR-DTGADAIVAAGYDRELVVKTL---------------RMV---DTA-EYK    235
d1qopb_      234 SNAIGMFADFINDT--SV---------GLIGVEPGGHGIETGEHGAP-LKHGR--VG-IY    278

Query        236 -RRQY----------------------------PPGTKISAKGFGKDRRLPITNRWREGH    266
d1qopb_      279 F-GMKAPMMQTADGQIEESYSISAGLDFPSVGP---------------QHAYLNSIGRAD    322

Query        267 ------------------------------------------------------------    267
d1qopb_      323 YVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKD    382

Query        267 --------    267
d1qopb_      383 IFTVHDIL    390


hit structure      alignment
HHsearch alignment (Probability: 0.14 E-value:0.03)
DALI match         ********************************** . ...  ....      ******
Query         11 VVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDA     70
d1qopb_       90 VLGQALLAKRMGKSEIIAETGAGQHGVASALASALL-GLKCR--IYMG--AKDVERQSPN    144

DALI match       ***************
Query         71 AELARRTGLNFRTVS     85
d1qopb_      145 VFRMRLMGAEVIPVH    159



hit structures. 
top
46: d1gtra2 Glutaminyl-​tRNA synthetase (GlnRS) (svm: 0.726)

SCOP Superfamily: Nucleotidylyl transferase  |  SCOP Fold: Adenine nucleotide alpha hydrolase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.21  Contact: 978
Modified z-scores:
dali:0.95 daliz:0.92 gdtts:0.94 tmscore:0.96 rmsd:0.37 AHM:0.34 LBcontacta:0.83 LBcontactb:0.85 LHM:0.17
id:0.85 blosum:0.12 compass:0.11 pearson:0.92
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.47 tmscore:0.59 rmsd:0.76 AHM:0.72 LBcontacta:0.29 LBcontactb:0.44 LHM:0.45
id:0.03 blosum:0.04 compass:0.13 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 4.2 Raw score:540.90)
Query          1 dadeevysalVVGLRAYVAKNG-----FRSVLIGLS--------gGIDSALVAAIACDAL     47
d1gtra2        1 ----------TNFIRQIIDEDLasgkhTTVHTRFPPepngylhigHAKSICLNFGIAQDY     50

Query         48 GaqNVYG-VSMPSKY--SSDHSKGDAAELAR--RTGLN-fRTVSIEPM------------     89
d1gtra2       51 K--GQCNlRFDDTNPvkEDIEYVESIKNDVEwlGFHWSgnVRYSSDYFdqlhayaielin    108

Query         90 -----------------------------------------------fdaymasLGLT--    100
d1gtra2      109 kglayvdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkACLRak    168

Query        101 -----------GLAEE-----------------NLQSRLRGTTLMAISnqegHIVLAPGN    132
d1gtra2      169 idmaspfivmrDPVLYrikfaehhqtgnkwciyPMYDFTHCISDALEG----ITHSLCTL    224

Query        133 K------selavgystlygdsvGAYGpiKDVYKT--------------------------    160
d1gtra2      225 EfqdnrrlydwvldnitipvhpRQYE--FSRLNLeytvmskrklnllvtdkhvegwddpr    282

Query        161 ------------sifRLAEWRNRaaaergqtppipeasitkpdypvldailelyvdrdtg    208
d1gtra2      283 mptisglrrrgytaaSIREFCKR-------------------------------------    305

Query        209 adaivaagydrelvvktlrmvdtaeykrrqyppgTKISakgfgkdrrlpitnrwregh    266
d1gtra2      306 -------------------------------igvTKQD-ntiemaslesciredlnen    331


hit structure      alignment
FAST alignment (Normalized score: 2.18 Raw score:646.20)
Query          1 DADEEVY-SALVVGLRAYVAKN--GFRSVLIGLSG-----------GIDSA-LVAAIACD     45
d1gtra2        1 -------TNFIRQIIDEDLA--SGKHTTVHTRF--PPEPNGYLHIGHAKSICLNFGIAQD     49

Query         46 ALGAQ---NVYGVSMPS--KYSSDHSKGDAAELARRTGL-----NFRTV--SIEPMFDAY     93
d1gtra2       50 -----YKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLG-FHWSGNVRY-SSDYFDQLHAY    102

Query         94 MASLGLTGLAEENLQSR-------------------------------------------    110
d1gtra2      103 AIE--------------LINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLA    148

Query        111 ------------------------------------------------------LRGTTL    116
d1gtra2      149 LFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTH    208

Query        117 MAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAER    176
d1gtra2      209 CISDALEGI-THSLCTLEF-----------------------------------------    226

Query        177 GQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKR    236
d1gtra2      227 ------------------------------------------------------------    227

Query        237 RQYPPGTKISAKGFGKDRRLPITNRWREGH------------------------------    266
d1gtra2      227 ------------------------------QDNRRLYDWVLDNITIPVHPRQYEFSRLNL    256

Query        267 ------------------------------------------------------------    267
d1gtra2      257 EYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIE    316

Query        267 ---------------    267
d1gtra2      317 MASLESCIREDLNEN    331


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:114.60)
Query          1 DADEEVYSALVVGLRAYVAKNG----F--RSVLIGLSG---GI-DSALVAAIACDALGA-     49
d1gtra2        1 ----------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDY     50

Query         50 -QNVYGVSMPS-KY-SSDHSKGDAAELARR--TGLN-FRTVSIE-PMFDA--Y-------     93
d1gtra2       51 KGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKG    110

Query         94 ---------------------------------------MASL----G-LTG-L------    102
d1gtra2      111 LAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKID    170

Query        103 -----------A--EE--------------NLQSRLRGTTLMAISNQEGHIVLAPGNKSE    135
d1gtra2      171 MASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALE--GITHSLC-TL--E    225

Query        136 LAVGYSTLYGDSV-------------GAYGPIKDVYKTS--IF-----------------    163
d1gtra2      226 FQ-D--N--RRLYDWVLDNITIPVHPRQYEF--SRLNLEYTVMSKRKLNLLVTDKHVEGW    278

Query        164 -----RLA--EW--RNRAAAERGQTPP-------IPEASITKPDYPVLDAILELYVDRDT    207
d1gtra2      279 DDPRMPTISGLRRR-GYTAAS----IREFCKRIG--------------------------    307

Query        208 GADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISA------------------KG    249
d1gtra2      308 ----------------------------------VTKQDNTIEMASLESCIREDLNEN--    331

Query        250 FGKDRRLPITNRWREGH    266
d1gtra2      332 -----------------    332


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.35)
DALI match                             
Query        208 GADAIVAAGYDRELVVKTLRMV    229
d1gtra2      285 TISGLRRRGYTAASIREFCKRI    306



top
47: d1dnpa2 DNA photolyase (svm: 1.499)

SCOP Superfamily: Cryptochrome/​photolyase,​ N-​terminal domain  |  SCOP Fold: Cryptochrome/​photolyase,​ N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.30  Contact: 912
Modified z-scores:
dali:0.96 daliz:0.94 gdtts:0.96 tmscore:0.96 rmsd:0.30 AHM:0.32 LBcontacta:0.89 LBcontactb:0.87 LHM:0.22
id:0.83 blosum:0.36 compass:0.27 pearson:0.93
Scaled scores:
dali:0.71 daliz:0.40 gdtts:0.57 tmscore:0.66 rmsd:0.80 AHM:0.72 LBcontacta:0.41 LBcontactb:0.54 LHM:0.33
id:0.03 blosum:0.08 compass:0.22 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 5.2 Raw score:505.00)
Query          1 dadeevysalvvglrayvakngfRSVLIGLSGG--idsALVAAIACDALGaQNVYGVSMP     58
d1dnpa2        1 -----------------------TTHLVWFRQDlrlhdNLALAAACRNSS-ARVLALYIA     36

Query         59 SKY-------------sSDHSKGDAAELARRTGLNFRTVSIEpmfdaymaslgltglaee    105
d1dnpa2       37 TPRqwathnmsprqaelINAQLNGLQIALAEKGIPLLFREVD------------------     78

Query        106 nlQSRLRGTTLMAISNQEGH-IVLAPGnkselavGYSTlyGDSVG-------AYGPIKdv    157
d1dnpa2       79 --DFVASVEIVKQVCAENSVtHLFYNY-----qyEVNEraRDVEVeralrnvVCEGFDds    131

Query        158 YKTS--------------------------ifrlaEWRNraaaergqtppipeasitkpd    191
d1dnpa2      132 VILPpgavmtgnhemykvftpfknawlkrlregmpECVA---------------------    170

Query        192 ypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgtkisakgfg    251
d1dnpa2      171 ---------------------------------------------apkvrssgsiepsps    185

Query        252 kdrrlpitnrwregh    266
d1dnpa2      186 itlnyprqsfdtahf    200


hit structure      alignment
FAST alignment (Normalized score: 3.50 Raw score:806.60)
Query          1 DADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDS--------ALVAAIACDALGAQ--     50
d1dnpa2        1 -----------------------TTHLVWF------RQDLRLHDNLALAAACR-----NS     26

Query         51 --NVYGVSMPSKYS-----------SDHSKGDAAELARR---TGLNFRTVSIEPMFDAYM     94
d1dnpa2       27 SARVLALYIATPR-QWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFRE---------     76

Query         95 ASLGLTGLAEENL--QSRLRGTTLMAISNQEG-HIVLAPGNKSELAVGYSTLY-------    144
d1dnpa2       77 -------------VDDFVASVEIVKQVCAENSVTHLFY---------------NYQYEVN    108

Query        145 ---GDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILEL    201
d1dnpa2      109 ERARDVE-----------------------------------------------------    115

Query        202 YVDRDTGADAIVAAGYDR---------------------------------ELVVKTLRM    228
d1dnpa2      116 ------------------VERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAW    157

Query        229 VDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH----------------------    266
d1dnpa2      158 LKR-----------------------------------LREGM<