HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8
Comments and suggestions to: grishin@chop.swmed.edu


Query1: 1u84 a
Query2: 1mp1 a
Mode: Pairwise comparison, accurate
Access to advanced search results:   Query1   Query2  


Summary

score component
The query pair have a score better than threshold (HHsearch score above 0.9 or SVM score above 0.4)
1.114 svm

Alignments and Scores

In each alignment, the 1st sequence corresponds to the query, and the 2nd sequence corresponds to the hit.

DALI alignment (Z-score: 4.8 Raw score:258.80)
query1         1 -----------------gqqLNRLLLEWIGAW--DPFGLgkdAYDVEAASVLQAVYE-TE     40
                                     ::::::::::::  :::::   ::::::::::::::: ::
query2         1 shmqlkfaeclekkvdmskvNLEVIKPWITKRvtEILGF---EDDVVIEFIFNQLEVkNP     57

query1        41 DARTLAARIQSiyefafdepIPFPHCLKLARRLLELKQAAS-------------------     81
                 :::::::::::         :::::::::::::::::::::                   
query2        58 DSKMMQINLTG--------fLNGKNAREFMGELWPLLLSAQeniagipsaflelkkeeik    109

query1        82 --     82
                   
query2       110 qr    111


FAST alignment (Normalized score: 5.88 Raw score:557.60)
query1         1 G----------------------QQLNRLLLEWIGAWDPFGLGKD----AYDVEAASVLQ     34
                                        :::::::::::::             :::::::::::
query2         1 -SHMQLKFAECLEKKVDMSKVNLEVIKPWITKRVTE---------ILGFEDDVVIEFIFN     50

query1        35 AVYET---EDARTLAARIQSIYEFAFDEPIPFPHCLKLARRLLELKQAAS----------     81
                 :::     ::::::::::::        :::::::::::::::::::::           
query2        51 QLE--VKNPDSKMMQINLTG--------FLNGKNAREFMGELWPLLLSA-QENIAGIPSA     99

query1        82 ------------     82
                             
query2       100 FLELKKEEIKQR    111


TMalign alignment (TM-score: 0.56 Raw score:45.72)
query1         1 --------------------GQQLNRLLLEWIGAW--DPFGLGKDAYDVEAASVLQAV-Y     37
                                        ::::::::::::  ::: ::  ::::::::::::: :
query2         1 SHMQLKFAECLEKKVDMSKV---NLEVIKPWITKRVTEIL-GF--EDDVVIEFIFNQLEV     54

query1        38 ETEDARTLAARIQSIYEFAFDEPIP-FPH-CLKLARRLL-ELKQ-A-AS-----------     81
                 :::   :: ::::::::::: :::: : : ::::::: : :: : : ::           
query2        55 KNP---DS-KMMQINLTGFL-NGKNAR-EFMGELWPL-LLSA-QENIAGIPSAFLELKKE    106

query1        82 -----     82
                      
query2       107 EIKQR    111


HHsearch alignment (Probability: 0.01 E-value:0.83)
query1        23 DAYDVEAASVLQAVYETEDARTLAARIQSIYEFAFDEPIPFPHCLKLARRLLELKQA     79
                 :::::::::::::::::::::::::::::::::::::::::  ::::::::::::::
query2        38 GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREF--MGELWPLLLSAQEN     92


Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.95 tmscore:0.97 rmsd:0.29 AHM:0.27 LBcontacta:0.89 LBcontactb:0.88 LHM:0.20
id:0.94 blosum:0.91 compass:0.71 pearson:0.95
Scaled scores:
dali:0.57 daliz:0.42 gdtts:0.54 tmscore:0.56 rmsd:0.76 AHM:0.70 LBcontacta:0.29 LBcontactb:0.33 LHM:0.55
id:0.07 blosum:0.15 compass:0.17 pearson:0.23