HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T0582d1
Query:
T0582_Ad1.pdb
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1vj2a_ Hypothetical protein TM1459 RmlC-​like cupins Double-​stranded beta-​helix All β 10.14 1.662 0.97 11.8 9.8 0.68
2 d1o4ta_ Hypothetical protein TM1287 RmlC-​like cupins Double-​stranded beta-​helix All β 9.12 1.463 0.97 11.6 8.8 0.68
3 d1lrha_ Auxin binding protein RmlC-​like cupins Double-​stranded beta-​helix All β 8.82 1.316 0.97 9.7 7.7 0.67
4 d1sfna_ Hypothetical protein DR1152 RmlC-​like cupins Double-​stranded beta-​helix All β 6.68 1.868 0.97 10.4 7.1 0.75
5 d1sefa_ Hypothetical protein EF2996 RmlC-​like cupins Double-​stranded beta-​helix All β 6.33 1.737 0.97 10.0 6.1 0.74
6 d1dgw.1 Seed storage 7S protein RmlC-​like cupins Double-​stranded beta-​helix All β 6.29 0.153 0.97 8.0 6.3 0.60
7 d1fi2a_ Germin RmlC-​like cupins Double-​stranded beta-​helix All β 6.27 0.942 0.97 7.4 5.4 0.60
8 d1od5a2 Seed storage 7S protein RmlC-​like cupins Double-​stranded beta-​helix All β 6.18 0.354 0.97 7.7 5.8 0.61
9 d1dgwa_ Seed storage 7S protein RmlC-​like cupins Double-​stranded beta-​helix All β 6.16 0.859 0.97 8.6 5.5 0.60
10 d1qxra_ Glucose-​6-​phosphate isomerase,​ GPI RmlC-​like cupins Double-​stranded beta-​helix All β 6.14 0.101 0.97 7.5 5.5 0.63
11 d1sq4a_ Glyoxylate-​induced protein PA1140 RmlC-​like cupins Double-​stranded beta-​helix All β 6.01 2.036 0.97 10.1 6.0 0.67
12 d1od5a1 Seed storage 7S protein RmlC-​like cupins Double-​stranded beta-​helix All β 5.88 0.772 0.97 7.3 5.9 0.63
13 d2arca_ Regulatory protein AraC Regulatory protein AraC Double-​stranded beta-​helix All β 5.66 0.329 0.97 6.4 5.0 0.58
14 d1o5ua_ Hypothetical protein TM1112 RmlC-​like cupins Double-​stranded beta-​helix All β 5.64 1.169 0.97 6.5 6.7 0.47
15 d1juha_ Quercetin 2,​3-​dioxygenase RmlC-​like cupins Double-​stranded beta-​helix All β 5.49 1.119 0.97 9.2 5.6 0.74
16 d1j1la_ Pirin RmlC-​like cupins Double-​stranded beta-​helix All β 5.37 1.062 0.97 9.2 5.5 0.59
17 d1e5sa_ Type II Proline 3-​hydroxylase (proline oxidase) Clavaminate synthase-​like Double-​stranded beta-​helix All β 4.97 0.315 0.97 5.8 4.2 0.60
18 d1j58a_ Oxalate decarboxylase OxdC (YvrK) RmlC-​like cupins Double-​stranded beta-​helix All β 4.84 1.057 0.97 8.9 4.7 0.67
19 d1jopa_ Hypothetical protein HI0227 Clavaminate synthase-​like Double-​stranded beta-​helix All β 4.49 1.387 0.12 5.3 4.9 0.48
20 d1eyba_ Homogentisate dioxygenase RmlC-​like cupins Double-​stranded beta-​helix All β 4.23 0.451 0.96 6.6 4.1 0.68
21 d1pf0a_ Putative ion channel CnbD cAMP-​binding domain-​like Double-​stranded beta-​helix All β 4.20 1.414 0.23 4.6 3.5 0.50
22 d1h2ka_ Hypoxia-​inducible factor HIF ihhibitor (FIH1) Clavaminate synthase-​like Double-​stranded beta-​helix All β 4.03 -0.543 0.97 5.7 4.3 0.62
23 d1x8ma_ 5-​keto-​4-​deoxyuronate isomerase KduI RmlC-​like cupins Double-​stranded beta-​helix All β 4.01 0.134 0.96 7.7 4.1 0.63
24 d1m4oa_ Acireductone dioxygenase RmlC-​like cupins Double-​stranded beta-​helix All β 4.00 0.253 0.97 2.8 3.3 0.47
25 d1o7fa2 Regulatory domain of Epac2,​ domains 1 and 3 cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.99 1.391 0.03 4.6 3.4 0.52
26 d1o7fa3 Regulatory domain of Epac2,​ domains 1 and 3 cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.87 1.392 0.04 4.4 3.7 0.47
27 d1cx4a2 Regulatory subunit of Protein kinase A cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.71 1.572 0.13 4.9 3.4 0.47
28 d1qwra_ Mannose-​6-​phosphate isomerase ManA RmlC-​like cupins Double-​stranded beta-​helix All β 3.68 0.430 0.97 6.9 3.7 0.58
29 d1ne6a2 Regulatory subunit of Protein kinase A cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.67 1.432 0.05 4.0 3.5 0.46
30 d1cx4a1 Regulatory subunit of Protein kinase A cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.66 0.409 0.91 4.2 3.3 0.48
31 d1q3ea_ HCN pacemaker channel cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.53 0.604 0.94 4.5 2.9 0.50
32 d1ft9a2 CO-​sensing protein CooA,​ N-​terminal domain cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.52 -0.686 0.90 3.7 3.9 0.44
33 d1i5za2 Catabolite gene activator protein,​ N-​terminal domain cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.42 -0.242 0.92 3.9 3.6 0.46
34 d1o5la1 CRP-​like transcriptional regulator TM1171,​ N-​terminal domain cAMP-​binding domain-​like Double-​stranded beta-​helix All β 3.35 1.374 0.09 4.4 3.3 0.45
35 d1oi6a_ dTDP-​4-​keto-​6-​deoxy-​glucose-​5-​epimerase EvaD RmlC-​like cupins Double-​stranded beta-​helix All β 3.14 0.240 0.96 3.8 3.4 0.48
36 d1ktba1 Melibiase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 3.094 -1.025 0.01 4.9 3.9 0.46
37 d1nxma_ dTDP-​4-​dehydrorhamnose 3,​5-​epimerase RmlC RmlC-​like cupins Double-​stranded beta-​helix All β 3.01 0.065 0.96 4.0 3.6 0.47
38 d1r46a1 Melibiase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.956 -1.174 0.01 5.0 2.6 0.42
39 d1ep0a_ dTDP-​4-​dehydrorhamnose 3,​5-​epimerase RmlC RmlC-​like cupins Double-​stranded beta-​helix All β 2.95 0.210 0.96 4.0 3.5 0.47
40 d1uasa1 Melibiase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.792 -1.062 0.01 4.3 3.5 0.43
41 d1bvp12 BTV vp7,​ central (top) domain Viral protein domain Viral protein domain All β 2.679 0.596 0.01 3.8 2.7 0.47
42 d1j0ha2 Neopullulanase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.645 -1.414 0.01 4.6 3.8 0.40
43 d1omia1 Listeriolysin regulatory protein PrfA,​ N-​terminal domain cAMP-​binding domain-​like Double-​stranded beta-​helix All β 2.62 1.388 0.01 3.6 3.6 0.34
44 d1pmia_ Phosphomannose isomerase RmlC-​like cupins Double-​stranded beta-​helix All β 2.57 -0.439 0.97 5.6 3.0 0.58
45 d1ahsa_ RDV p8,​ central (top) domain Viral protein domain Viral protein domain All β 2.564 0.524 0.01 3.8 2.8 0.46
46 d1szna1 Melibiase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.413 -1.105 0.02 3.7 2.4 0.43
47 d1dcsa_ Deacetoxycephalosporin C synthase Clavaminate synthase-​like Double-​stranded beta-​helix All β 2.38 0.713 0.03 3.5 2.9 0.54
48 d1gp6a_ Anthocyanidin synthase Clavaminate synthase-​like Double-​stranded beta-​helix All β 2.312 0.567 0.02 3.5 3.0 0.57
49 d1nofa1 Glycosyl hydrolase family 5 xylanase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.264 -1.756 0.01 4.0 2.5 0.43
50 d1g5aa1 Amylosucrase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.259 -1.559 0.00 3.6 3.3 0.39
51 d1su4a1 Calcium ATPase,​ transduction domain A Calcium ATPase,​ transduction domain A Double-​stranded beta-​helix All β 2.233 -1.145 0.02 2.3 2.1 0.42
52 d1u79a_ FKBP13 FKBP-​like FKBP-​like α+β 2.137 -1.447 0.01 2.6 2.2 0.41
53 d1uhva1 Beta-​D-​xylosidase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 2.090 -1.332 0.01 3.5 2.0 0.43
54 d1gh5a_ Antifungal protein AFP1 gamma-​Crystallin-​like gamma-​Crystallin-​like All β 2.021 -1.418 0.07 2.8 2.6 0.38
55 d1odma_ Isopenicillin N synthase Clavaminate synthase-​like Double-​stranded beta-​helix All β 2.02 0.754 0.01 3.5 2.9 0.31
56 d1nlqa_ Chromatin decondensation protein 1 (Crp1,​ Nlp) Nucleoplasmin-​like core domain Nucleoplasmin-​like/​VP (viral coat and capsid proteins) All β 1.95 0.812 0.01 3.6 2.2 0.38
57 d1szba1 Mannose-​binding protein associated serine protease 2,​ MASP2 Spermadhesin,​ CUB domain CUB-​like All β 1.76 0.927 0.01 1.9 2.5 0.40
58 d1ds1a_ Clavaminate synthase Clavaminate synthase-​like Double-​stranded beta-​helix All β 1.68 1.210 0.01 2.6 2.0 0.37
59 d1otja_ Taurine/​alpha-​ketoglutarate dioxygenase TauD Clavaminate synthase-​like Double-​stranded beta-​helix All β 1.59 0.777 0.01 2.5 2.1 0.36
60 d1nzia1 Complement C1S component Spermadhesin,​ CUB domain CUB-​like All β 1.57 1.044 0.01 2.4 2.4 0.36
61 d1k5ja_ Nucleoplasmin core Nucleoplasmin-​like core domain Nucleoplasmin-​like/​VP (viral coat and capsid proteins) All β 1.51 0.735 0.01 2.9 1.6 0.34
62 d1nx4a_ Carbapenem synthase,​ CarC Clavaminate synthase-​like Double-​stranded beta-​helix All β 1.50 0.677 0.01 2.3 2.0 0.36
63 d1sfpa_ Acidic seminal fluid protein (ASFP) Spermadhesin,​ CUB domain CUB-​like All β 1.36 0.609 0.02 1.6 2.4 0.38
64 d1pg6a_ Hypothetical protein SPyM3 0169 (SPyM18 0222,​ SPS0176) TRAP-​like Double-​stranded beta-​helix All β 1.14 1.183 0.01 1.2 0.9 0.33
SCOP domains with score worse than the threshold
65 d1m7xa2 1,​4-​alpha-​glucan branching enzyme Glycosyl hydrolase domain Glycosyl hydrolase domain All β 1.95 -1.634 0.05 2.5 2.1 0.40
66 d1gjwa1 Maltosyltransferase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 1.89 -1.748 0.02 3.1 2.4 0.36
67 d1f53a_ Killer toxin-​like protein SKLP gamma-​Crystallin-​like gamma-​Crystallin-​like All β 1.84 -1.353 0.01 2.4 2.3 0.38
68 d1ji2a2 Maltogenic amylase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 1.82 -2.026 0.01 3.1 2.5 0.37
69 d7taaa1 Fungal alpha-​amylase Glycosyl hydrolase domain Glycosyl hydrolase domain All β 1.79 -1.857 0.01 2.5 2.3 0.39
70 d1flca1 Hemagglutinin domain of haemagglutinin-​esterase-​fusion glycoprotein HEF1 Viral protein domain Viral protein domain All β 1.77 -1.808 0.01 2.1 1.3 0.42
71 d1k45a_ Carbohydrate binding module from a thermostable xylanase Galactose-​binding domain-​like Galactose-​binding domain-​like All β 1.76 -1.556 0.01 2.2 1.9 0.41
72 d1gwma_ Non-​catalytic protein 1,​ Ncp1 Galactose-​binding domain-​like Galactose-​binding domain-​like All β 1.75 -1.180 0.01 2.7 3.1 0.38
73 d1hn0a2 Chondroitin ABC lyase I,​ N-​terminal domain Galactose-​binding domain-​like Galactose-​binding domain-​like All β 1.73 -1.468 0.01 2.3 2.6 0.46
74 d1ig3a1 Thiamin pyrophosphokinase,​ substrate-​binding domain Thiamin pyrophosphokinase,​ substrate-​binding domain Double-​stranded beta-​helix All β 1.71 -1.785 0.01 2.0 2.2 0.37


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1vj2a_ Hypothetical protein TM1459 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.85  Contact: 939
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.34 LBcontacta:0.99 LBcontactb:0.98 LHM:0.21
id:1.00 blosum:0.94 compass:0.84 pearson:1.00
Scaled scores:
dali:0.83 daliz:0.63 gdtts:0.77 tmscore:0.81 rmsd:0.85 AHM:0.72 LBcontacta:0.74 LBcontactb:0.79 LHM:0.28
id:0.11 blosum:0.20 compass:0.28 pearson:0.32

hit structure      alignment
DALI alignment (Z-score: 11.8 Raw score:636.30)
Query          1 meinadftkPVVIDTDQLEWRPSP---MKGVERRMLDRIGgevaRATSIVRYAPGSRFSA     57
d1vj2a_        1 ---------MILKRAYDVTPQKIStdkVRGVRKRVLIGLKdapnFVMRLFTVEPGGLIDR     51

Query         58 HTHDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLWQF    111
d1vj2a_       52 HSHPWEHEIFVLKGKLTVLkeqgEETVEEGFYIFVEPNEIHGFRNDTdsEVEFLCLIPKE    111

Query        112 dpadrtqfsknm    123
d1vj2a_      112 ---------gge    114


hit structure      alignment
FAST alignment (Normalized score: 9.80 Raw score:1161.00)
Query          1 MEINADFTKPVVIDTDQLEWRPS----PMKGVERRMLDRIGGEVA-------RATSIVRY     49
d1vj2a_        1 ---------MILKRAYDVTPQK-ISTDKVRGVRKRVLI-------GLKDAPNFVMRLFTV     43

Query         50 APGSRFSAHTHDGGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGS--AEGC    102
d1vj2a_       44 EPGGLIDRHSHPWEHEIFVLKGKLTV-LKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEV    102

Query        103 TIFVKLWQFDPADRTQFSKNM-----    123
d1vj2a_      103 EFLCLIP--------------KEGGE    114


hit structure      alignment
TMalign alignment (TM-score: 0.68 Raw score:83.64)
Query          1 MEINADFTKPVVIDTDQLEWRPSP---MKGVERRMLDRIG----GEVARATSIVRYAPGS     53
d1vj2a_        1 ---------MILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPN----FVMRLFTVEPGG     47

Query         54 RFSAHTHDGGEEFIVLDGVFQD----EHGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVK    107
d1vj2a_       48 LIDRHSHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCL    107

Query        108 LWQF---DPADRTQFSKNM    123
d1vj2a_      108 IPKEGGE------------    114


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match                   *************    *******************************
Query         13 IDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTHDGGEEFIVLDGV     72
d1vj2a_        9 VTPQKISTDK--VRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRHSHPWEHEIFVLKGK     66

DALI match           ....**********************  ..******
Query         73 ----FQDEHGDYPAGTYVRNPPTTSHVPGS--AEGCTIFV    106
d1vj2a_       67 LTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLC    106



top
2: d1o4ta_ Hypothetical protein TM1287 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.79  Contact: 962
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.32 AHM:0.46 LBcontacta:0.99 LBcontactb:0.98 LHM:0.18
id:1.00 blosum:0.93 compass:0.64 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.60 gdtts:0.72 tmscore:0.78 rmsd:0.80 AHM:0.65 LBcontacta:0.73 LBcontactb:0.78 LHM:0.32
id:0.13 blosum:0.19 compass:0.25 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 11.6 Raw score:634.20)
Query          1 meinadftkpVVIDTDQLEWRPSPM-----KGVERRMLDRI--GGEVARATSIVRYAPGS     53
d1o4ta_        1 ----------MVVRSSEITPERISNmrggkGEVEMAHLLSKeaMHNKARLFARMKLPPGS     50

Query         54 RFSAHTHD-GGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFV    106
d1o4ta_       51 SVGLHKHEgEFEIYYILLGEGVFHdngkDVPIKAGDVCFTDSGESHSIENTGntDLEFLA    110

Query        107 KLWQFdpadrtqfsknm    123
d1o4ta_      111 VIILL------------    115


hit structure      alignment
FAST alignment (Normalized score: 8.79 Raw score:1045.00)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM-------KGVERRMLDRIGGEV--------ARATS     45
d1o4ta_        1 ----------MVVRSSEITPERI--SNMRGGKGEVEMAHLL------SKEAMHNKARLFA     42

Query         46 IVRYAPGSRFSAHTHD-GGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGS-     98
d1o4ta_       43 RMKLPPGSSVGLHKHEGEFEIYYILLGEGVF-HDNGKDVPIKAGDVCFTDSGESHSIENT    101

Query         99 -AEGCTIFVKLWQFDPADRTQFSKNM----    123
d1o4ta_      102 GNTDLEFLAV----------------IILL    115


hit structure      alignment
TMalign alignment (TM-score: 0.68 Raw score:84.23)
Query          1 MEINADFTKPVVIDTDQLEWRPSP-M----KGVERRMLDRIG-----GEVARATSIVRYA     50
d1o4ta_        1 ----------MVVRSSEITPERISNMRGGKGEVEMAHLLSKEAMHNK---ARLFARMKLP     47

Query         51 PGSRFSAHTHD-GGEEFIVLDGVFQ-D---EHGDYPAGTYVRNPPTTSHVPGSAE--GCT    103
d1o4ta_       48 PGSSVGLHKHEGEFEIYYILLGEGVFHDNGKDVPIKAGDVCFTDSGESHSIENTGNTDLE    107

Query        104 IFVKLWQFDPADRTQFSKNM    123
d1o4ta_      108 FLAVI-IL-L----------    115


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match                    ***********..........  ***************.. ******
Query         13 IDTDQLEWRPSPMKGVERRMLDRIGGEVARATSI--VRYAPGSRFSAHTHDGG-EEFIVL     69
d1o4ta_        8 ITPERISNMRGGKGEVEMAHLLSKEAMHNKARLFARMKLPPGSSVGLHKHEGEFEIYYIL     67

DALI match       ***    ....*********************  ...******
Query         70 DGV----FQDEHGDYPAGTYVRNPPTTSHVPG--SAEGCTIFV    106
d1o4ta_       68 LGEGVFHDNGKDVPIKAGDVCFTDSGESHSIENTGNTDLEFLA    110



top
3: d1lrha_ Auxin binding protein (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.78  Contact: 915
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.44 LBcontacta:0.99 LBcontactb:0.98 LHM:0.22
id:1.00 blosum:0.97 compass:0.73 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.63 gdtts:0.69 tmscore:0.75 rmsd:0.82 AHM:0.63 LBcontacta:0.75 LBcontactb:0.81 LHM:0.36
id:0.14 blosum:0.21 compass:0.17 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 9.7 Raw score:629.00)
Query          1 meinadftKPVVIDTDQLEWRPSPMKGVERRMLDRIG--gevARATSIVRYAPGSRFSAH     58
d1lrha_        1 ---scvrdNSLVRDISQMPQSSYGIEGLSHITVAGALnhgmkEVEVWLQTISPGQRTPIH     57

Query         59 THDGGEEFIVLDGVFQDE-------------HGDYPAGTYVRNPPTTSHVPGSAE---GC    102
d1lrha_       58 RHSCEEVFTVLKGKGTLLmgssslkypgqpqEIPFFQNTTFSIPVNDPHQVWNSDeheDL    117

Query        103 TIFVKLWQ----------------------fdpadrtqfsknm    123
d1lrha_      118 QVLVIISRppakiflyddwsmphtaavlkfpfvwdedcfeaak    160


hit structure      alignment
FAST alignment (Normalized score: 7.67 Raw score:1076.00)
Query          1 MEINADFTKP-------VVIDTDQLEWRPSPMKGVERRMLDRIGGEVA--------RATS     45
d1lrha_        1 ----------SCVRDNSLVRDISQMPQSSYGIEGLSHITVAG------ALNHGMKEVEVW     44

Query         46 IVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE--------------HGDYPAGTYVRNPPT     91
d1lrha_       45 LQTISPGQRTPIHRHSCEEVFTVLKGKGTL-LMGSSSLKYPGQPQEIPFFQNTTFSIPVN    103

Query         92 TSHVPGSA----EGCTIFVKLWQFDPADRTQFSKNM------------------------    123
d1lrha_      104 DPHQVWN-SDEHEDLQVLVI----------------ISRPPAKIFLYDDWSMPHTAAVLK    146

Query        124 --------------    124
d1lrha_      147 FPFVWDEDCFEAAK    160


hit structure      alignment
TMalign alignment (TM-score: 0.67 Raw score:82.39)
Query          1 -MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGG---EVA-RATSIVRYAPGSRF     55
d1lrha_        1 SCVRD-N--S-LVRDISQMPQSSYGIEGLSHITVAGALNHGM--KEVEVWLQTISPGQRT     54

Query         56 SAHTHDGGEEFIVLDGVFQDE-------------HGDYPAGTYVRNPPTTSHVPGSAE--    100
d1lrha_       55 PIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEH    114

Query        101 -GCTIFVKLWQF----------------------------------DPADRTQFSKNM    123
d1lrha_      115 EDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAK------------    160


hit structure      alignment
HHsearch alignment (Probability: 0.97 E-value:0.00)
DALI match       ************************  ....   ***************************
Query         10 PVVIDTDQLEWRPSPMKGVERRML--DRIGGEVARATSIVRYAPGSRFSAHTHDGGEEFI     67
d1lrha_        7 SLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFT     66

DALI match       *********                *****************  ... .******
Query         68 VLDGVFQDEHGD-------------YPAGTYVRNPPTTSHVP--GSA-EGCTIFV    106
d1lrha_       67 VLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLV    121



top
4: d1sfna_ Hypothetical protein DR1152 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.81  Contact: 1059
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.37 LBcontacta:0.99 LBcontactb:0.99 LHM:0.16
id:0.99 blosum:0.19 compass:0.60 pearson:1.00
Scaled scores:
dali:0.83 daliz:0.61 gdtts:0.72 tmscore:0.79 rmsd:0.86 AHM:0.74 LBcontacta:0.68 LBcontactb:0.78 LHM:0.42
id:0.07 blosum:0.07 compass:0.26 pearson:0.26

hit structure      alignment
DALI alignment (Z-score: 10.4 Raw score:726.80)
Query          1 -----meinadfTKPVVIDTDQLEWRPSP-MKGVERRMLDRIG--gevARATSIVRYAPG     52
d1sfna_        1 mkhlgqtrsalhGSHAVITPETFVRTALAeWPGSAIVLHIAPVvglgaRFVQFTAEMPAG     60

Query         53 SRfsaHTHDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKL    108
d1sfna_       61 AQ--aTESVYQRFAFVLSGEVDVAvggeTRTLREYDYVYLPAGEKHMLTAKTDARVSVFE    118

Query        109 WqFDPA-----DRTQFSKNM----------------------------------------    123
d1sfna_      119 K-PYQTvegvqAPGVYWGNErenpgypfegddhliarkllpdepafdfmvstmsfapgas    177

Query        124 ------------------------------------------------------------    124
d1sfna_      178 lpyaevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskylly    237

Query        124 --------    124
d1sfna_      238 kdmnrhpl    245


hit structure      alignment
FAST alignment (Normalized score: 7.10 Raw score:1232.00)
Query          1 MEINADF------------TKPVVIDTDQLEWRPS-PMKGVERRMLDRIGGEVA------     41
d1sfna_        1 -------MKHLGQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHI-------APVVGL     46

Query         42 ---RATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTS     93
d1sfna_       47 GARFVQFTAEMPAGAQATE--SVYQRFAFVLSGEVDV-AVGGETRTLREYDYVYLPAGEK    103

Query         94 HVPGSAEGCTIFVKLWQFDP----------ADRTQFSKNM--------------------    123
d1sfna_      104 HMLTAKTDARVSVF------EKPYQTVEGVQAPGVYWG--NERENPGYPFEGDDHLIARK    155

Query        124 ------------------------------------------------------------    124
d1sfna_      156 LLPDEPAFDFMVSTMSFAPGASLPYAEVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIW    215

Query        124 ------------------------------    124
d1sfna_      216 MGAHCPQWYGALGRNWSKYLLYKDMNRHPL    245


hit structure      alignment
TMalign alignment (TM-score: 0.75 Raw score:91.78)
Query          1 ----------MEINADFTKPVVIDTDQ-LEWRPSP-MKGVERRMLDRIG-----GEVARA     43
d1sfna_        1 MKHLGQTRSA-----LHGSHAVIT-PETFVRTALAEWPGSAIVLHIAPVVGLGA---RFV     51

Query         44 TSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSA     99
d1sfna_       52 QFTAEMPAGAQA-TE-SVYQRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAK    109

Query        100 EGCTIFVKLWQFDP----ADRTQFSKNM--------------------------------    123
d1sfna_      110 TDARVSVFEKPYQTVEGVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVST    169

Query        124 ------------------------------------------------------------    124
d1sfna_      170 MSFAPGASLPYAEVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIWMGAHCPQWYGALGR    229

Query        124 ----------------    124
d1sfna_      230 NWSKYLLYKDMNRHPL    245


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       **************. ***********  .   ************** . ....  ****
Query         11 VVIDTDQLEWRPSPM-KGVERRMLDRI--GGEVARATSIVRYAPGSRFSAHTHDGGEEFI     67
d1sfna_       16 AVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPAGAQATESVYQ--RFAF     73

DALI match       *******    ..*********************************......
Query         68 VLDGVFQ----DEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPAD    115
d1sfna_       74 VLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPYQTVE    125



top
5: d1sefa_ Hypothetical protein EF2996 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.76  Contact: 1098
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.28 AHM:0.33 LBcontacta:0.99 LBcontactb:0.99 LHM:0.12
id:1.00 blosum:0.80 compass:0.54 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.56 gdtts:0.62 tmscore:0.73 rmsd:0.84 AHM:0.77 LBcontacta:0.67 LBcontactb:0.77 LHM:0.50
id:0.09 blosum:0.16 compass:0.25 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 10.0 Raw score:711.50)
Query          1 -----meinaDFTKPVVIDTDQLEWRPSP-MKGVERRMLDRIGgevARATSIVRYAPGSR     54
d1sefa_        1 kelltsraviKKDNYAIIPHDGLVQNAVPgFENVDISILGSPKlgaTFVDYIATFHKNGQ     60

Query         55 -FSAHTH-DGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFV    106
d1sefa_       61 qTTGFGGdGIQTLVYVIDGRLRVSdgqeTHELEAGGYAYFTPEMKMYLANAQeaDTEVFL    120

Query        107 KLWqFDPA----dRTQFSKNM---------------------------------------    123
d1sefa_      121 YKK-RYQPlaghqPYKVVGSIhdqqpeeyegmtdvllwsllpkefdfdmnmhilsfepga    179

Query        124 ------------------------------------------------------------    124
d1sefa_      180 shayiethvqehgaylisgqgmynldnewypvekgdyifmsayvpqaayavgreeplmyv    239

Query        124 -----------    124
d1sefa_      240 yskdanrepel    250


hit structure      alignment
FAST alignment (Normalized score: 6.14 Raw score:1077.00)
Query          1 MEINADF------------TKPVVIDTDQLEWRPS-PMKGVERRMLDRIGGEVA------     41
d1sefa_        1 -------KELLTSRAVIKKDNYAIIPHDGLVQNAVPGFENVDISILG-------SPKLGA     46

Query         42 -RATSIVRYAPGSRFSAHTHD---------GGEEFIVLDGVFQDE------HGDYPAGTY     85
d1sefa_       47 TFVDYIATFHKNGQ-------QTTGFGGDGIQTLVYVIDGRLR--VSDGQETHELEAGGY     97

Query         86 VRNPPTTSHVPG--SAEGCTIFVKLWQFDPAD-----------RTQFSKNM---------    123
d1sefa_       98 AYFTPEMKMYLANAQEADTEVFLY--------KKRYQPLAGHQPYKVVG--SIHDQQPEE    147

Query        124 ------------------------------------------------------------    124
d1sefa_      148 YEGMTDVLLWSLLPKEFDFDMNMHILSFEPGASHAYIETHVQEHGAYLISGQGMYNLDNE    207

Query        124 -------------------------------------------    124
d1sefa_      208 WYPVEKGDYIFMSAYVPQAAYAVGREEPLMYVYSKDANREPEL    250


hit structure      alignment
TMalign alignment (TM-score: 0.74 Raw score:90.69)
Query          1 ---------MEINADFTKPVVIDTDQLEWRPS-P-MKGVERRMLDRIG---GEVARATSI     46
d1sefa_        1 KELLTSRAV---IKKD-NYAIIP-HDGLVQNAVPGFENVDISILGSPKLGA---TFVDYI     52

Query         47 VRYAPGSRFSAHTHD--GGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGSAE    100
d1sefa_       53 ATFHKNGQQTTGFGGDGIQTLVYVIDGRLRVSDGQETHELEAGGYAYFTPEMKMYLANAQ    112

Query        101 --GCTIFVKLWQFDPA----DRTQFSKNM-------------------------------    123
d1sefa_      113 EADTEVFLYK-KRYQPLAGHQPYKVVGSIHDQQPEEYEGMTDVLLWSLLPKEFDFDMNMH    171

Query        124 ------------------------------------------------------------    124
d1sefa_      172 ILSFEPGASHAYIETHVQEHGAYLISGQGMYNLDNEWYPVEKGDYIFMSAYVPQAAYAVG    231

Query        124 -------------------    124
d1sefa_      232 REEPLMYVYSKDANREPEL    250


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       **************. ************   **************.  .....*******
Query         11 VVIDTDQLEWRPSPM-KGVERRMLDRIGGEVARATSIVRYAPGSRF--SAHTHDGGEEFI     67
d1sefa_       16 AIIPHDGLVQNAVPGFENVDISILGSPKLGATFVDYIATFHKNGQQTTGFGGDGIQTLVY     75

DALI match       *******    ..********************  ....*********..... 
Query         68 VLDGVFQ----DEHGDYPAGTYVRNPPTTSHVP--GSAEGCTIFVKLWQFDPAD    115
d1sefa_       76 VIDGRLRVSDGQETHELEAGGYAYFTPEMKMYLANAQEADTEVFLYKKRYQPLA    129



hit structures. 
top
6: d1dgw.1 Seed storage 7S protein (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.64  Contact: 901
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.39 AHM:0.59 LBcontacta:0.99 LBcontactb:0.98 LHM:0.23
id:0.96 blosum:0.27 compass:0.27 pearson:0.99
Scaled scores:
dali:0.78 daliz:0.53 gdtts:0.58 tmscore:0.63 rmsd:0.73 AHM:0.51 LBcontacta:0.70 LBcontactb:0.78 LHM:0.29
id:0.04 blosum:0.08 compass:0.17 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 8.0 Raw score:547.40)
Query          1 meinadftKPVVIdTDQLEWRPSpMKGVERRMLDR-----IGGEvARATSIVRYAPGSRF     55
d1dgw.1        1 --------DKPFN-LRSRDPIYS-NNYGKLYEITPeknsqLRDL-DILLNCLQMNEGALF     49

Query         56 SAHTHD-GGEEFIVLDGVFQDE----------HGDYPAGTYVRNPPTTSHVPGSAEGCTI    104
d1dgw.1       50 VPHYNSrATVILVANEGRAEVElvgleqlrryAATLSEGDIIVIPSSFPVALKAASDLNM    109

Query        105 FVKLWQ----------------------------------------fdpadrtqfsknm    123
d1dgw.1      110 VGIGVNaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp    168


hit structure      alignment
FAST alignment (Normalized score: 6.32 Raw score:908.40)
Query          1 MEINADFTKPVVIDTDQLEWRPS--PMKGVERRMLDRIGGEVA-------------RATS     45
d1dgw.1        1 ---------DKPFNLRSRDP---IYSNNYGKLYE---------ITPEKNSQLRDLDILLN     39

Query         46 IVRYAPGSRFSAHTHD-GGEEFIVLDGVFQDE-----------HGDYPAGTYVRNPPTTS     93
d1dgw.1       40 CLQMNEGALFVPHYNSRATVILVANEGRAEV-ELVGLEQLRRYAATLSEGDIIVIPSSFP     98

Query         94 HVPGSAEGCTIFVKLWQFDPADRTQFSKNM------------------------------    123
d1dgw.1       99 VALKAASDLNMVGI----------------GVNAENNERNFLAGHKENVIRQIPRQVSDL    142

Query        124 --------------------------    124
d1dgw.1      143 TFPGSGEEVEELLENQKESYFVDGQP    168


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:74.36)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK-GVERRMLDRIGG--------EVARATSIVRYAP     51
d1dgw.1        1 --------DKPFN-L--RSRDPIYSNNYGKLYE-ITPEKNSQLRDLD---ILLNCLQMNE     45

Query         52 GSRFSAHTHD-GGEEFIVLDGVFQDE----------HGDYPAGTYVRNPPTTSHVPGSAE    100
d1dgw.1       46 GALFVPHYNSRATVILVANEGRAEVELVGLEQLRRYAATLSEGDIIVIPSSFPVALKAAS    105

Query        101 GCTIFVKLWQFDP-----------------------------------------------    113
d1dgw.1      106 DLNMVGIG-VNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFV    164

Query        114 ----ADRTQFSKNM    123
d1dgw.1      165 DGQP----------    168


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match       ******************** .***********    ....        ***********
Query         41 ARATSIVRYAPGSRFSAHTH-DGGEEFIVLDGV----FQDEHG------DYPAGTYVRNP     89
d1dgw.1       35 DILLNCLQMNEGALFVPHYNSRATVILVANEGRAEVELVGLEQLRRYAATLSEGDIIVIP     94

DALI match       *****************
Query         90 PTTSHVPGSAEGCTIFV    106
d1dgw.1       95 SSFPVALKAASDLNMVG    111



top
7: d1fi2a_ Germin (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.63  Contact: 898
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.45 AHM:0.52 LBcontacta:0.99 LBcontactb:0.98 LHM:0.18
id:1.00 blosum:0.81 compass:0.61 pearson:1.00
Scaled scores:
dali:0.77 daliz:0.49 gdtts:0.56 tmscore:0.62 rmsd:0.68 AHM:0.55 LBcontacta:0.65 LBcontactb:0.77 LHM:0.30
id:0.12 blosum:0.15 compass:0.25 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 7.4 Raw score:522.50)
Query          1 -----meinaDFTK---------------------PVVIDTdqLEWRP-sPMKGVERRML     33
d1fi2a_        1 tdpdplqdfcVADLdgkavsvnghtckpmseagddFLFSSK-lTKAGNtsTPNGSAVTEL     59

Query         34 DR-----IGGEvARATSIVRYAPGSRfSAHTHD-GGEEFIVLDGVFQDE-----------     76
d1fi2a_       60 DVaewpgTNTL-GVSMNRVDFAPGGTnPPHIHPrATEIGMVMKGELLVGilgsldsgnkl    118

Query         77 -HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLWQ-----------------------    110
d1fi2a_      119 ySRVVRAGETFVIPRGLMHFQFNVGktEAYMVVSFNSqnpgivfvpltlfgsdppiptpv    178

Query        111 ----------fdpadrtqfsknm    123
d1fi2a_      179 ltkalrveagvvellkskfaggs    201


hit structure      alignment
FAST alignment (Normalized score: 5.45 Raw score:856.40)
Query          1 MEINADFTK-----------------------------------PVVIDTDQ---LEWRP     22
d1fi2a_        1 ---------TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFS----SKLTKAG-     46

Query         23 SPM-----KGVERRMLDRIGGEVA-------------RATSIVRYAPGSRFSAHTHD-GG     63
d1fi2a_       47 ---NTSTPNGSAVTE---------LDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRAT     94

Query         64 EEFIVLDGVFQDE-------------HGDYPAGTYVRNPPTTSHVPGS--AEGCTIFVKL    108
d1fi2a_       95 EIGMVMKGELLV-GILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSF    153

Query        109 WQFDPADRTQFSKNM---------------------------------------------    123
d1fi2a_      154 ---------------NSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFA    198

Query        124 ---    124
d1fi2a_      199 GGS    201


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:73.66)
Query          1 ---------MEINADF-------------------T---KPVVIDTDQLEWRPSPMKGVE     29
d1fi2a_        1 TDPDPLQDF----CVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLT-KAGNTSTPNGSA     55

Query         30 RRMLDRIG---------GEVARATSIVRYAPGSRFSAHTHD-GGEEFIVLDGVFQDE---     76
d1fi2a_       56 VTE-LDVAEWPGTNTLG----VSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILG    110

Query         77 ---------HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLWQF--------------    111
d1fi2a_      111 SLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSF-NSQNPGIVFVPLTLFG    169

Query        112 --------------------------------DPADRTQFSKNM    123
d1fi2a_      170 SDPPIPTPVLTKALRVEAGVVELLKSKFAGGS------------    201


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match       ************** ****** *************                *********
Query         41 ARATSIVRYAPGSRFSAHTHD-GGEEFIVLDGVFQ-------DEHG-----DYPAGTYVR     87
d1fi2a_       71 GVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFV    130

DALI match       ***********  ..**********      
Query         88 NPPTTSHVPGS--AEGCTIFVKLWQFDPADR    116
d1fi2a_      131 IPRGLMHFQFNVGKTEAYMVVSFNSQNPGIV    161



top
8: d1od5a2 Seed storage 7S protein (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.65  Contact: 917
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.39 AHM:0.53 LBcontacta:0.99 LBcontactb:0.98 LHM:0.18
id:0.99 blosum:0.56 compass:0.34 pearson:0.99
Scaled scores:
dali:0.77 daliz:0.51 gdtts:0.59 tmscore:0.65 rmsd:0.72 AHM:0.56 LBcontacta:0.69 LBcontactb:0.79 LHM:0.36
id:0.08 blosum:0.12 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 7.7 Raw score:538.30)
Query          1 meinadfTKPVVIDT-DQLEWRPSPMKGVERRMLDR-----IGGEvARATSIVRYAPGSR     54
d1od5a2        1 gveenicTMKLHENIaRPSRADFYNPKAGRISTLNSltlpaLRQF-GLSAQYVVLYRNGI     59

Query         55 FSAHTHD-GGEEFIVLDGVFQDE----------HGDYPAGTYVRNPPTTSHVPGSA-EGC    102
d1od5a2       60 YSPHWNLnANSVIYVTRGKGRVRvvncqgnavfDGELRRGQLLVVPQNFVVAEQGGeQGL    119

Query        103 TIFVKLWQ---------------------------------fdpadrtqfsknm    123
d1od5a2      120 EYVVFKTHhnavssyikdvfraipsevlsnsynlgqsqvrqlkyqgnsgplvnp    173


hit structure      alignment
FAST alignment (Normalized score: 5.80 Raw score:845.70)
Query          1 MEINADF-------TKPVVIDTDQLEWRPSPMK-----------GVERRMLDRIGGEVA-     41
d1od5a2        1 -------GVEENICTMKLHENIA----------RPSRADFYNPKAGRIST---------L     34

Query         42 ------------RATSIVRYAPGSRFSAHTHD-GGEEFIVLDGVFQDE-----------H     77
d1od5a2       35 NSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRV-RVVNCQGNAVFD     93

Query         78 GDYPAGTYVRNPPTTSHVPG-SAEGCTIFVKLWQFDPADRTQFSKNM-------------    123
d1od5a2       94 GELRRGQLLVVPQNFVVAEQGGEQGLEYVVFK---------------THHNAVSSYIKDV    138

Query        124 -----------------------------------    124
d1od5a2      139 FRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP    173


hit structure      alignment
TMalign alignment (TM-score: 0.61 Raw score:74.77)
Query          1 -----MEINAD-FTKPVVIDTDQLEWRPSPMK--GVERRMLDRIG---------GEVARA     43
d1od5a2        1 GVEEN-----IC-TMKLHENIARPSRADFY-NPKAGRIST-LNSLTLPALRQFG----LS     48

Query         44 TSIVRYAPGSRFSAHTHD-GGEEFIVLDGVFQDE----------HGDYPAGTYVRNPPTT     92
d1od5a2       49 AQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNF    108

Query         93 SHVPGSAE-GCTIFVKLWQF----------------------------------------    111
d1od5a2      109 VVAEQGGEQGLEYVVFK-THHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNS    167

Query        112 ------DPADRTQFSKNM    123
d1od5a2      168 GPLVNP------------    173


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match       ********************* **********    .....         **********
Query         41 ARATSIVRYAPGSRFSAHTHD-GGEEFIVLDG----VFQDEHGD------YPAGTYVRNP     89
d1od5a2       46 GLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVP    105

DALI match       **********...........         
Query         90 PTTSHVPGSAEGCTIFVKLWQFDPADRTQF    119
d1od5a2      106 QNFVVAEQGGEQGLEYVVFKTHHNAVSSYI    135



top
9: d1dgwa_ Seed storage 7S protein (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.72  Contact: 894
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.37 AHM:0.51 LBcontacta:0.99 LBcontactb:0.98 LHM:0.23
id:0.99 blosum:0.44 compass:0.43 pearson:0.99
Scaled scores:
dali:0.79 daliz:0.54 gdtts:0.60 tmscore:0.67 rmsd:0.76 AHM:0.63 LBcontacta:0.68 LBcontactb:0.78 LHM:0.33
id:0.08 blosum:0.12 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 8.6 Raw score:536.90)
Query          1 meinadfTKPVVIDTDQLEWRPSPmKGVERRMLDRI-------ggevARATSIVRYAPGS     53
d1dgwa_        1 -------NNPYLFRSNKFLTLFKN-QHGSLRLLQRFnedteklenlrDYRVLEYCSKPNT     52

Query         54 RFSAHTHDGGEEFIVLDGVFQDE--------HGDYPAGTYVRNPPTTSHVPGSAE---GC    102
d1dgwa_       53 LLLPHHSDSDLLVLVLEGQAILVlvnpdgrdTYKLDQGDAIKIQAGTPFYLINPDnnqNL    112

Query        103 TIFVKLwQFDP----------------------------------------------adr    116
d1dgwa_      113 RILKFA-ITFRrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqe    171

Query        117 tqfsknm    123
d1dgwa_      172 gvivkmp    178


hit structure      alignment
FAST alignment (Normalized score: 5.55 Raw score:820.80)
Query          1 MEINADFTK--PVVIDT-DQLEWRPSP---MKGVERRMLDRIGGEV--------------     40
d1dgwa_        1 ---------NNPYLFR-SNKFLT----LFKNQHGSLRLL-------QRFNEDTEKLENLR     39

Query         41 ARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE---------HGDYPAGTYVRNPPT     91
d1dgwa_       40 DYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAIL-VLVNPDGRDTYKLDQGDAIKIQAG     98

Query         92 TSHVPGS---AEGCTIFVKLWQFDPADRTQFSKNM-------------------------    123
d1dgwa_       99 TPFYLINPDNNQNLRILKF----------------AITFRRPGTVEDFFLSSTKRLPSYL    142

Query        124 ------------------------------------    124
d1dgwa_      143 SAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMP    178


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:74.01)
Query          1 -MEINADFTKPVVIDTDQLEWRPSPMK-GVERRMLDRI-----------GGEVARATSIV     47
d1dgwa_        1 N--------NPYLFRS--NKFLTLFKNQHGSLRLLQRFNEDTEKLENLR----DYRVLEY     46

Query         48 RYAPGSRFSAHTHDGGEEFIVLDGVFQDE--------HGDYPAGTYVRNPPTTSHVPGSA     99
d1dgwa_       47 CSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINP    106

Query        100 E---GCTIFVKLWQFDP-------------------------------------------    113
d1dgwa_      107 DNNQNLRILKFA-ITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTL    165

Query        114 -------------ADRTQFSKNM    123
d1dgwa_      166 LQEEQEGVIVKMP----------    178


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match       ********           ************************************     
Query         29 ERRMLDRIGGE-------VARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDEH----     77
d1dgwa_       21 SLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPD     80

DALI match           ***********************.  ....... ****    
Query         78 ----GDYPAGTYVRNPPTTSHVPGSAEG--CTIFVKLWQFDPADRT    117
d1dgwa_       81 GRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGT    126



top
10: d1qxra_ Glucose-​6-​phosphate isomerase,​ GPI (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.70  Contact: 882
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.38 AHM:0.45 LBcontacta:0.98 LBcontactb:0.98 LHM:0.18
id:1.00 blosum:0.74 compass:0.31 pearson:0.95
Scaled scores:
dali:0.78 daliz:0.52 gdtts:0.59 tmscore:0.67 rmsd:0.74 AHM:0.63 LBcontacta:0.65 LBcontactb:0.76 LHM:0.40
id:0.11 blosum:0.15 compass:0.12 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 7.5 Raw score:564.50)
Query          1 meinadfTKPVVID-------TDQLEWRPSP----------------------mKGVERR     31
d1qxra_        1 -----myKEPFGVKvdfetgiIEGAKKSVRRlsdmegyfvderawkelvekedpVVYEVY     55

Query         32 MLDRIGGEVARATSIVRYAP------GSRFSAHTH---DGGEEFIVLDGVFQDE------     76
d1qxra_       56 AVEQEEKEGDLNFATTVLYPgkvgkeFFFTKGHFHaklDRAEVYVALKGKGGMLlqtpeg    115

Query         77 ---HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLW--------------------qf    111
d1qxra_      116 dakWISMEPGTVVYVPPYWAHRTVNIGdePFIFLAIYPadaghdygtiaekgfskiviee    175

Query        112 dpadrtqfsknm    123
d1qxra_      176 ngevkvvdnprw    187


hit structure      alignment
FAST alignment (Normalized score: 5.51 Raw score:836.20)
Query          1 MEINADF--TKPVVIDT--------DQLEWRPSPM-------------------------     25
d1qxra_        1 -------MYKEPFGVK-VDFETGIIEGAKKSV---RRLSDMEGYFVDERAWKELVEKEDP     49

Query         26 KGVERRMLDRIGGEVA---------RATSIVRYAPG--------SRFSAHTH---DGGEE     65
d1qxra_       50 VVYEVYA---------VEQEEKEGDLNFATTVLY--PGKVGKEFFFTKGHFHAKLDRAEV     98

Query         66 FIVLDGVFQDE----------HGDYPAGTYVRNPPTTSHVPGS--AEGCTIFVKLWQFDP    113
d1qxra_       99 YVALKGKGGM-LLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYP----    153

Query        114 ADRTQFSKNM----------------------------------    123
d1qxra_      154 ----------ADAGHDYGTIAEKGFSKIVIEENGEVKVVDNPRW    187


hit structure      alignment
TMalign alignment (TM-score: 0.63 Raw score:77.90)
Query          1 MEINADFTKPVVIDTD-----QL-EWRPSPMK-----------------------GVERR     31
d1qxra_        1 -----MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVY     55

Query         32 MLDRIGG--EVARATSIVRYAPG------SRFSAHTH--D-GGEEFIVLDGVFQDE----     76
d1qxra_       56 AVEQEEKEG--DLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTP    113

Query         77 -----HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLWQFD-----------------    112
d1qxra_      114 EGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDYGTIAEKGFSKIVI    173

Query        113 --------------PADRTQFSKNM    123
d1qxra_      174 EENGEVKVVDNPRW-----------    187


hit structure      alignment
HHsearch alignment (Probability: 0.95 E-value:0.00)
DALI match       ***********************        *******   ************  .... 
Query         29 ERRMLDRIGGEVARATSIVRYAPGS------RFSAHTH---DGGEEFIVLDGV--FQDEH     77
d1qxra_       53 EVYAVEQEEKEGDLNFATTVLYPGKVGKEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQT    112

DALI match                ******************  ...******
Query         78 GD-------YPAGTYVRNPPTTSHVPG--SAEGCTIFV    106
d1qxra_      113 PEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLA    150



hit structures. 
top
11: d1sq4a_ Glyoxylate-​induced protein PA1140 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.64  Contact: 1074
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.41 LBcontacta:0.99 LBcontactb:0.99 LHM:0.17
id:1.00 blosum:0.61 compass:0.56 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.59 gdtts:0.67 tmscore:0.77 rmsd:0.84 AHM:0.73 LBcontacta:0.62 LBcontactb:0.76 LHM:0.42
id:0.09 blosum:0.13 compass:0.24 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 10.1 Raw score:710.40)
Query          1 ----------------meinadfTKPVVID-TDQL-EWRPSP-MKGVERRMLDR--igGE     39
d1sq4a_        1 kssyyaphgghpalltdramfteAYAVIPKgVMRDiVTSHLPfWDNMRMWVIARplsgFA     60

Query         40 VARATSIVRYAPGSRFSAHT--hDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTS     93
d1sq4a_       61 ETFSQYIVELAPNGGSDKPEqdpNAEAVLFVVEGELSLTlqgqVHAMQPGGYAFIPPGAD    120

Query         94 HVPGSAE--GCTIFVKLWqFDPA-----DRTQFSKNM-----------------------    123
d1sq4a_      121 YKVRNTTgqHTRFHWIRK-HYQKvdgvpLPEAFVTNEqdiqplvmpdtegrwsttrfvdm    179

Query        124 ------------------------------------------------------------    124
d1sq4a_      180 sdmrhdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfmwlra    239

Query        124 -------------------------------    124
d1sq4a_      240 fcpqacysggpgrfryllykdvnrhmrltln    270


hit structure      alignment
FAST alignment (Normalized score: 6.03 Raw score:1099.00)
Query          1 MEINAD---------------------FTKPVVIDTDQL-------EWRPS-PMKGVERR     31
d1sq4a_        1 ------KSSYYAPHGGHPALLTDRAMFTEAYAVIP----KGVMRDIVTSHLPFWDNMRMW     50

Query         32 MLDRIGGEVA-----------RATSIVRYAPGSRFSAHTHD------GGEEFIVLDGVFQ     74
d1sq4a_       51 V---------IARPLSGFAETFSQYIVELAPNGGSDK----PEQDPNAEAVLFVVEGELS     97

Query         75 DE-----HGDYPAGTYVRNPPTTSHVPGS--AEGCTIFVKLWQFDPA-----------DR    116
d1sq4a_       98 L-TLQGQVHAMQPGGYAFIPPGADYKVRNTTGQHTRFHWI-------RKHYQKVDGVPLP    149

Query        117 TQFSKNM-----------------------------------------------------    123
d1sq4a_      150 EAFVT--NEQDIQPLVMPDTEGRWSTTRFVDMSDMRHDMHVNIVNFEPGGVIPFAETHVM    207

Query        124 ------------------------------------------------------------    124
d1sq4a_      208 EHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMRL    267

Query        124 ---    124
d1sq4a_      268 TLN    270


hit structure      alignment
TMalign alignment (TM-score: 0.67 Raw score:81.85)
Query          1 ------------------------------------------------------------      1
d1sq4a_        1 KSSYYAPHGGHPALLTDRAMFTEAYAVIPKGVMRDIVTSHLPFWDNMRMWVIARPLSGFA     60

Query          1 -----------------------------------------------------MEIN---      4
d1sq4a_       61 ETFSQYIVELAPNGGSDKPEQDPNAEAVLFVVEGELSLTLQGQVHAMQPGGYA---FIPP    117

Query          5 ----------------------------ADFTKPVVIDTDQLEWRPSPMK--GVERRMLD     34
d1sq4a_      118 GADYKVRNTTGQHTRFHWIRKHYQKVDGVPLPEAFVTNEQDIQPLVMPDTEGRWSTTRFV    177

Query         35 RIGG---EVARATSIVRYAPGSRFSAHT-HDGGEEFIVLDGVFQDE----HGDYPAGTYV     86
d1sq4a_      178 DMSDMRH--DMHVNIVNFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFM    235

Query         87 RNPPTTSHVPGSAE--GCTIFVKLWQF--DPA----DRTQFSKNM    123
d1sq4a_      236 WLRAFCPQACYSGGPGRFRYLLYK-DVNRHMRLTLN---------    270


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match                                                                   
Query          9 KPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARA---TSIVRYAPGSRFS-AHTHDGGE     64
d1sq4a_      150 EAFVTNEQDIQPLVMPDTEGRWSTTRFVDMSDMRHDMHVNIVNFEPGGVIPFAETHVMEH    209

DALI match                                          
Query         65 EFIVLDGVFQDEHGDY----PAGTYVRNPPTTSHV     95
d1sq4a_      210 GLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQA    244



top
12: d1od5a1 Seed storage 7S protein (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.72  Contact: 902
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.36 AHM:0.54 LBcontacta:0.99 LBcontactb:0.98 LHM:0.20
id:0.96 blosum:0.16 compass:0.40 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.55 gdtts:0.64 tmscore:0.70 rmsd:0.77 AHM:0.57 LBcontacta:0.68 LBcontactb:0.78 LHM:0.32
id:0.04 blosum:0.07 compass:0.20 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 7.3 Raw score:556.70)
Query          1 meinadfTKPVVIDTdqLEWRPspMKGVERRMLDR----IGGEvARATSIVRYAPGSRFS     56
d1od5a1        1 --necqlNNLNALEP--DHRVE--SEGGLIETWNSqhpeLQCA-GVTVSKRTLNRNGLHL     53

Query         57 AHTHDGGEEFIVLDGVFQDE-------------------HGDYPAGTYVRNPPTTSHVPG     97
d1od5a1       54 PSYSPYPQMIIVVQGKGAIGfafpgcpetfekpqdshqkIRHFNEGDVLVIPPGVPYWTY    113

Query         98 SAE--GCTIFVKLWQ-FDPA----------------------------------------    114
d1od5a1      114 NTGdePVVAISLLDTsNFNNqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaq    173

Query        115 ---------------------------drtqfsknm    123
d1od5a1      174 sfntnedtaeklrspdderkqivtvegglsvispkw    209


hit structure      alignment
FAST alignment (Normalized score: 5.87 Raw score:941.60)
Query          1 MEINAD----FTKPVVIDTDQ--LEWRPSPMKGVERRMLDRIGGEVA----------RAT     44
d1od5a1        1 ------NECQLNNLNAL----EPDHRV--ESEGGLIETWN-------SQHPELQCAGVTV     41

Query         45 SIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE--------------------HGDYPAGT     84
d1od5a1       42 SKRTLNRNGLHLPSYSPYPQMIIVVQGKGAI-GFAFPGCPETFEKPQDSHQKIRHFNEGD    100

Query         85 YVRNPPTTSHVPGS--AEGCTIFVK-LWQFDPADRTQFSKNM------------------    123
d1od5a1      101 VLVIPPGVPYWTYNTGDEPVVAISLLDTSN------------FNNQLDQNPRVFYLAGNP    148

Query        124 ------------------------------------------------------------    124
d1od5a1      149 DIEHPETMQEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPK    208

Query        124 -    124
d1od5a1      209 W    209


hit structure      alignment
TMalign alignment (TM-score: 0.63 Raw score:77.83)
Query          1 -MEINADF-T-KPVVIDTDQLEWRPSPMKGVERRMLDRI--------GGEVARATSIVRY     49
d1od5a1        1 N-----ECQLNNLNAL-E--PDHRVE-SEGGLIETWNSQHPELQCAG-----VTVSKRTL     46

Query         50 APGSRFSAHTHDGGEEFIVLDGVFQDE-------------------HGDYPAGTYVRNPP     90
d1od5a1       47 NRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQDSHQKIRHFNEGDVLVIPP    106

Query         91 TTSHVPGSAE--GCTIFVKLWQ-FDPA---------------------------------    114
d1od5a1      107 GVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQEGGSVLSGF    166

Query        115 -------------------------------------------DRTQFSKNM    123
d1od5a1      167 SKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKW---------    209


hit structure      alignment
HHsearch alignment (Probability: 0.94 E-value:0.00)
DALI match       ************************************                     ***
Query         41 ARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDEHG-------------------DYP     81
d1od5a1       38 GVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQDSHQKIRHFN     97

DALI match       *************
Query         82 AGTYVRNPPTTSH     94
d1od5a1       98 EGDVLVIPPGVPY    110



top
13: d2arca_ Regulatory protein AraC (hh: 0.971)

SCOP Superfamily: Regulatory protein AraC  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.59  Contact: 831
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.29 AHM:0.37 LBcontacta:0.99 LBcontactb:0.97 LHM:0.19
id:0.97 blosum:0.33 compass:0.39 pearson:0.94
Scaled scores:
dali:0.78 daliz:0.53 gdtts:0.67 tmscore:0.71 rmsd:0.80 AHM:0.68 LBcontacta:0.68 LBcontactb:0.77 LHM:0.30
id:0.06 blosum:0.09 compass:0.09 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 6.4 Raw score:449.30)
Query          1 meinadftkpvvidtdqlewrPSPMKgverrmldriggeVARATSIVRYAP---gSRFSA     57
d2arca_        1 ---------------------DPLLP--------gysfnAHLVAGLTPIEAngylDFFID     31

Query         58 H--THDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGS---AEGCTIFVKL    108
d2arca_       32 RplGMKGYILNLTIRGQGVVKnqgrEFVCRPGDILLFPPGEIHHYGRhpeAREWYHQWVY     91

Query        109 WqFDPA-----------drTQFSKNM----------------------------------    123
d2arca_       92 F-RPRAywhewlnwpsifaNTGFFRPdeahqphfsdlfgqiinagqgegrysellainll    150

Query        124 -----------    124
d2arca_      151 eqlllrrmeai    161


hit structure      alignment
FAST alignment (Normalized score: 5.03 Raw score:708.00)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGE----------VARATSIVRYA     50
d2arca_        1 ---------------------------------------DPLLPGYSFNAHLVAGLTPIE     21

Query         51 P----GSRFSAH----THDGGEEFIVLDGVFQDE------HGDYPAGTYVRNPPTTSHVP     96
d2arca_       22 ANGYLDFFI---DRPLGMKGYILNLTIRGQGV--VKNQGREFVCRPGDILLFPPGEIHHY     76

Query         97 GS----AEGCTIFVKLW--QFDPADR------------TQFSKNM---------------    123
d2arca_       77 G-RHPEAREWYHQWV--YFRPRAY--WHEWLNWPSIFANTGFF--RPDEAHQPHFSDLFG    129

Query        124 --------------------------------    124
d2arca_      130 QIINAGQGEGRYSELLAINLLEQLLLRRMEAI    161


hit structure      alignment
TMalign alignment (TM-score: 0.58 Raw score:71.90)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM--KGVERRMLDRIGGEV--ARATSIVRYAPG---S     53
d2arca_        1 --------------------DPLLPGY-------------SFNAHLVAGLTPIEANGYLD     27

Query         54 RFSAH--THDGGEEFIVLDGVFQDE----HGDYPAGTYVRNPPTTSHVPGS-A-E-GCTI    104
d2arca_       28 FFIDRPLGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYH     87

Query        105 FVKLWQFDP-AD--RT-------QFSKNM-------------------------------    123
d2arca_       88 QWVYFRPRAYWHEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAI    147

Query        124 --------------    124
d2arca_      148 NLLEQLLLRRMEAI    161


hit structure      alignment
HHsearch alignment (Probability: 0.57 E-value:0.00)
DALI match       ..**************    ....*******************
Query         57 AHTHDGGEEFIVLDGV----FQDEHGDYPAGTYVRNPPTTSHV     95
d2arca_       33 PLGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHH     75



top
14: d1o5ua_ Hypothetical protein TM1112 (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.72  Contact: 568
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.20 AHM:0.21 LBcontacta:0.98 LBcontactb:0.94 LHM:0.17
id:0.99 blosum:0.78 compass:0.63 pearson:0.98
Scaled scores:
dali:0.85 daliz:0.68 gdtts:0.80 tmscore:0.80 rmsd:0.87 AHM:0.74 LBcontacta:0.84 LBcontactb:0.84 LHM:0.36
id:0.14 blosum:0.16 compass:0.23 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 6.5 Raw score:349.60)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldriggevaraTSIVRYApGSRFsAHTH     60
d1o5ua_        1 ------------------------evkiekptpeklkelsvekWPIWEKE-VSEF-DWYY     34

Query         61 DGGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWqfdpad    115
d1o5ua_       35 DTNETCYILEGKVEVTtedgkKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF------     88

Query        116 rtqfsknm    123
d1o5ua_       89 --------     89


hit structure      alignment
FAST alignment (Normalized score: 6.68 Raw score:695.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARA-----------------     43
d1o5ua_        1 -------------------------------------------EVKIEKPTPEKLKELSV     17

Query         44 --TSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE------HGDYPAGTYVRNPPTTSHV     95
d1o5ua_       18 EKWPIWEKE-VSE-FDWYYDTNETCYILEGKVEV-TTEDGKKYVIEKGDLVTFPKGLRCR     74

Query         96 PGSAEGCTIFVKLWQFDPADRTQFSKNM-    123
d1o5ua_       75 WKVLEPVRKHYNL---------------F     88


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:58.28)
Query          1 -----------------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARA     43
d1o5ua_        1 EVKIEKPTPEKLKELSV--------------E-----------------K----------     19

Query         44 TSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGS     98
d1o5ua_       20 WPIWEKE-VSEF-DWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKV     77

Query         99 AEGCTIFVKLWQFDPADRTQFSKNM    123
d1o5ua_       78 LEPVRKHYNL-F-------------     88


hit structure      alignment
HHsearch alignment (Probability: 0.74 E-value:0.00)
DALI match       ****************       ***************
Query         61 DGGEEFIVLDGVFQDEHG-----DYPAGTYVRNPPTTS     93
d1o5ua_       35 DTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLR     72



top
15: d1juha_ Quercetin 2,​3-​dioxygenase (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.73  Contact: 939
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.32 AHM:0.44 LBcontacta:0.99 LBcontactb:0.98 LHM:0.21
id:0.98 blosum:0.21 compass:0.53 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.62 gdtts:0.72 tmscore:0.78 rmsd:0.80 AHM:0.66 LBcontacta:0.68 LBcontactb:0.79 LHM:0.28
id:0.04 blosum:0.07 compass:0.16 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 9.2 Raw score:671.30)
Query          1 ------------------------------------------------------------      1
d1juha_        1 sslivedapdhvrpyvirhysharavtvdtqlyrfyvtgpssgyaftlmgtnaphsdalg     60

Query          1 ------------------------------------------------------------      1
d1juha_       61 vlphihqkhyenfycnkgsfqlwaqsgnetqqtrvlssgdygsvprnvthtfqiqdpdte    120

Query          1 ------------------------------------------------------------      1
d1juha_      121 mtgvivpggfedlfyylgtnatdtthtpyipsistlqsfdvyaelsftprtdtvngtapa    180

Query          1 --------meINADFTKPVVIDTDQLEWRPSP-MKGVERRMLDRI--GGEVARATSIVRY     49
d1juha_      181 ntvwhtganaLASTAGDPYFIANGWGPKYLNSqYGYQIVAPFVTAtqAQDTNYTLSTISM    240

Query         50 APG---srFSAHTHDGGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGSAE-    100
d1juha_      241 STTpstvtVPTWSFPGACAFQVQEGRVVVQigdyaATELGSGDVAFIPGGVEFKYYSEAy    300

Query        101 GCTIFVKLWQ-----------fdpadrtqfsknm    123
d1juha_      301 FSKVLFVSSGsdgldqnlvnggeewssvsfpadw    334


hit structure      alignment
FAST alignment (Normalized score: 5.64 Raw score:1144.00)
Query          1 ME----------------------------------------------------------      2
d1juha_        1 --SSLIVEDAPDHVRPYVIRHYSHARAVTVDTQLYRFYVTGPSSGYAFTLMGTNAPHSDA     58

Query          3 ------------------------------------------------------------      3
d1juha_       59 LGVLPHIHQKHYENFYCNKGSFQLWAQSGNETQQTRVLSSGDYGSVPRNVTHTFQIQDPD    118

Query          3 ------------------------------------------------------------      3
d1juha_      119 TEMTGVIVPGGFEDLFYYLGTNATDTTHTPYIPSISTLQSFDVYAELSFTPRTDTVNGTA    178

Query          3 ------------INADFTKPVVIDTDQLEWRP-SPMKGVERRMLDRIGGEVA--------     41
d1juha_      179 PANTVWHTGANALASTAGDPYFIANGWGPKYLNSQYGYQIVAPFV-------TATQAQDT    231

Query         42 -RATSIVRYAPGSR-------FSAHTHDGGEEFIVLDGVFQDE------HGDYPAGTYVR     87
d1juha_      232 NYTLSTISMS----TTPSTVTVPTWSFPGACAFQVQEGRVVV-QIGDYAATELGSGDVAF    286

Query         88 NPPTTSHVPGS-AEGCTIFVKLWQFDPADRTQFSKNM-----------------------    123
d1juha_      287 IPGGVEFKYYSEAYFSKVLFVS---------------SGSDGLDQNLVNGGEEWSSVSFP    331

Query        124 ---    124
d1juha_      332 ADW    334


hit structure      alignment
TMalign alignment (TM-score: 0.74 Raw score:90.61)
Query          1 ------MEINADFTKPVVIDTDQLEW-RPSPMKGVERRMLDRIG---GEVA-RATSIVRY     49
d1juha_        1 SSLIVE-DAPDHV-RPYVIRHY-SHARAVT-VDTQLYRFYVTGPSSG---YAFTLMGTNA     53

Query         50 APGSRF--SAHTHD-GGEEFIVLDGVFQDE---------HGDYPAGTYVRNPPTTSHVPG     97
d1juha_       54 PHSDALGVLPHIHQKHYENFYCNKGSFQLWAQSGNETQQTRVLSSGDYGSVPRNVTHTFQ    113

Query         98 SAEG-CTIFVKLWQF---------------------------------------------    111
d1juha_      114 IQDPDTEMTGVIVPGGFEDLFYYLGTNATDTTHTPYIPSISTLQSFDVYAELSFTPRTDT    173

Query        112 ---------------------DPADRTQFSK-NM--------------------------    123
d1juha_      174 VNGTAPANTVWHTGANALAST---AGDPYFIANGWGPKYLNSQYGYQIVAPFVTATQAQD    230

Query        124 ------------------------------------------------------------    124
d1juha_      231 TNYTLSTISMSTTPSTVTVPTWSFPGACAFQVQEGRVVVQIGDYAATELGSGDVAFIPGG    290

Query        124 --------------------------------------------    124
d1juha_      291 VEFKYYSEAYFSKVLFVSSGSDGLDQNLVNGGEEWSSVSFPADW    334


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match                                                                   
Query          6 DFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFS--AHTHDGG     63
d1juha_       10 DHVRPYVIRHYSHARAVTVDTQLYRFYVTGPSSGYAFTLMGTNAPHSDALGVLPHIHQKH     69

DALI match                                                 
Query         64 -EEFIVLDGVFQDEHGD---------YPAGTYVRNPPTTSHV     95
d1juha_       70 YENFYCNKGSFQLWAQSGNETQQTRVLSSGDYGSVPRNVTHT    111



hit structures. 
top
16: d1j1la_ Pirin (hh: 0.969)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.72  Contact: 1060
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.38 AHM:0.35 LBcontacta:0.99 LBcontactb:0.99 LHM:0.10
id:0.98 blosum:0.21 compass:0.16 pearson:0.98
Scaled scores:
dali:0.79 daliz:0.54 gdtts:0.62 tmscore:0.71 rmsd:0.78 AHM:0.76 LBcontacta:0.64 LBcontactb:0.73 LHM:0.50
id:0.05 blosum:0.08 compass:0.12 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 9.2 Raw score:663.80)
Query          1 meinadfTKPVVIDtdqLEWRPSpMKGVERRMLDR----IGGEVARATSIVRYAPGSRFS     56
d1j1la_        1 ----sskKVTLSVL---SREQSE-GVGARVRRSIGrpelKNLDPFLLFDEFKGGRPGGFP     52

Query         57 AHTHD-GGEEFIVL-DGVFQDE-----HGDYPAGTYVRNPP--TTSHVPGSAE--GCTIF    105
d1j1la_       53 DHPHRgFETVSYLLeGGSMAHEdfcghTGKMNPGDLQWMTAgrGILHAEMPCSeePAHGL    112

Query        106 VKLWQF---DPAD-RTQFSKNM--------------------------------------    123
d1j1la_      113 QLWVNLrssEKMVePQYQELKSeeipkpskdgvtvavisgealgikskvytrtptlyldf    172

Query        124 ------------------------------------------------------------    124
d1j1la_      173 kldpgakhsqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpk    232

Query        124 --------------------------------------------------------    124
d1j1la_      233 rshfvliageplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign    288


hit structure      alignment
FAST alignment (Normalized score: 5.54 Raw score:1043.00)
Query          1 MEINADFTK-----PVVIDTDQLEWRPSPMKGVERRMLDRIGGEV-----------ARAT     44
d1j1la_        1 ---------SSKKVTLSVL---SREQS-EGVGARVRRS-------IGRPELKNLDPFLLF     40

Query         45 SIVRYAPGS--RFSAHTHD-GGEEFIVL-DGVFQDE-------HGDYPAGTYVRNPP---     90
d1j1la_       41 DEFKGGR--PGGFPDHPHRGFETVSYLLEGGSMA--HEDFCGHTGKMNPGDLQWM--TAG     94

Query         91 -TTSHVPGS--AEGCTIFVKLWQF-------DPAD-RTQFSKNM----------------    123
d1j1la_       95 RGILHAEMPCSEEPAHGLQL----WVNLRSSEKMVEPQYQEL--KSEEIPKPSKDGVTVA    148

Query        124 ------------------------------------------------------------    124
d1j1la_      149 VISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ    208

Query        124 ------------------------------------------------------------    124
d1j1la_      209 KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILD    268

Query        124 --------------------    124
d1j1la_      269 FRNAKNGFERAKTWKSKIGN    288


hit structure      alignment
TMalign alignment (TM-score: 0.59 Raw score:72.48)
Query          1 ---------------------------------------------------------MEI      3
d1j1la_        1 SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHR---     57

Query          4 NADFTKPVVIDTD-----------------QL----------------------------     18
d1j1la_       58 ---GFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQL    114

Query         19 -------------------E---WRPSPMKGVERRMLDR---------IG--GEVARATS     45
d1j1la_      115 WVNLRSSEKMVEPQYQELKSEEIPKPS-KDGVTVAVISGEALGIKSKVYTRT---PTLYL    170

Query         46 IVRYAPGSRFSAHTH-D-GGEEFIVLDGVFQD----EHGDYPAGTYVRNPPTTSHVPGSA     99
d1j1la_      171 DFKLDPGAKH-SQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENK    229

Query        100 E--GCTIFVKLWQFDPA-------------------------------------------    114
d1j1la_      230 DPKRSHFVLIA-GEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN    288

Query        115 DRTQFSKNM    123
d1j1la_      289 ---------    289


hit structure      alignment
HHsearch alignment (Probability: 0.84 E-value:0.00)
DALI match       ...........................  *******..... ***. ***        **
Query         28 VERRMLDRIGGEVARATSIVRYAPGSR--FSAHTHDGGEEF-IVLD-GVF-----QDEHG     78
d1j1la_       22 VRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTG     81

DALI match       ************..
Query         79 DYPAGTYVRNPPTT     92
d1j1la_       82 KMNPGDLQWMTAGR     95



top
17: d1e5sa_ Type II Proline 3-​hydroxylase (proline oxidase) (hh: 0.969)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.63  Contact: 820
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.32 AHM:0.39 LBcontacta:0.98 LBcontactb:0.97 LHM:0.20
id:0.93 blosum:0.07 compass:0.56 pearson:0.96
Scaled scores:
dali:0.75 daliz:0.47 gdtts:0.59 tmscore:0.65 rmsd:0.78 AHM:0.67 LBcontacta:0.62 LBcontactb:0.72 LHM:0.29
id:0.03 blosum:0.03 compass:0.08 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 5.8 Raw score:434.80)
Query          1 --------meinadftkpvviDTDQLEWR-psPMKGVERRMLDRI---------------     36
d1e5sa_        1 mrshilgkieldqtrlapdlaYLAAVPTVeefSNGFWKHVPLWNQptahvehvpylkeiv     60

Query         37 ----ggevaRATSIVRYApGSRFSAHTH-dGGEEFIVLDGV--FQDE----HGDYPAGTY     85
d1e5sa_       61 ttvfdgthlQMARSRNLK-NAIVIPHRDfrYFRTFMVLEDSplAFHSnedtVIHMRPGEI    119

Query         86 VRNPPTTSHVPGSA--EGCTIFVKLwQFDPA-----------------------------    114
d1e5sa_      120 WFLDAATVHSAVNFseISRQSLCVD-FAFDGpfdekeifadatlyapgstpdlperrpft    178

Query        115 ------------------------------------------------------------    115
d1e5sa_      179 aehrrrilslgqvierenfrdilfllskvhykydvhpsetydwlieiskqagdekmvvka    238

Query        115 -------------drtqfsknm    123
d1e5sa_      239 eqirdfavearalserfsltsw    260


hit structure      alignment
FAST alignment (Normalized score: 4.16 Raw score:743.40)
Query          1 MEINADFTKPVVI---------------------DTDQLEWRPSPM-----KGVERRMLD     34
d1e5sa_        1 -------------MRSHILGKIELDQTRLAPDLAYLAAVPTV----EEFSNGFWKHVPLW     43

Query         35 RIGGEV-------------------------ARATSIVRYAPGSRFSAHTH-DGGEEFIV     68
d1e5sa_       44 ------NQPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNL-KNAIVIPHRDFRYFRTFMV     96

Query         69 LD----GVFQDEH--GDYPAGTYVRNPPTTSHVPGS--AEGCTIFVKLWQFDPADRTQFS    120
d1e5sa_       97 LEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCV-------------    143

Query        121 KNM---------------------------------------------------------    123
d1e5sa_      144 ---DFAFDGPFDEKEIFADATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDI    200

Query        124 ------------------------------------------------------------    124
d1e5sa_      201 LFLLSKVHYKYDVHPSETYDWLIEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLTSW    260


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:73.36)
Query          1 -----------------MEINADFTKPVVIDT--DQ-LEWRPSP-MK-GVERRMLDRI--     36
d1e5sa_        1 MRSHILGKIELDQTRLA-------------PDLAYLAAVPTVEEFSNGFWKHVPLWNQPT     47

Query         37 ----------------------GGEVARATSIVRYAPGSRFSAHTHD-GGEEFIVLDGV-     72
d1e5sa_       48 AHVEHVPYLKEIVTTVFDGTHL-----QMARSRNLK-NAIVIPHRDFRYFRTFMVLEDSP    101

Query         73 -FQDE----HGDYPAGTYVRNPPTTSHVPGSAE--GCTIFVKLWQFDP-ADRT-------    117
d1e5sa_      102 LAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVD-FAFDGPFDEKEIFADA    160

Query        118 ----QFSKN---------------------------------------------------    122
d1e5sa_      161 TLYA-PGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDVHPSETY    219

Query        123 -----------------------------------------M    123
d1e5sa_      220 DWLIEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLTSW-    260


hit structure      alignment
HHsearch alignment (Probability: 0.21 E-value:0.00)
DALI match       ........ *********  ***********    .......  ****************
Query         43 ATSIVRYAPGSRFSAHTH-DGGEEFIVLDGV----FQDEHGD--YPAGTYVRNPPTTSHV     95
d1e5sa_       70 QMARSRNLKNAIVIPHRDFRYFRTFMVLEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHS    129



top
18: d1j58a_ Oxalate decarboxylase OxdC (YvrK) (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.67  Contact: 942
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.99 tmscore:1.00 rmsd:0.37 AHM:0.41 LBcontacta:0.99 LBcontactb:0.98 LHM:0.34
id:1.00 blosum:0.95 compass:0.68 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.62 gdtts:0.66 tmscore:0.71 rmsd:0.74 AHM:0.63 LBcontacta:0.80 LBcontactb:0.83 LHM:0.25
id:0.16 blosum:0.20 compass:0.24 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 8.9 Raw score:600.80)
Query          1 ------------------------------meinadftkpvvidtdqLEWRPSpmKGVER     30
d1j58a_        1 pqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdTHNRLE--KGGYA     58

Query         31 RMlDRIG---GEVARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE---------HG     78
d1j58a_       59 RE-VTVRelpISENLASVNMRLKPGAIRELHWHKEAEWAYMIYGSARVTivdekgrsfID    117

Query         79 DYPAGTYVRNPPTTSHVPGSA-EGCTIFVKLWQ---------------------------    110
d1j58a_      118 DVGEGDLWYFPSGLPHSIQALeEGAEFLLVFDDgsfsenstfqltdwlahtpkeviaanf    177

Query        111 ---------------------------------fdpadrtqFSKNM--------------    123
d1j58a_      178 gvtkeeisnlpgkekyifenqlpgslkddivegpngevpypFTYRLleqepieseggkvy    237

Query        124 ------------------------------------------------------------    124
d1j58a_      238 iadstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfn    297

Query        124 ------------------------------------------------------------    124
d1j58a_      298 yqagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlg    357

Query        124 ---------------    124
d1j58a_      358 kdftdvlskekhpvv    372


hit structure      alignment
FAST alignment (Normalized score: 4.65 Raw score:995.20)
Query          1 MEINADF-------------------------------------TKPVVIDTDQLEWRPS     23
d1j58a_        1 -------PQPIRGDKGATVKIPRNIERDRQNPDMLVPPETDHGTVSNMKFSFSDTHNR--     51

Query         24 PMKGVERRMLDRIGGEVA-----------RATSIVRYAPGSRFSAHTHDGGEEFIVLDGV     72
d1j58a_       52 LEKGGYARE---------VTVRELPISENLASVNMRLKPGAIRELHWHKEAEWAYMIYGS    102

Query         73 FQDE----------HGDYPAGTYVRNPPTTSHVPG-SAEGCTIFVKLWQFDPADRTQFSK    121
d1j58a_      103 ARV-TIVDEKGRSFIDDVGEGDLWYFPSGLPHSIQALEEGAEFLLVF-------------    148

Query        122 NM----------------------------------------------------------    123
d1j58a_      149 --DDGSFSENSTFQLTDWLAHTPKEVIAANFGVTKEEISNLPGKEKYIFENQLPGSLKDD    206

Query        124 ------------------------------------------------------------    124
d1j58a_      207 IVEGPNGEVPYPFTYRLLEQEPIESEGGKVYIADSTNFKVSKTIASALVTVEPGAMRELH    266

Query        124 ------------------------------------------------------------    124
d1j58a_      267 WHPNTHEWQYYISGKARMTVFASDGHARTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLE    326

Query        124 ----------------------------------------------    124
d1j58a_      327 IFKDDHYADVSLNQWLAMLPETFVQAHLDLGKDFTDVLSKEKHPVV    372


hit structure      alignment
TMalign alignment (TM-score: 0.67 Raw score:81.85)
Query          1 -------------------------------------MEINADFTKPVVIDTDQLE-WRP     22
d1j58a_        1 PQPIRGDKGATVKIPRNIERDRQNPDMLVPPETDHGT------VSNMKFS-F--SDTHNR     51

Query         23 SPMKGVERRMLDRIG-------GEVARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQD     75
d1j58a_       52 L-EKGGYARE-VTVRELPISEN----LASVNMRLKPGAIRELHWHKEAEWAYMIYGSARV    105

Query         76 E---------HGDYPAGTYVRNPPTTSHVPGSAE-GCTIFVKLWQF--------------    111
d1j58a_      106 TIVDEKGRSFIDDVGEGDLWYFPSGLPHSIQALEEGAEFLLVF-DDGSFSENSTFQLTDW    164

Query        112 ----------------------------------------------------DPADRTQF    119
d1j58a_      165 LAHTPKEVIAANFGVTKEEISNLPGKEKYIFENQLPGSLKDDIVEGPNGEVP-----YPF    219

Query        120 SKNM--------------------------------------------------------    123
d1j58a_      220 TYRLLEQEPIESEGGKVYIADSTNFKVSKTIASALVTVEPGAMRELHWHPNTHEWQYYIS    279

Query        124 ------------------------------------------------------------    124
d1j58a_      280 GKARMTVFASDGHARTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDDHYADVSLN    339

Query        124 ---------------------------------    124
d1j58a_      340 QWLAMLPETFVQAHLDLGKDFTDVLSKEKHPVV    372


hit structure      alignment
HHsearch alignment (Probability: 0.96 E-value:0.00)
DALI match                                      ........ ............. ******
Query          3 INADFTKPVVIDTDQLEWRPSP---------MKGVERRMLDRIGGEVARATSI-VRYAPG     52
d1j58a_       23 QNPDMLVPPETDHGTVSNMKFSFSDTHNRLEKGGYAREVTVRELPISENLASVNMRLKPG     82

DALI match       ********************    ....       ******************** .***
Query         53 SRFSAHTHDGGEEFIVLDGV----FQDEHG-----DYPAGTYVRNPPTTSHVPGS-AEGC    102
d1j58a_       83 AIRELHWHKEAEWAYMIYGSARVTIVDEKGRSFIDDVGEGDLWYFPSGLPHSIQALEEGA    142

DALI match       ****
Query        103 TIFV    106
d1j58a_      143 EFLL    146



top
19: d1jopa_ Hypothetical protein HI0227 (svm: 1.387)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.50  Contact: 654
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.98 tmscore:0.99 rmsd:0.37 AHM:0.45 LBcontacta:0.97 LBcontactb:0.96 LHM:0.25
id:0.99 blosum:0.64 compass:0.49 pearson:0.98
Scaled scores:
dali:0.77 daliz:0.51 gdtts:0.54 tmscore:0.57 rmsd:0.75 AHM:0.61 LBcontacta:0.66 LBcontactb:0.75 LHM:0.23
id:0.09 blosum:0.13 compass:0.20 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 5.3 Raw score:369.00)
Query          1 --------------meinadftkpvvIDTDqlewrpspmkgvERRMLDRIGgevARATSI     46
d1jopa_        1 miissltnpnfkvglpkviaevcdylNTLD--------lnalENGRHDIND---QIYMNV     49

Query         47 VRYapgsrfSAHTHD-GGEEFIVLDGVFQDE-----------------------------     76
d1jopa_       50 MEP------KAELHHeYLDVQVLIRGTENIEvgatypnlskyedyneaddyqlcadiddk    103

Query         77 -HGDYPAGTYVRNPPTTSHVPGSAegCTIFVKLWQFDPAdrtqfsknm    123
d1jopa_      104 fTVTMKPKMFAVFYPYEPHKPCCV--IKKLVVKVPVKLI---------    140


hit structure      alignment
FAST alignment (Normalized score: 4.91 Raw score:644.70)
Query          1 MEINADFTKPV---------------------------VIDTDQLEWRPSPMKGVERRML     33
d1jopa_        1 -----------MIISSLTNPNFKVGLPKVIAEVCDYLNTLDLNALE----------NGRH     39

Query         34 DRIGGEV--ARATSIVRYAPGSR-FSAHTHD-GGEEFIVLDGVFQDE-------------     76
d1jopa_       40 DI-----NDQIYMNVM-------EPKAELHHEYLDVQVLIRGTENI-EVGATYPNLSKYE     86

Query         77 ------------------HGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQ    118
d1jopa_       87 DYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCC--VIKKLVV--KVPVKL---    139

Query        119 FSKNM-    123
d1jopa_      140 -----I    140


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:59.13)
Query          1 ----------------------------MEINADFTKPVVI-DTDQLEWRPSPMKGVERR     31
d1jopa_        1 MIISSLTNPNFKVGLPKVIAEVCDYLNT----------LDLNAL--E-----------NG     37

Query         32 MLDRIGGEVARATSIVRYAPGSRFSAHTHDGGEEFIVL-DGVFQD---------------     75
d1jopa_       38 RHDIND---QIYMNVMEP-----KAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYN     89

Query         76 -------------EHGDYPA-GTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSK    121
d1jopa_       90 EADDYQLCADIDDKFTVTMKPKMFAVFY-PYEPHKPCCV-IKKLVVK-VPVKLI------    140

Query        122 NM    123
d1jopa_      141 --    141


hit structure      alignment
HHsearch alignment (Probability: 0.12 E-value:0.00)
DALI match       ******************
Query         79 DYPAGTYVRNPPTTSHVP     96
d1jopa_      107 TMKPKMFAVFYPYEPHKP    124



top
20: d1eyba_ Homogentisate dioxygenase (hh: 0.965)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.73  Contact: 990
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.39 AHM:0.47 LBcontacta:0.99 LBcontactb:0.98 LHM:0.24
id:0.99 blosum:0.15 compass:0.16 pearson:0.98
Scaled scores:
dali:0.79 daliz:0.53 gdtts:0.59 tmscore:0.66 rmsd:0.76 AHM:0.66 LBcontacta:0.68 LBcontactb:0.77 LHM:0.30
id:0.07 blosum:0.07 compass:0.12 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:607.10)
Query          1 ------------------------------------------------------------      1
d1eyba_        1 aelkyisgfgnecssedprcpgslpegqnnpqvcpynlyaeqlsgsaftcprstnkrswl     60

Query          1 -------------------meINAD-FTKP-vVIDTD-qlewrpspMKGV---ERRMLDR     35
d1eyba_       61 yrilpsvshkpfesideghvtHNWDeVDPDpnQLRWKpfeipkasqKKVDfvsGLHTLCG    120

Query         36 IGGE---VARATSIVRYApGSRF-SAHTHD-GGEEFIVLDGVFQDE----HGDYPAGTYV     86
d1eyba_      121 AGDIksnNGLAIHIFLCN-TSMEnRCFYNSdGDFLIVPQKGNLLIYtefgKMLVQPNEIC    179

Query         87 RNPPTTSHVPGSAEGCTIFVKLWQFDP---------------------------------    113
d1eyba_      180 VIQRGMRFSIDVFEETRGYILEVYGVHfelpdlgpiganglanprdflipiawyedrqvp    239

Query        114 -----------------------------adRTQFSKNM---------------------    123
d1eyba_      240 ggytvinkyqgklfaakqdvspfnvvawhgnYTPYKYNLknfmvinsvafdhadpsiftv    299

Query        124 ------------------------------------------------------------    124
d1eyba_      300 ltaksvrpgvaiadfvifpprwgvadktfrppyyhrncmsefmglirgflpgggslhstm    359

Query        124 ------------------------------------------------------------    124
d1eyba_      360 tphgpdadcfekaskvklaperiadgtmafmfesslslavtkwglkasrlkshftpnsrn    419


hit structure      alignment
FAST alignment (Normalized score: 4.10 Raw score:930.10)
Query          1 MEINAD------------------------------------------------------      6
d1eyba_        1 ------AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRST     54

Query          7 -----------------------------------FTKPVVIDTDQLEWRPSPMKG----     27
d1eyba_       55 NKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRW--------------KPFE    100

Query         28 ------------VERRMLDRIGGEVA-------RATSIVRYAPGSRF------SAHTHD-     61
d1eyba_      101 IPKASQKKVDFVSGLHTLCGAG----DIKSNNGLAIHIFLC------NTSMENRCFYNSD    150

Query         62 GGEEFIVLDGVFQDE-----HGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPAD-    115
d1eyba_      151 GDFLIVPQKGNLLI-YTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYIL---EVYGVH    206

Query        116 ------------------------------------------------------------    116
d1eyba_      207 FELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVA    266

Query        116 ----RTQFSKNM------------------------------------------------    123
d1eyba_      267 WHGNYTPYKY--NLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVA    324

Query        124 ------------------------------------------------------------    124
d1eyba_      325 DKTFRPPYYHRNCMSEFMGLIRGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIAD    384

Query        124 -----------------------------------    124
d1eyba_      385 GTMAFMFESSLSLAVTKWGLKASRLKSHFTPNSRN    419


hit structure      alignment
TMalign alignment (TM-score: 0.68 Raw score:83.15)
Query          1 ------------------------------------------------------------      1
d1eyba_        1 AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWL     60

Query          1 ----------------------ME-INADFTKPVVIDTDQLEWR-----PSPMKG---VE     29
d1eyba_       61 YRILPSVSHKPFESIDEGHVTHNWDEVDP--DPNQLRWKPFEIPKASQK----KVDFVSG    114

Query         30 RRMLDRI-GGE-V-ARATSIVRYAPGSRF-SAHTHD-GGEEFIVLDGVFQDE----HGDY     80
d1eyba_      115 LHTLCGAGDIKSNNGLAIHIFLCN-TSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLV    173

Query         81 PAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPAD-------------------------    115
d1eyba_      174 QPNEICVIQRGMRFSIDVFEETRGYILE-VYGV-HFELPDLGPIGANGLANPRDFLIPIA    231

Query        116 ---------------------------------------RTQFSKNM-------------    123
d1eyba_      232 WYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDH    291

Query        124 ------------------------------------------------------------    124
d1eyba_      292 ADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGFLPG    351

Query        124 ------------------------------------------------------------    124
d1eyba_      352 GGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRLKS    411

Query        124 --------    124
d1eyba_      412 HFTPNSRN    419


hit structure      alignment
HHsearch alignment (Probability: 0.81 E-value:0.00)
DALI match       .                            *********   .***********.....**
Query         10 PVVIDTDQLEWRPSPMKGVE---------RRMLDRIGG---EVARATSIVRYAPGSRFSA     57
d1eyba_       86 EVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRC    145

DALI match        ....************    ...******************************
Query         58 -HTHDGGEEFIVLDGVF----QDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFV    106
d1eyba_      146 FYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYI    199



hit structures. 
top
21: d1pf0a_ Putative ion channel CnbD (svm: 1.414)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.47  Contact: 551
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.98 tmscore:0.99 rmsd:0.36 AHM:0.34 LBcontacta:0.96 LBcontactb:0.94 LHM:0.10
id:0.93 blosum:0.61 compass:0.69 pearson:0.98
Scaled scores:
dali:0.79 daliz:0.51 gdtts:0.61 tmscore:0.63 rmsd:0.74 AHM:0.69 LBcontacta:0.67 LBcontactb:0.78 LHM:0.53
id:0.05 blosum:0.11 compass:0.25 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:325.90)
Query          1 meinadftkpVVID--TDQL-----ewrpspmkgverrMLDRiggevaraTSIVRYAPGS     53
d1pf0a_        1 ---------vRRGDfvRNWQlvaavplfqklgpavlveIVRA--------LRARTVPAGA     43

Query         54 R-fSAHTHdgGEEFIVLDGVFQDE---HGDYPAGTYVRN----pPTTS-HVPGSAEGCTI    104
d1pf0a_       44 VicRIGEP-gDRMFFVVEGSVSVAtpnPVELGPGAFFGEmalisGEPRsATVSAATTVSL    102

Query        105 FVKLWQ-----------fdpadRTQF-sknm    123
d1pf0a_      103 LSLHSAdfqmlcssspeiaeifRKTAlerrg    133


hit structure      alignment
FAST alignment (Normalized score: 3.55 Raw score:453.80)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1pf0a_        1 ------------------------------------------VRRGDFVRNWQLVAAVPL     18

Query         43 --------------ATSIVRYAPGSRFSAHTHDG--------GEEFIVLDGVFQDE----     76
d1pf0a_       19 FQKLGPAVLVEIVRALRARTVPAGAV--------ICRIGEPGDRMFFVVEGSVSV-ATPN     69

Query         77 HGDYPAGTYVR-----NPPTT--SHVPGSAEGCTIFVKLWQFDPADRTQFSKNM------    123
d1pf0a_       70 PVELGPGAF--FGEMALISGEPRSATVSAATTVSLLSL----------------HSADFQ    111

Query        124 ----------------------    124
d1pf0a_      112 MLCSSSPEIAEIFRKTALERRG    133


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:61.65)
Query          1 MEIN--ADFTKPVVIDTD---------------------QLEWRPSPMKGVERRMLDRIG     37
d1pf0a_        1 ---VRR------GDFVRNWQLVAAVPLFQKLGPAVLVEI----------------VR---     32

Query         38 GEVARATSIVRYAPGSRFSA--HTHDGGEEFIVLDGVFQDEH---GDYPAGTYV-RN-P-     89
d1pf0a_       33 -----ALRARTVPAGAVICRIGEPG-D-RMFFVVEGSVSVATPNPVELGPGAFFGEMALI     85

Query         90 -PTTS-HVPGSAEGCTIFVKLWQ-FD---------PAD--RT--QFS---KNM    123
d1pf0a_       86 SGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEI--AEIFRKTALERRG---    133


hit structure      alignment
HHsearch alignment (Probability: 0.23 E-value:0.00)
DALI match       ********* .....  *************   .**********
Query         46 IVRYAPGSRFSAHTHDGGEEFIVLDGVFQD---EHGDYPAGTYV     86
d1pf0a_       36 ARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFF     79



top
22: d1h2ka_ Hypoxia-​inducible factor HIF ihhibitor (FIH1) (hh: 0.971)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.69  Contact: 869
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.40 LBcontacta:0.98 LBcontactb:0.97 LHM:0.48
id:0.97 blosum:0.37 compass:0.52 pearson:0.78
Scaled scores:
dali:0.79 daliz:0.57 gdtts:0.70 tmscore:0.73 rmsd:0.80 AHM:0.65 LBcontacta:0.69 LBcontactb:0.76 LHM:0.07
id:0.06 blosum:0.10 compass:0.05 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 5.7 Raw score:527.70)
Query          1 --------------------------------------------------------mein      4
d1h2ka_        1 epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal     60

Query          5 adftkpvviDTDQLEWRPSP----------------------------------------     24
d1h2ka_       61 kwdleylqeNIGNGDFSVYSasthkflyydekkmanfqnfkprsnreemkfhefveklqd    120

Query         25 -------mKGVERRMLD------------------------riggevARATSIVRYAPGS     53
d1h2ka_      121 iqqrggeeRLYLQQTLNdtvgrkivmdflgfnwnwinkqqgkrgwgqLTSNLLLIGMEGN    180

Query         54 RFSAHTHDGGEEFIVLDGVFQDE-------------------------------------     76
d1h2ka_      181 VTPAHYDEQQNFFAQIKGYKRCIlfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn    240

Query         77 -------HGDYPAGTYVRNPPTTSHVPGSA---EGCTIFVKLwQFDPA------------    114
d1h2ka_      241 fqnvvgyETVVGPGDVLYIPMYWWHHIESLlngGITITVNFW-YKGAPtpeyplkahqkv    299

Query        115 ------------------------drtqfsknm    123
d1h2ka_      300 aimrniekmlgealgnpqevgpllntmikgryn    332


hit structure      alignment
FAST alignment (Normalized score: 4.28 Raw score:864.40)
Query          1 MEINADFTKPVVIDT---------------------------------------------     15
d1h2ka_        1 ---------------EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENE     45

Query         16 --------------------------DQLEWRPSPM------------------------     25
d1h2ka_       46 EPVVLTDTNLVYPALKWDLEYLQENIGNGDFSV---YSASTHKFLYYDEKKMANFQNFKP    102

Query         26 --------------------------KGVERRMLDRIGGEV-------------------     40
d1h2ka_      103 RSNREEMKFHEFVEKLQDIQQRGGEERLYLQQT--------LNDTVGRKIVMDFLGFNWN    154

Query         41 -------------ARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE-----------     76
d1h2ka_      155 WINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRC-ILFPPDQFECL    213

Query         77 ----------------------------------HGDYPAGTYVRNPPTTSHVPGS----     98
d1h2ka_      214 YPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIE-SLLN    272

Query         99 AEGCTIFVKLWQFDPADRTQFSKNM-----------------------------------    123
d1h2ka_      273 GGITITVNF----------------WYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNP    316

Query        124 ----------------    124
d1h2ka_      317 QEVGPLLNTMIKGRYN    332


hit structure      alignment
TMalign alignment (TM-score: 0.62 Raw score:75.87)
Query          1 ------------------------------------------------------------      1
d1h2ka_        1 EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPAL     60

Query          1 -----MEINADFTKPVVIDTD--QL--E-WRPSP-----M-----------------K--     26
d1h2ka_       61 KWDLE--------------YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR    106

Query         27 -----------------------GVERRMLDR----------------------------     35
d1h2ka_      107 EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG    166

Query         36 -IGGEVARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE------------------     76
d1h2ka_      167 Q-----LTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHP    221

Query         77 --------------------------HGDYPAGTYVRNPPTTSHVPGSA--E-GCTIFVK    107
d1h2ka_      222 CDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNF    281

Query        108 LWQFDPA---------------------------------------------DRTQFSKN    122
d1h2ka_      282 W-YKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN--------    332

Query        123 M    123
d1h2ka_      333 -    333


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.01)
DALI match       ********************  .......... 
Query         79 DYPAGTYVRNPPTTSHVPGS--AEGCTIFVKLW    109
d1h2ka_      250 VVGPGDVLYIPMYWWHHIESLLNGGITITVNFW    282



top
23: d1x8ma_ 5-​keto-​4-​deoxyuronate isomerase KduI (hh: 0.963)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.48  Contact: 1002
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.41 AHM:0.48 LBcontacta:0.98 LBcontactb:0.98 LHM:0.11
id:0.85 blosum:0.04 compass:0.08 pearson:0.95
Scaled scores:
dali:0.77 daliz:0.47 gdtts:0.53 tmscore:0.61 rmsd:0.76 AHM:0.65 LBcontacta:0.61 LBcontactb:0.71 LHM:0.45
id:-0.00 blosum:0.02 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 7.7 Raw score:534.80)
Query          1 MEINADFT--------------KPVVIDTdqlewrpspmkGVERRMlDRIGgeVARATSI     46
d1x8ma_        1 SLDVRQSIhsahaktldtqglrNEFLVEK--------vfvADEYTM-VYSH-iDRIIVGG     50

Query         47 VRYApGSRF-----------saHTHD-GGEEFIVLDGVFQDE----HGDYPAGTYVRNPP     90
d1x8ma_       51 IMPI-TKTVsvggevgkqlgvsYFLErRELGVINIGGAGTITvdgqCYEIGHRDALYVGK    109

Query         91 TT-SHVPGSAE---GCTIFVKLWQfDPADRTQFSKNM-----------------------    123
d1x8ma_      110 GAkEVVFASIDtgtPAKFYYNCAP-AHTTYPTKKVTPdevspvtlgdnltsnrrtinkyf    168

Query        124 ------------------------------------------------------------    124
d1x8ma_      169 vpdvletcqlsmgltelapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneq    228

Query        124 -------------------------------    124
d1x8ma_      229 avispswsihsgvgtkaytfiwgmvgenqvf    259


hit structure      alignment
FAST alignment (Normalized score: 4.07 Raw score:726.60)
Query          1 MEINADF-----------------------------------------------------      7
d1x8ma_        1 -------SLDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMP     53

Query          8 ------------------------------------------------------------      8
d1x8ma_       54 ITKTVSVGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKE    113

Query          8 ------------------------TKPVVID-TDQLEWRPSPM-------KGVERRMLDR     35
d1x8ma_      114 VVFASIDTGTPAKFYYNCAPAHTTYPTKKV-TPDEVSPVT---LGDNLTSNRRTINKYF-    168

Query         36 IGGEV--------ARATSIVRYAP-GSRFSAHTHD-GGEEFIVLD-----GVFQDEH---     77
d1x8ma_      169 -----VPDVLETCQLSMGLTELAPGNLWN------TRMEVYFYF-NMDDDACVFH--MMG    214

Query         78 -------GDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM-------    123
d1x8ma_      215 QPQETRHIVMHNEQAVISPSWSIHSGVGTKAYTFIWG----------------MVGENQV    258

Query        124 -    124
d1x8ma_      259 F    259


hit structure      alignment
TMalign alignment (TM-score: 0.63 Raw score:77.77)
Query          1 ---MEINADFT--K-------PVV--IDTDQLEWRPSPMKGVERRMLDRIG-GEVARATS     45
d1x8ma_        1 SLDVRQ-SIHSAHAKTLDTQG-LRNEFLV--EKVFV---ADEYTMV-YSHID---RIIVG     49

Query         46 IVRYAPGSRFSAH----------T-HD-GGEEFIVLDG-VFQD---EHGDYPAGTYVRNP     89
d1x8ma_       50 GIMPITKTVS-VGGEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVG    108

Query         90 PTTSHVPGSA-E---GCTIFVKLWQFDPADRTQFSKNM----------------------    123
d1x8ma_      109 KGAKEVVFASIDTGTPAKFYYNC-APAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKY    167

Query        124 ------------------------------------------------------------    124
d1x8ma_      168 FVPDVLETCQLSMGLTELAPGNLWNTRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNE    227

Query        124 --------------------------------    124
d1x8ma_      228 QAVISPSWSIHSGVGTKAYTFIWGMVGENQVF    259


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.14)
DALI match                 
Query         86 VRNPPTTSHV     95
d1x8ma_      230 VISPSWSIHS    239



top
24: d1m4oa_ Acireductone dioxygenase (hh: 0.971)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.54  Contact: 577
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.95 tmscore:0.97 rmsd:0.37 AHM:0.40 LBcontacta:0.96 LBcontactb:0.94 LHM:0.36
id:0.95 blosum:0.71 compass:0.58 pearson:0.96
Scaled scores:
dali:0.73 daliz:0.39 gdtts:0.49 tmscore:0.52 rmsd:0.73 AHM:0.65 LBcontacta:0.62 LBcontactb:0.71 LHM:0.17
id:0.07 blosum:0.13 compass:0.22 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:282.60)
Query          1 --------------------------------------meinadftkpvviDTDQLewrp     22
d1m4oa_        1 saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaeTVIAA----     56

Query         23 spmkgverrmldriggevaRATSIVR-------yapGSRF--SAHTHDGGEEFIVLDGVF     73
d1m4oa_       57 -----yqhaidklvaekgyQSWDVISlradnpqkeaLREKflNEHTHGEDEVRFFVEGAG    111

Query         74 QDE--------HGDYPAGTYVRNPPTTSHVPGSA--EGCTIFVKLwQFDPADRT------    117
d1m4oa_      112 LFClhigdevfQVLCEKNDLISVPAHTPHWFDMGsePNFTAIRIF-DNPEGWIAqftgdd    170

Query        118 ---qfsknm    123
d1m4oa_      171 iasayprla    179


hit structure      alignment
FAST alignment (Normalized score: 3.31 Raw score:490.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVA-------------------     41
d1m4oa_        1 -----------------------------------------SALTIFSVKDPQNSLWHST     19

Query         42 ---------------------------------------------------RATSIVRYA     50
d1m4oa_       20 NAEEIQQQLNAKGVRFERWQADRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISL-     78

Query         51 PGS-------------RFSAHTHDGGEEFIVLDGVFQD----------EHGDYPAGTYVR     87
d1m4oa_       79 ---RADNPQKEALREKFLNEHTHGEDEVRFFVEGAGL-FCLHIGDEVFQVLC-EKNDLIS    133

Query         88 NPPTTSHVPGSA--EGCTIFVKLWQFDPADRTQFSKNM----------------------    123
d1m4oa_      134 VPAHTPHWFDMGSEPNFTAIRIFD--------------NPEGWIAQFTGDDIASAYPRLA    179


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:58.11)
Query          1 -------------------------------------------------MEINADFTKPV     11
d1m4oa_        1 SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQADRDLGAAPT-----------     49

Query         12 VIDTDQ-----------------LEWRPSPMKGVERRMLDRIGGEVARATSIVRYA----     50
d1m4oa_       50 --AETVIAAYQHAIDKLVAEKGY------------------------QSWDVISLRADNP     83

Query         51 -PG--SR--FSAHTHDGGEEFIVLDGVFQDE--------HGDYPAGTYVRNPPTTSHVPG     97
d1m4oa_       84 QKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFD    143

Query         98 SA-EG-CTIFVKLWQFD-PADRTQ--------------FSKNM    123
d1m4oa_      144 MGSEPNFTAIRIF-DNPE-GWIAQFTGDDIASAYPRLA-----    179


hit structure      alignment
HHsearch alignment (Probability: 0.94 E-value:0.00)
DALI match       .****************  .....        *********************.......
Query         55 FSAHTHDGGEEFIVLDG--VFQDEHG------DYPAGTYVRNPPTTSHVPGSAEGCTIFV    106
d1m4oa_       93 LNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTA    152

DALI match        . ......
Query        107 KLWQFDPAD    115
d1m4oa_      153 -IRIFDNPE    160



top
25: d1o7fa2 Regulatory domain of Epac2,​ domains 1 and 3 (svm: 1.391)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.52  Contact: 548
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.97 tmscore:0.99 rmsd:0.40 AHM:0.41 LBcontacta:0.96 LBcontactb:0.96 LHM:0.10
id:0.96 blosum:0.26 compass:0.54 pearson:0.98
Scaled scores:
dali:0.78 daliz:0.48 gdtts:0.54 tmscore:0.57 rmsd:0.72 AHM:0.66 LBcontacta:0.63 LBcontactb:0.77 LHM:0.51
id:0.06 blosum:0.06 compass:0.21 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:343.60)
Query          1 -------meINADftkPVVI--DTDQL----ewrpspmkgverrMLDRiggevaraTSIV     47
d1o7fa2        1 aewiacldkRPLE--rSSEDvdIIFTRlkgvkafekfhpnllrqICLC--------GYYE     50

Query         48 RYAPGSR-FSAHTHdgGEEFIVLDGVFQDE------------HGDYPAGTYVRNP---PT     91
d1o7fa2       51 NLEKGITlFRQGDI-gTNWYAVLAGSLDVKvsetsshqdavtICTLGIGTAFGESildNT    109

Query         92 TS-HVPGSAEGCTIFVKLW--QFDP-----------adrtqfsknm    123
d1o7fa2      110 PRhATIVTRESSELLRIEQedFKALwekyrqymagllappygvmet    155


hit structure      alignment
FAST alignment (Normalized score: 3.44 Raw score:474.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1o7fa2        1 ------------------------------------------AEWIACLDKRPLERSSED     18

Query         43 ---------------------------ATSIVRYAPGSRFSAHTHDG--------GEEFI     67
d1o7fa2       19 VDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGIT--------LFRQGDIGTNWYA     70

Query         68 VLDGVFQD-------------EHGDYPAGTYVR----NPPTT--SHVPGSAEGCTIFVKL    108
d1o7fa2       71 VLAGSLD-VKVSETSSHQDAVTICTLGIGTA--FGESILDNTPRHATIVTRESSELLRI-    126

Query        109 WQFDPADRTQFSKNM-----------------------------    123
d1o7fa2      127 ---------------EQEDFKALWEKYRQYMAGLLAPPYGVMET    155


hit structure      alignment
TMalign alignment (TM-score: 0.52 Raw score:63.93)
Query          1 --------MEINADFTKPVVI-DT---------------------DQLEWRPSPMKGVER     30
d1o7fa2        1 AEWIACLD-KRPLER-SSEDVDIIFTRLKGVKAFEKFHPNLLRQI---------------     43

Query         31 RMLDRIGGEVARATSIVRYAPGSRFSA--HTHDGGEEFIVLDGVFQDE------------     76
d1o7fa2       44 --CL--------CGYYENLEKGITLFRQGDIGT--NWYAVLAGSLDVKVSETSSHQDAVT     91

Query         77 HGDYPAGTYVRNPP---TTS-HVPGSAEGCTIFVKLW-QFDP-AD------------RTQ    118
d1o7fa2       92 ICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAPPYG    151

Query        119 F---SKNM    123
d1o7fa2      152 VMET----    155


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.01)
DALI match       *********......  ************
Query         46 IVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1o7fa2       49 YENLEKGITLFRQGDIGTNWYAVLAGSLD     77



hit structures. 
top
26: d1o7fa3 Regulatory domain of Epac2,​ domains 1 and 3 (svm: 1.392)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.48  Contact: 543
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.95 tmscore:0.98 rmsd:0.47 AHM:0.43 LBcontacta:0.96 LBcontactb:0.94 LHM:0.11
id:0.98 blosum:0.57 compass:0.52 pearson:0.98
Scaled scores:
dali:0.76 daliz:0.44 gdtts:0.47 tmscore:0.48 rmsd:0.68 AHM:0.64 LBcontacta:0.63 LBcontactb:0.72 LHM:0.50
id:0.08 blosum:0.12 compass:0.22 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:312.40)
Query          1 meinadftKPVV---IDTDQL-ewrpspmkgverrMLDRiggevaraTSIVRYAPGSRF-     55
d1o7fa3        1 -------tVDDLeiiYDELLHikalshlsttvkreLAGV--------LIFESHAKGGTVl     45

Query         56 SAHThDGGEEFIVLDGVFQDE------HGDYPAGTYVRNP----PTTS-HVPGSAE-GCT    103
d1o7fa3       46 FNQGeEGTSWYIILKGSVNVViygkgvVCTLHEGDDFGKLalvnDAPRaASIVLREdNCH    105

Query        104 IFVKLWQfdpadrtqfsknm    123
d1o7fa3      106 FLRVDKE-dfnrilrdvean    124


hit structure      alignment
FAST alignment (Normalized score: 3.69 Raw score:455.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1o7fa3        1 ------------------------------------------TVDDLEIIYDELLHIKAL     18

Query         43 -------------ATSIVRY-APGSRFSAHTHDG--------GEEFIVLDGVFQD-----     75
d1o7fa3       19 SHLSTTVKRELAGVLIFESHAKGGTV--------LFNQGEEGTSWYIILKGSVN-VVIYG     69

Query         76 --EHGDYPAGTYVR-----NPPTT--SHVPGS-AEGCTIFVK-LWQFDPADRTQFSKNM-    123
d1o7fa3       70 KGVVCTLHEGDD--FGKLALVNDAPRAASIVLREDNCHFLRVDKEDF------------N    115

Query        124 ---------    124
d1o7fa3      116 RILRDVEAN    124


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:57.93)
Query          1 MEINADFTKPVVI-DT---------------------DQLEWRPSPMKGVERRMLDRIGG     38
d1o7fa3        1 --------TVDDLEIIYDELLHIKALSHLSTTVKREL-----------------AG----     31

Query         39 EVARATSIVRYAPGSRF-SA--HTHDGGEEFIVLDGVFQDE------HGDYPAGTYV-RN     88
d1o7fa3       32 ----VLIFESHAKGGTVLFNQGEEG--TSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKL     85

Query         89 P--P-TTS-HVPGSAEG-CTIFVKLWQ-FD---------PADRTQFSKNM    123
d1o7fa3       86 ALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEAN-----------    124


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.05)
DALI match       **** ......**** **************
Query         46 IVRY-APGSRFSAHTHDGGEEFIVLDGVFQ     74
d1o7fa3       35 FESHAKGGTVLFNQGEEGTSWYIILKGSVN     64



top
27: d1cx4a2 Regulatory subunit of Protein kinase A (svm: 1.572)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.46  Contact: 511
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.91 tmscore:0.94 rmsd:0.42 AHM:0.46 LBcontacta:0.95 LBcontactb:0.91 LHM:0.15
id:0.96 blosum:0.70 compass:0.72 pearson:0.98
Scaled scores:
dali:0.80 daliz:0.54 gdtts:0.47 tmscore:0.45 rmsd:0.70 AHM:0.61 LBcontacta:0.69 LBcontactb:0.76 LHM:0.40
id:0.08 blosum:0.12 compass:0.27 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:309.00)
Query          1 -----meinadftKPVVidtdqlewrpspmkgverrMLDRiggevaraTSIVRYAPGSR-     54
d1cx4a2        1 esfieslpflkslEVSE----------------rlkVVDV--------IGTKVYNDGEQi     36

Query         55 fSAHThDGGEEFIVLDGVFQDE--------HGDYPAGTYV-RNPP----TTSHVPGSAEG    101
d1cx4a2       37 iAQGD-SADSFFIVESGEVRITmkrngaveIARCLRGQYFgELALvtnkPRAASAHAIGT     95

Query        102 CTIFVKLWQ-------fdpadrTQFS---------------knm    123
d1cx4a2       96 VKCLAMDVQaferllgpcmeimKRNIatyeeqlvalfgtnmdiv    139


hit structure      alignment
FAST alignment (Normalized score: 3.42 Raw score:446.70)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1cx4a2        1 ------------------------------------------ESFIESLPFLKSLEVSER     18

Query         43 -----ATSIVRYAPGSRFSAHTHDG---------GEEFIVLDGVFQD---------EHGD     79
d1cx4a2       19 LKVVDVIGTKVYNDGE---------QIIAQGDSADSFFIVESGEVR-ITMKRNGAVEIAR     68

Query         80 YPAGTYVRNPP----------TTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM------    123
d1cx4a2       69 CLRGQY-----FGELALVTNKPRAASAHAIGTVKCLAM----------------DVQAFE    107

Query        124 --------------------------------    124
d1cx4a2      108 RLLGPCMEIMKRNIATYEEQLVALFGTNMDIV    139


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:57.86)
Query          1 -------------------MEINADFTKPV-VIDTDQLEWRPSPMKGVERRMLDRIGGEV     40
d1cx4a2        1 ESFIESLPFLKSLEVSERL----------KV-V-------------------DV------     24

Query         41 ARATSIVRYAPGSRFSA--HTHDGGEEFIVLDGVFQDE--------HGDYPAGTYV-RN-     88
d1cx4a2       25 ---IGTKVYNDGEQIIAQGDSA-D-SFFIVESGEVRITMKRNGAVEIARCLRGQYFGELA     79

Query         89 P--PTTS-HVPGSAEGCTIFVKLWQ-FD------PAD--RTQFS----------------    120
d1cx4a2       80 LVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPC--MEIMKRNIATYEEQLVALFGTNMD    137

Query        121 --KNM    123
d1cx4a2      138 IV---    139


hit structure      alignment
HHsearch alignment (Probability: 0.13 E-value:0.00)
DALI match       ********* .... **************    .....    ******      ....**
Query         46 IVRYAPGSRFSAHTHDGGEEFIVLDGVFQ----DEHGD----YPAGTY-----VRNPPTT     92
d1cx4a2       27 TKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRNGAVEIARCLRGQYFGELALVTNKPR     86

DALI match       **************
Query         93 SHVPGSAEGCTIFV    106
d1cx4a2       87 AASAHAIGTVKCLA    100



top
28: d1qwra_ Mannose-​6-​phosphate isomerase ManA (hh: 0.969)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.63  Contact: 807
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.39 AHM:0.50 LBcontacta:0.98 LBcontactb:0.97 LHM:0.23
id:0.98 blosum:0.32 compass:0.39 pearson:0.99
Scaled scores:
dali:0.78 daliz:0.52 gdtts:0.58 tmscore:0.64 rmsd:0.73 AHM:0.59 LBcontacta:0.65 LBcontactb:0.76 LHM:0.29
id:0.06 blosum:0.09 compass:0.18 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 6.9 Raw score:483.90)
Query          1 ------------------------------------------------------------      1
d1qwra_        1 tqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktl     60

Query          1 ------------------------------------------------------------      1
d1qwra_       61 ielweehrevfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyii    120

Query          1 ----------------------------------------meiNADFT------------      8
d1qwra_      121 dckenaeiiyghtarsktelvtminsgdwegllrrikikpgdfYYVPSgtlhalckgalv    180

Query          9 ------------------------------------------KPVVIdtdqlEWRPspMK     26
d1qwra_      181 letqqnsdatyrvydydrldsngsprelhfakavnaatvphvDGYID----eSTES--RK    234

Query         27 GVERRMLDRIGgevARATSIVRYApGSRFsAHTHDGGEEFIVLDGVFQDE----HGDYPA     82
d1qwra_      235 GITIKTFVQGE---YFSVYKWDIN-GEAE-MAQDESFLICSVIEGSGLLKyedkTCPLKK    289

Query         83 GTYVRNPPTTSHVPGSAeGCTIFVKLWqfdpadrtqfsknm    123
d1qwra_      290 GDHFILPAQMPDFTIKG-TCTLIVSHI--------------    315


hit structure      alignment
FAST alignment (Normalized score: 3.70 Raw score:728.30)
Query          1 MEINADF-----------------------------------------------------      7
d1qwra_        1 -------TQSPIFLTPVFKEKIWGGTALRDRFGYSIPSESTGECWAISAHPKGPSTVANG     53

Query          8 ------------------------------------------------------------      8
d1qwra_       54 PYKGKTLIELWEEHREVFGGVEGDRFPLLTKLLDVKEDTSIKVHPDDYYAGENEEGELGK    113

Query          8 ------------------------------------------------------------      8
d1qwra_      114 TECWYIIDCKENAEIIYGHTARSKTELVTMINSGDWEGLLRRIKIKPGDFYYVPSGTLHA    173

Query          8 -------------------------------------------------TKPVVIDTDQL     18
d1qwra_      174 LCKGALVLETQQNSDATYRVYDYDRLDSNGSPRELHFAKAVNAATVPHVDGYID-----E    228

Query         19 EWRPSPMKGVERRMLDRIGGEVA---RATSIVRYAPGSRFSAHTH-DGGEEFIVLDGVFQ     74
d1qwra_      229 STES--RKGITIKTFVQ------GEYFSVYKWDINGEA---EMAQDESFLICSVIEGSG-    276

Query         75 DE-------HGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM--    123
d1qwra_      277 --LLKYEDKTCPLKKGDHFILPAQM-PDFTIKGTCTLIVS----------------HI    315


hit structure      alignment
TMalign alignment (TM-score: 0.58 Raw score:71.52)
Query          1 ------------------------------------------------------------      1
d1qwra_        1 TQSPIFLTPVFKEKIWGGTALRDRFGYSIPSESTGECWAISAHPKGPSTVANGPYKGKTL     60

Query          1 -------------------------------------MEINADFT--------------K      9
d1qwra_       61 IELWEEHREVFGGVEGDRFPLLTKLLDVKEDTSIKVH------PDDYYAGENEEGELGKT    114

Query         10 PVVIDT---------------------------------------DQLE-----------     19
d1qwra_      115 ECWYIIDCKENAEIIYGHTARSKTELVTMINSGDWEGLLRRIKIKPGDFYYVPSGTLHAL    174

Query         20 -----------------------------------------------------WRPSPMK     26
d1qwra_      175 CKGALVLETQQNSDATYRVYDYDRLDSNGSPRELHFAKAVNAATVPHVDGYIDESTESRK    234

Query         27 GVERRMLDRIG-GEVARATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE----HGDYP     81
d1qwra_      235 GITIKTFVQGEY----FSVYKWDIN-GEAE-MAQDESFLICSVIEGSGLLKYEDKTCPLK    288

Query         82 AGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM    123
d1qwra_      289 KGDHFILPAQMPDFTIKG-TCTLIVSH-I-------------    315


hit structure      alignment
HHsearch alignment (Probability: 0.33 E-value:0.00)
DALI match       ...... .... ********************..    *********************.
Query         45 SIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDEHG----DYPAGTYVRNPPTTSHVPGSAE    100
d1qwra_      248 SVYKWDINGEAEMAQDESFLICSVIEGSGLLKYEDKTCPLKKGDHFILPAQMPDFTIKGT    307

DALI match       ....
Query        101 GCTI    104
d1qwra_      308 CTLI    311



top
29: d1ne6a2 Regulatory subunit of Protein kinase A (svm: 1.432)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.48  Contact: 501
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.93 tmscore:0.95 rmsd:0.39 AHM:0.43 LBcontacta:0.95 LBcontactb:0.90 LHM:0.13
id:0.96 blosum:0.71 compass:0.68 pearson:0.97
Scaled scores:
dali:0.81 daliz:0.54 gdtts:0.51 tmscore:0.47 rmsd:0.70 AHM:0.63 LBcontacta:0.69 LBcontactb:0.75 LHM:0.45
id:0.08 blosum:0.14 compass:0.24 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:300.30)
Query          1 -----meinadftKPVVidtdqlewrpspmkgverrMLDRiggevaraTSIVRYAPGSR-     54
d1ne6a2        1 eeflskvsileslDKWE----------------rltVADA--------LEPVQFEDGQKi     36

Query         55 -fsAHTHdgGEEFIVLDGVFQDE-----------HGDYPAGTYVRNP----PTTS-HVPG     97
d1ne6a2       37 vvqGEPG--DEFFIILEGSAAVLqrrseneefveVGRLGPSDYFGEIallmNRPRaATVV     94

Query         98 SAEGCTIFVKLWQ------------fdpadrtqfsknm    123
d1ne6a2       95 ARGPLKCVKLDRPrfervlgpcsdilkrniqqynsfvs    132


hit structure      alignment
FAST alignment (Normalized score: 3.46 Raw score:441.00)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1ne6a2        1 ------------------------------------------EEFLSKVSILESLDKWER     18

Query         43 -----ATSIVRYAPGSRFSAHTHDG--------GEEFIVLDGVFQD------------EH     77
d1ne6a2       19 LTVADALEPVQFEDGQK--------IVVQGEPGDEFFIILEGSAA-VLQRRSENEEFVEV     69

Query         78 GDYPAGTYVR-----NPPTT--SHVPGSAEGCTIFVKLWQFDPADRTQFSKNM-------    123
d1ne6a2       70 GRLGPSDY--FGEIALLMNRPRAATVVARGPLKCVKL----------------DRPRFER    111

Query        124 ---------------------    124
d1ne6a2      112 VLGPCSDILKRNIQQYNSFVS    132


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:56.76)
Query          1 ------------------MEINADFTKPVV---IDTDQLEWRPSPMKGVERRMLDRIGGE     39
d1ne6a2        1 EEFLSKVSILESLDKWER-----------LTVA--------------------DA-----     24

Query         40 VARATSIVRYAPGSRF-SA-HTHDGGEEFIVLDGVFQDE-----------HGDYPAGTYV     86
d1ne6a2       25 ----LEPVQFEDGQKIVVQGEPG-D-EFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYF     78

Query         87 RNP-P---TTS-HVPGSAEGCTIFVKLW--QFD-----PAD--RT--Q-FS-----KNM    123
d1ne6a2       79 GEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPC--SDILKRNIQQYNSFVS---    132


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.01)
DALI match       *********  ....  ************
Query         46 IVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1ne6a2       27 PVQFEDGQKIVVQGEPGDEFFIILEGSAA     55



top
30: d1cx4a1 Regulatory subunit of Protein kinase A (hh: 0.913)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.45  Contact: 547
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.35 AHM:0.41 LBcontacta:0.96 LBcontactb:0.93 LHM:0.14
id:0.90 blosum:0.52 compass:0.62 pearson:0.98
Scaled scores:
dali:0.76 daliz:0.45 gdtts:0.53 tmscore:0.54 rmsd:0.74 AHM:0.63 LBcontacta:0.65 LBcontactb:0.74 LHM:0.45
id:0.04 blosum:0.09 compass:0.23 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.2 Raw score:300.70)
Query          1 MEINadftkpvVIDTDQ--------lewrpspmkgverrMLDRiggevaraTSIVRYAPG     52
d1cx4a1        1 RIIH-----pkTDDQRNrlqeackdillfknldpeqmsqVLDA--------MFEKLVKEG     47

Query         53 SR-fSAHTHDgGEEFIVLDGVFQDE---------HGDYPAGTYVRNPP-----TTSHVPG     97
d1cx4a1       48 EHviDQGDDG-DNFYVIDRGTFDIYvkcdgvgrcVGNYDNRGSFGELAlmyntPRAATIT    106

Query         98 SAEGCTIFVKLWQ----fdpadrtqfsknm    123
d1cx4a1      107 ATSPGALWGLDRVtfrriivknnakkrkmy    136


hit structure      alignment
FAST alignment (Normalized score: 3.28 Raw score:423.90)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1cx4a1        1 ------------------------------------------RIIHPKTDDQRNRLQEAC     18

Query         43 -------------------ATSIVRYAPGSRFSAHTHDG---------GEEFIVLDGVFQ     74
d1cx4a1       19 KDILLFKNLDPEQMSQVLDAMFEKLVKEGE---------HVIDQGDDGDNFYVIDRGTFD     69

Query         75 D----------EHGDYPAGTYVRNPP----------TTSHVPGSAEGCTIFVKLWQFDPA    114
d1cx4a1       70 -IYVKCDGVGRCVGNYDNRGS-----FGELALMYNTPRAATITATSPGALWGL-------    116

Query        115 DRTQFSKNM--------------------    123
d1cx4a1      117 ---------DRVTFRRIIVKNNAKKRKMY    136


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:59.44)
Query          1 MEINADFTKPVVIDTDQ-------------------------LEWRPSPMKGVERRMLDR     35
d1cx4a1        1 -RIIH-----P-KTDDQRNRLQEACKDILLFKNLDPEQMSQV---------------LD-     37

Query         36 IGGEVARATSIVRYAPGSRFSA--HTHDGGEEFIVLDGVFQDE---------HGDYPAGT     84
d1cx4a1       38 -------AMFEKLVKEGEHVIDQGDDG-D-NFYVIDRGTFDIYVKCDGVGRCVGNYDNRG     88

Query         85 YVRNP-P---TTS-HVPGSAEGCTIFVKLW-QFDP--AD--RT-------QFSKNM    123
d1cx4a1       89 SFGELALMYNTPRAATITATSPGALWGLDRVTFRRII-VKN-NAKKRKMY------    136


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.01)
DALI match       *********** ...... ************
Query         44 TSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1cx4a1       39 MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFD     69



hit structures. 
top
31: d1q3ea_ HCN pacemaker channel (hh: 0.939)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.45  Contact: 547
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.96 tmscore:0.98 rmsd:0.38 AHM:0.40 LBcontacta:0.97 LBcontactb:0.95 LHM:0.13
id:0.94 blosum:0.62 compass:0.61 pearson:0.98
Scaled scores:
dali:0.78 daliz:0.49 gdtts:0.52 tmscore:0.53 rmsd:0.75 AHM:0.68 LBcontacta:0.67 LBcontactb:0.77 LHM:0.51
id:0.06 blosum:0.12 compass:0.22 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:324.80)
Query          1 -----------------------------------------------meinadfTKPVV-     12
d1q3ea_        1 dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelnGPLREe     60

Query         13 --IDTDQ-----lewrpspmkgverrMLDRiggevaraTSIVRYAPGSR-fSAHTHDgGE     64
d1q3ea_       61 ivNFNCRklvasmplfanadpnfvtaMLTK--------LKFEVFQPGDYiiREGTIG-KK    111

Query         65 EFIVLDGVFQDE----HGDYPAGTYVRNP----PTTS-HVPGSAEGCTIFVKLWQ-----    110
d1q3ea_      112 MYFIQHGVVSVLtgnkEMKLSDGSYFGEIclltRGRRtASVRADTYCRLYSLSVDnfnev    171

Query        111 ------fdpadRTQF--sknm    123
d1q3ea_      172 leeypmmrrafETVAidrldr    192


hit structure      alignment
FAST alignment (Normalized score: 2.88 Raw score:442.90)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1q3ea_        1 ------------------------------------------DSSRRQYQEKYKQVEQYM     18

Query         43 ------------------------------------------------------------     43
d1q3ea_       19 SFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFAN     78

Query         43 -----------ATSIVRYAPGSRFSAHTHDG---------GEEFIVLDGVFQDE-----H     77
d1q3ea_       79 ADPNFVTAMLTKLKFEVFQPGD---------YIIREGTIGKKMYFIQHGVVSV-LTGNKE    128

Query         78 GDYPAGTYVRNPP----------TTSHVPGSAEGCTIFVK-LWQFDPADRTQFSKNM---    123
d1q3ea_      129 MKLSDGSY-----FGEICLLTRGRRTASVRADTYCRLYSLSVDNF------------NEV    171

Query        124 ---------------------    124
d1q3ea_      172 LEEYPMMRRAFETVAIDRLDR    192


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:61.74)
Query          1 ----------------------------------------------MEIN--AD--FTKP     10
d1q3ea_        1 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDE--DSIL-GEL--NG     55

Query         11 -VV--ID-TD----------------------QLEWRPSPMKGVERRMLDRIGGEVARAT     44
d1q3ea_       56 PLREEIVNFNCRKLVASMPLFANADPNFVTAM----------------LT--------KL     91

Query         45 SIVRYAPGSRFSA--HTHDGGEEFIVLDGVFQDEH----GDYPAGTYV-RN-P--PTTS-     93
d1q3ea_       92 KFEVFQPGDYIIREGTIG-K-KMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRT    149

Query         94 HVPGSAEGCTIFVKLW-QFD---------PAD--RT--QFSK---NM    123
d1q3ea_      150 ASVRADTYCRLYSLSVDNFNEVLEEYPMM--RRAFETVAIDRLDR--    192


hit structure      alignment
HHsearch alignment (Probability: 0.12 E-value:0.01)
DALI match       ****** ...... *********    .....**********        ....******
Query         49 YAPGSRFSAHTHDGGEEFIVLDG----VFQDEHGDYPAGTYV-----RNPPTTSHVPGSA     99
d1q3ea_       96 FQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKLSDGSYFGEICLLTRGRRTASVRAD    155

DALI match       *******
Query        100 EGCTIFV    106
d1q3ea_      156 TYCRLYS    162



top
32: d1ft9a2 CO-​sensing protein CooA,​ N-​terminal domain (hh: 0.901)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.48  Contact: 539
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.88 tmscore:0.91 rmsd:0.46 AHM:0.54 LBcontacta:0.96 LBcontactb:0.93 LHM:0.21
id:0.97 blosum:0.68 compass:0.63 pearson:0.94
Scaled scores:
dali:0.79 daliz:0.52 gdtts:0.43 tmscore:0.40 rmsd:0.67 AHM:0.55 LBcontacta:0.70 LBcontactb:0.80 LHM:0.27
id:0.08 blosum:0.12 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:275.70)
Query          1 ----meinadftKPVVIdtdqlewrpspmkgverrmldriggevaraTSIVRYAPGSRFs     56
d1ft9a2        1 pprfnianvllsPDGET--------------------------ffrgFRSKIHAKGSLVc     34

Query         57 AHTHdgGEEFIVLDGVFQDE---------HGDYPAGTYVRNpptTSHVPGSAEGCTIFVK    107
d1ft9a2       35 TGEGdeNGVFVVVDGRLRVYlvgeereisLFYLTSGDMFCM--hSGCLVEATERTEVRFA     92

Query        108 LWQ------------------------fdpadrtqfsknm    123
d1ft9a2       93 DIRtfeqklqtcpsmawgliailgraltscmrtiedlmfh    132


hit structure      alignment
FAST alignment (Normalized score: 3.87 Raw score:493.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARA-----------------     43
d1ft9a2        1 -------------------------------------------PPRFNIANVLLSPDGET     17

Query         44 ----TSIVRYAPGSRFSA----HTHDGGEEFIVLDGVFQD----------EHGDYPAGTY     85
d1ft9a2       18 FFRGFRSKIHAKGS----LVCTGEGDENGVFVVVDGRLR-VYLVGEEREISLFYLTSGDM     72

Query         86 VRNPPT--TSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM--------------------    123
d1ft9a2       73 FC----MHSGCLVEATERTEVRFA----------------DIRTFEQKLQTCPSMAWGLI    112

Query        124 --------------------    124
d1ft9a2      113 AILGRALTSCMRTIEDLMFH    132


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:54.12)
Query          1 -------------------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVA     41
d1ft9a2        1 PPRFNIANVLLSPDGETFF--------------R-----------------G--------     21

Query         42 RATSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQDE---------HGDYPAGTYVRNPPTT     92
d1ft9a2       22 --FRSKIHAKGSLVCTGEGDENGVFVVVDGRLRVYLVGEEREISLFYLTSGDMF-CM-HS     77

Query         93 SHVPGSAEGCTIFVKLWQ-FD------------PADRTQFSK-N---------------M    123
d1ft9a2       78 GCLVEATERTEVRFADIRTFEQKLQTCPSMAWG----LIAILGRALTSCMRTIEDLMFH-    132


hit structure      alignment
HHsearch alignment (Probability: 0.13 E-value:0.01)
DALI match       *********** ****  ************
Query         45 SIVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1ft9a2       23 RSKIHAKGSLVCTGEGDENGVFVVVDGRLR     52



top
33: d1i5za2 Catabolite gene activator protein,​ N-​terminal domain (hh: 0.924)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.41  Contact: 521
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.92 tmscore:0.95 rmsd:0.41 AHM:0.40 LBcontacta:0.96 LBcontactb:0.92 LHM:0.16
id:0.85 blosum:0.54 compass:0.65 pearson:0.97
Scaled scores:
dali:0.78 daliz:0.50 gdtts:0.49 tmscore:0.46 rmsd:0.68 AHM:0.61 LBcontacta:0.71 LBcontactb:0.78 LHM:0.34
id:0.04 blosum:0.09 compass:0.23 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:290.40)
Query          1 meinadftkpvVIDTdqlewrpspmkgverRMLDriggevaraTSIVRYAPGSR-fSAHT     59
d1i5za2        1 ---------qtDPTL-------------ewFLSH---------CHIHKYPSKSTliHQGE     29

Query         60 HDgGEEFIVLDGVFQDE----------HGDYPAGTYVRNPP-----TTSH-VPGSAEGCT    103
d1i5za2       30 KA-ETLYYIVKGSVAVLikdeegkemiLSYLNQGDFIGELGlfeegQERSaWVRAKTACE     88

Query        104 IFVKLWQ------------------------fdpadrtqfsknm    123
d1i5za2       89 VAEISYKkfrqliqvnpdilmrlsaqmarrlqvtsekvgnlafl    132


hit structure      alignment
FAST alignment (Normalized score: 3.64 Raw score:464.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR-----------ATSIVRY     49
d1i5za2        1 ------------------------------------------QTDPTLEWFLSHCHIHKY     18

Query         50 APGSRFSAHTHDG--------GEEFIVLDGVFQD-----------EHGDYPAGTYVR---     87
d1i5za2       19 PSKST--------LIHQGEKAETLYYIVKGSVA-VLIKDEEGKEMILSYLNQGDF--IGE     67

Query         88 ---NPPTT--SHVPGSAEGCTIFVKLWQFDPADRTQFSKNM-------------------    123
d1i5za2       68 LGLFEEGQERSAWVRAKTACEVAEI----------------SYKKFRQLIQVNPDILMRL    111

Query        124 ---------------------    124
d1i5za2      112 SAQMARRLQVTSEKVGNLAFL    132


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:56.69)
Query          1 ----------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYA     50
d1i5za2        1 QTDPTLEWFL--------------S-----------------H----------CHIHKYP     19

Query         51 PGSRFSAHTHDGGEEFIVLDGVFQDE----------HGDYPAGTYV-RNP-----PTTSH     94
d1i5za2       20 SKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSA     79

Query         95 VPGSAEGCTIFVKLWQ-FD------------PADRTQFSK--N---------------M    123
d1i5za2       80 WVRAKTACEVAEISYKKFRQLIQVNPDILMR-----LSAQMARRLQVTSEKVGNLAFL-    132


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.02)
DALI match       ********** ...... ************
Query         45 SIVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1i5za2       14 HIHKYPSKSTLIHQGEKAETLYYIVKGSVA     43



top
34: d1o5la1 CRP-​like transcriptional regulator TM1171,​ N-​terminal domain (svm: 1.374)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.41  Contact: 503
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.98 tmscore:0.98 rmsd:0.24 AHM:0.29 LBcontacta:0.95 LBcontactb:0.90 LHM:0.14
id:0.90 blosum:0.81 compass:0.78 pearson:0.98
Scaled scores:
dali:0.78 daliz:0.54 gdtts:0.68 tmscore:0.65 rmsd:0.80 AHM:0.66 LBcontacta:0.75 LBcontactb:0.78 LHM:0.38
id:0.06 blosum:0.16 compass:0.29 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:279.00)
Query          1 meinadftkpvvidtdqlewrpspmkgverrMLDRiggevaraTSIVRYAPGSR-FSAHT     59
d1o5la1        1 --------------------------mdlkkLLPC--------GKVIVFRKGEIvKHQDD     26

Query         60 HdgGEEFIVLDGVFQDE----------HGDYPAGTYV-RNPP----TTSH-VPGSAEGCT    103
d1o5la1       27 P-iEDVLILLEGTLKTEhvsengktleIDEIKPVQIIaSGFIfssePRFPvNVVAGENSK     85

Query        104 IFVKLWQ------------------------fdpadrtqfsknm    123
d1o5la1       86 ILSIPKEvfldllmkdrelllfflkdvsehfrvvseklfflttk    129


hit structure      alignment
FAST alignment (Normalized score: 3.30 Raw score:415.50)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR--------ATSIVRYAPG     52
d1o5la1        1 ------------------------------------------MDLKKLLPCGKVIVFRKG     18

Query         53 SRFSAHTHDG--------GEEFIVLDGVFQD-----------EHGDYPAGTYVRNPPTT-     92
d1o5la1       19 EI--------VKHQDDPIEDVLILLEGTLK-TEHVSENGKTLEIDEIKPVQI-------I     62

Query         93 ------------SHVPGSAEGCTIFVKLWQFDPADRTQFSKNM-----------------    123
d1o5la1       63 ASGFIFSSEPRFPVNVVAGENSKILSI----------------PKEVFLDLLMKDRELLL    106

Query        124 -----------------------    124
d1o5la1      107 FFLKDVSEHFRVVSEKLFFLTTK    129


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:55.05)
Query          1 ------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSR     54
d1o5la1        1 MDLKKL--------------L-----------------PC---------GKVIVFRKGEI     20

Query         55 FSAHTHDGGEEFIVLDGVFQDE----------HGDYPAGTYV-R-NP----PTTSHVPGS     98
d1o5la1       21 VKHQDDPIEDVLILLEGTLKTEHVSENGKTLEIDEIKPVQIIASGFIFSSEPRFPVNVVA     80

Query         99 AEGCTIFVKLWQF--D-------------PADRT-QFSK---------------NM    123
d1o5la1       81 GENSKILSIP-KEVFLDLLMKDRELLLFF----LKDVSEHFRVVSEKLFFLTTK--    129


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.01)
DALI match       ***********......  ************
Query         44 TSIVRYAPGSRFSAHTHDGGEEFIVLDGVFQ     74
d1o5la1       10 GKVIVFRKGEIVKHQDDPIEDVLILLEGTLK     40



top
35: d1oi6a_ dTDP-​4-​keto-​6-​deoxy-​glucose-​5-​epimerase EvaD (hh: 0.964)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.56  Contact: 676
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.98 tmscore:0.99 rmsd:0.32 AHM:0.37 LBcontacta:0.97 LBcontactb:0.93 LHM:0.35
id:0.97 blosum:0.46 compass:0.46 pearson:0.97
Scaled scores:
dali:0.78 daliz:0.51 gdtts:0.64 tmscore:0.67 rmsd:0.77 AHM:0.66 LBcontacta:0.72 LBcontactb:0.77 LHM:0.18
id:0.08 blosum:0.09 compass:0.17 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:343.40)
Query          1 -----meinadftkpvvidtdqlewrpspmkgverrmldriggeVARATSIVRYAPGSRF     55
d1oi6a_        1 mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfRVAQTIHSMSKRGVVR     60

Query         56 SAHT----hDGGEEFIVLDGVFQDE---------------HGDYPA--GTYVRNPPTTSH     94
d1oi6a_       61 GIHYtvtppGTAKYVYCARGKAMDIvidirvgsptfgqwdSVLMDQqdPRAVYLPVGVGH    120

Query         95 VPGSAEG-CTIFVKLWQ-------------------------------------------    110
d1oi6a_      121 AFVALEDdTVMSYMLSRsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq    180

Query        111 ------------fDPADrtqfsknm    123
d1oi6a_      181 rqgllpdyttsqeIERR---ltavp    202


hit structure      alignment
FAST alignment (Normalized score: 3.36 Raw score:529.50)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEV--------------------     40
d1oi6a_        1 ----------------------------------------MQARKLAVDGAIEFTPRVFA     20

Query         41 -------------------------ARATSIVRYAPGSRFSAHTH----DGGEEFIVLDG     71
d1oi6a_       21 DDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARG     80

Query         72 VFQDE-----------------HGDYPA--GTYVRNPPTTSHVPGSAE-GCTIFVKLWQF    111
d1oi6a_       81 KAM--DIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYML---    135

Query        112 DPADRTQFSKNM------------------------------------------------    123
d1oi6a_      136 ------------SRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQG    183

Query        124 -------------------    124
d1oi6a_      184 LLPDYTTSQEIERRLTAVP    202


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:59.59)
Query          1 ---------------------------------------------MEINADFTKPVVIDT     15
d1oi6a_        1 MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFR---------------     45

Query         16 DQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTH----DGGEEFIVLDG     71
d1oi6a_       46 -------------------------VAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARG     80

Query         72 VFQDE---------------HGDYPA--GTYVRNPPTTSHVPGSAEG-CTIFVKLWQ---    110
d1oi6a_       81 KAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVMSYMLSRSYV    140

Query        111 ----------------------------------------------------FDPAD---    115
d1oi6a_      141 TQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQ-EIERRLT    199

Query        116 ---RTQFSKNM    123
d1oi6a_      200 AVP--------    202


hit structure      alignment
HHsearch alignment (Probability: 0.33 E-value:0.00)
DALI match                                                            *******
Query         18 LEWRPSPMKGVERRMLDRIGGEVARATSIVR----------------------YAPGSRF     55
d1oi6a_        1 MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVR     60

DALI match       **** ...    *************                         **********
Query         56 SAHTHDGG----EEFIVLDGVFQDEHGDYPAGT-----------------YVRNPPTTSH     94
d1oi6a_       61 GIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGH    120

DALI match       ****  ............            
Query         95 VPGS--AEGCTIFVKLWQFDPADRTQFSKN    122
d1oi6a_      121 AFVALEDDTVMSYMLSRSYVTQDELALSAL    150



hit structures. 
top
36: d1ktba1 Melibiase (cs: 3.094)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.53  Contact: 524
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.95 tmscore:0.97 rmsd:0.38 AHM:0.44 LBcontacta:0.95 LBcontactb:0.92 LHM:0.17
id:0.97 blosum:0.53 compass:0.43 pearson:0.88
Scaled scores:
dali:0.75 daliz:0.47 gdtts:0.56 tmscore:0.57 rmsd:0.75 AHM:0.63 LBcontacta:0.69 LBcontactb:0.75 LHM:0.30
id:0.07 blosum:0.12 compass:0.10 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:300.80)
Query          1 meinadftkpvvidtdQLEWRPSP----mKGVERRMLDRiggevarATSIVRYAP-----     51
d1ktba1        1 ---------------lGIQGRRIIkegshIEVFLRPLSQ-------AASALVFFSrrtdm     38

Query         52 gSRFSAH------thDGGEEFIVLDgvfqdehgdypAGTYV-RNPPtTSHV-PGSA--EG    101
d1ktba1       39 pFRYTTSlaklgfpmGAAYEVQDVY-----------SGKIIsGLKT-GDNFtVIINpsGV     86

Query        102 CTIFVKLWQfdpadrtqfsknm    123
d1ktba1       87 VMWYLCPKA-------------     95


hit structure      alignment
FAST alignment (Normalized score: 3.89 Raw score:420.20)
Query          1 MEINADFTKPVVIDTD-QLEWRPSPM-------KGVERRMLDRIGGEVAR--ATSIVRYA     50
d1ktba1        1 ----------------LGIQGRR---IIKEGSHIEVFLRPL---------SQAASALVF-     31

Query         51 PGSRF----------SAHTH--------DGGEEFIVLDGVFQDEHGDYPAGTYV-RNPPT     91
d1ktba1       32 -----FSRRTDMPFRYTTS-LAKLGFPMGAAYEVQDV-----------YSGKIISGLKTG     74

Query         92 TSHVPGSA---EGCTIFVKLWQFDPADRTQFSKNM---    123
d1ktba1       75 DNFTVII-NPSGVVMWYLC----------------PKA     95


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:56.47)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK-----GVERRMLDRIGGEVARATSIVRYAP----     51
d1ktba1        1 ---L--------G----IQGRRI-IKEGSHIEVFLRPLSQ-------AASALVFFSRRTD     37

Query         52 --GSRFSAHT-----HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAE---G    101
d1ktba1       38 MPFRYTTSLAKLGFPMGAAYEVQDVY-----------SGKIISGLKTGDNFTVIINPSGV     86

Query        102 CTIFVKLWQFDPADRTQFSKNM    123
d1ktba1       87 VMWYLC--PKA-----------     95


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.28)
DALI match       ........
Query         99 AEGCTIFV    106
d1ktba1       83 PSGVVMWY     90



top
37: d1nxma_ dTDP-​4-​dehydrorhamnose 3,​5-​epimerase RmlC (hh: 0.964)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.55  Contact: 661
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.98 tmscore:0.98 rmsd:0.32 AHM:0.54 LBcontacta:0.96 LBcontactb:0.91 LHM:0.31
id:0.91 blosum:0.46 compass:0.53 pearson:0.98
Scaled scores:
dali:0.78 daliz:0.54 gdtts:0.64 tmscore:0.66 rmsd:0.76 AHM:0.48 LBcontacta:0.71 LBcontactb:0.75 LHM:0.22
id:0.04 blosum:0.09 compass:0.19 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:350.00)
Query          1 ---------------meinadftkpvvidtdqlewrpspmkgverrmldriGGEVARATS     45
d1nxma_        1 nffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesfFAEGKLQNN     60

Query         46 IVRYAPGSRFSAHTHDGGEEFIVLD-GVFQDE--------------HGDYPAGTYVRNPP     90
d1nxma_       61 VSFSRKNVLRGLHAEPWDKYISVADgGKVLGTwvdlregetfgntyQTVIDASKSIFVPR    120

Query         91 TTSHVPGSAE-GCTIFVKLWQ---------------------------------------    110
d1nxma_      121 GVANGFQVLSdFVAYSYLVNDywalelkpkyafvnyadpsldikwenleeaevseadenh    180

Query        111 -fdpadrtqfsknm    123
d1nxma_      181 pflkdvkplrkedl    194


hit structure      alignment
FAST alignment (Normalized score: 3.65 Raw score:563.10)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEV--------------------     40
d1nxma_        1 ----------------------------------------NFFGKTLAARPVEAIPGMLE     20

Query         41 -----------------------------------ARATSIVRYAPGSRFSAHTHDGGEE     65
d1nxma_       21 FDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKY     80

Query         66 FIVL-DGVFQDE----------------HGDYPAGTYVRNPPTTSHVPGS-AEGCTIFVK    107
d1nxma_       81 ISVADGGKVL--GTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYL    138

Query        108 LWQFDPADRTQFSKNM--------------------------------------------    123
d1nxma_      139 V---------------NDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFL    183

Query        124 -----------    124
d1nxma_      184 KDVKPLRKEDL    194


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:58.28)
Query          1 -------------------------------------------------------MEINA      5
d1nxma_        1 NFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEG-----     55

Query          6 DFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTHDGGEE     65
d1nxma_       56 -----------------------------------KLQNNVSFSRKNVLRGLHAEPWDKY     80

Query         66 FIVLD-GVFQDE--------------HGDYPAGTYVRNPPTTSHVPGSAE-GCTIFVKLW    109
d1nxma_       81 ISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLV-    139

Query        110 QF-----------------------------------------------------DPADR    116
d1nxma_      140 NDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL-----    194

Query        117 TQFSKNM    123
d1nxma_      195 -------    195


hit structure      alignment
HHsearch alignment (Probability: 0.29 E-value:0.00)
DALI match                                                             ******
Query         21 RPS-PMKGVERRMLDRIGGEVARATSIVR-------------------------YAPGSR     54
d1nxma_       10 RPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVL     69

DALI match       **************** ******                      ***************
Query         55 FSAHTHDGGEEFIVLD-GVFQDEHGDYPAGT--------------YVRNPPTTSHVPGSA     99
d1nxma_       70 RGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVL    129

DALI match       *......
Query        100 EGCTIFV    106
d1nxma_      130 SDFVAYS    136



top
38: d1r46a1 Melibiase (cs: 2.956)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.21  Contact: 554
Modified z-scores:
dali:0.98 daliz:0.96 gdtts:0.94 tmscore:0.96 rmsd:0.39 AHM:0.48 LBcontacta:0.94 LBcontactb:0.92 LHM:0.24
id:0.87 blosum:0.09 compass:0.47 pearson:0.85
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.53 tmscore:0.54 rmsd:0.75 AHM:0.62 LBcontacta:0.65 LBcontactb:0.72 LHM:0.20
id:0.03 blosum:0.02 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:315.60)
Query          1 meinadftkpvvidtdQLEWRPSPM---kGVERRMLDRiggevarATSIVRYAPG-----     52
d1r46a1        1 ---------------lGKQGYQLRQgdnfEVWERPLSG-------LAWAVAMINRqeigg     38

Query         53 -sRFSAH--------thDGGEEFIVLDGvfqdehgdyPAGTYVRNPPTTSHVPGSA--EG    101
d1r46a1       39 prSYTIAvaslgkgvacNPACFITQLLP---------VKRKLGFYEWTSRLRSHINptGT     89

Query        102 CTIFVKLWQfdpadrtqfsknm    123
d1r46a1       90 VLLQLENTM-------------     98


hit structure      alignment
FAST alignment (Normalized score: 2.59 Raw score:284.80)
Query          1 MEINADFTKPVVIDTDQLEWRPSP----------MKGVERRMLDRIGGEV--ARATSIVR     48
d1r46a1        1 ------------------------LGKQGYQLRQGDNFEVWERPL-----SGLAWAVAMI     31

Query         49 YAPGSRF---------SAHTHD-----------GGEEFIVLDGVFQDEHGDYP-AGTY-V     86
d1r46a1       32 N------RQEIGGPRSYTIA--VASLGKGVACNPACFITQLL-----------PVKRKLG     72

Query         87 RNPPTTSHVPGSAE---GCTIFVKLWQFDPADRTQFSKNM-----    123
d1r46a1       73 FYEWTSRLRSH---INPTGTVLLQ----------------LENTM     98


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:52.17)
Query          1 MEINADFTKPV-VIDTDQLEWRPSPMK--GVERRMLDRIGGEVARATSIVRYA------P     51
d1r46a1        1 ---L------GK------Q-GYQLRQGDNFEVWERPLSG-----LAWAVAMINRQEIGGP     39

Query         52 GSRFSAHT-------HDGGE-EFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAE--G    101
d1r46a1       40 RSYTIAVASLGKGVACNPACFITQLLP-----------VKRKLGFYEWTSRLRSHINPTG     88

Query        102 CTIFVKLWQFDPADRTQFSKNM    123
d1r46a1       89 TVLLQLE-NTM-----------     98


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.12)
DALI match                        
Query        106 VKLWQFDPADRTQFSKN    122
d1r46a1       69 RKLGFYEWTSRLRSHIN     85



top
39: d1ep0a_ dTDP-​4-​dehydrorhamnose 3,​5-​epimerase RmlC (hh: 0.964)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.55  Contact: 655
Modified z-scores:
dali:0.99 daliz:0.99 gdtts:0.98 tmscore:0.98 rmsd:0.32 AHM:0.38 LBcontacta:0.96 LBcontactb:0.92 LHM:0.27
id:0.98 blosum:0.58 compass:0.48 pearson:0.96
Scaled scores:
dali:0.78 daliz:0.54 gdtts:0.65 tmscore:0.67 rmsd:0.75 AHM:0.59 LBcontacta:0.75 LBcontactb:0.77 LHM:0.27
id:0.09 blosum:0.12 compass:0.16 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:339.00)
Query          1 ----meinadftkpvvidtdqlewrpspmkgverrmldriggeVARATSIVRYAPGSRFS     56
d1ep0a_        1 efrfiktsldgaiiiepevytdergyfmetfneaifqenglevRFVQDNESMSVRGVLRG     60

Query         57 AHT---hDGGEEFIVLDGVFQDE---------------HGDYPA--GTYVRNPPTTSHVP     96
d1ep0a_       61 LHFqrekPQGKLVRVIRGEIFDVavdlrknsdtygewtGVRLSDenRREFFIPEGFAHGF    120

Query         97 GSAE-GCTIFVKLWQ-----------------------------------fdpadrtqfs    120
d1ep0a_      121 LALSdECIVNYKCTElyhpeydsgipwddpdigidwplemvddliisekdrnwkplrenp    180

Query        121 knm    123
d1ep0a_      181 vyl    183


hit structure      alignment
FAST alignment (Normalized score: 3.53 Raw score:529.80)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEV--------------------     40
d1ep0a_        1 ----------------------------------------EFRFIKTSLDGAIIIEPEVY     20

Query         41 ------------------------ARATSIVRYAPGSRFSAHTH-----DGGEEFIVLDG     71
d1ep0a_       21 TDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLH--FQREKPQGKLVRVIRG     78

Query         72 VFQDE-----------------HGDYP---AGTYVRNPPTTSHVPGS-AEGCTIFVKLWQ    110
d1ep0a_       79 EIF--DVAVDLRKNSDTYGEWTGVRL-SDENRREFFIPEGFAHGFLALSDECIVNYKC--    133

Query        111 FDPADRTQFSKNM-----------------------------------------------    123
d1ep0a_      134 -------------TELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENP    180

Query        124 ---    124
d1ep0a_      181 VYL    183


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:57.57)
Query          1 ---------------------------------------------MEINADFTKPVVIDT     15
d1ep0a_        1 EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRF---------------     45

Query         16 DQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTH---DGGEEFIVLDGV     72
d1ep0a_       46 --------------------------VQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGE     79

Query         73 FQDE---------------HGDYPA--GTYVRNPPTTSHVPGSAE-GCTIFVKLWQF---    111
d1ep0a_       80 IFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHP    139

Query        112 --------------------------------------------DPADRTQFSKNM    123
d1ep0a_      140 EYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL------------    183


hit structure      alignment
HHsearch alignment (Probability: 0.69 E-value:0.00)
DALI match                                                           ********
Query         17 QLEWRPSPMKGVERRMLDRIGGEVARATSIVR--------------------YAPGSRFS     56
d1ep0a_        1 EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRG     60

DALI match       **   . ****************                         ************
Query         57 AH---THDGGEEFIVLDGVFQDEHGDYPAGT-----------------YVRNPPTTSHVP     96
d1ep0a_       61 LHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGF    120

DALI match       **  ............            
Query         97 GS--AEGCTIFVKLWQFDPADRTQFSKN    122
d1ep0a_      121 LALSDECIVNYKCTELYHPEYDSGIPWD    148



top
40: d1uasa1 Melibiase (cs: 2.792)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.60  Contact: 486
Modified z-scores:
dali:0.97 daliz:0.95 gdtts:0.96 tmscore:0.97 rmsd:0.40 AHM:0.53 LBcontacta:0.93 LBcontactb:0.90 LHM:0.21
id:0.81 blosum:0.10 compass:0.29 pearson:0.91
Scaled scores:
dali:0.75 daliz:0.46 gdtts:0.62 tmscore:0.59 rmsd:0.72 AHM:0.55 LBcontacta:0.66 LBcontactb:0.74 LHM:0.26
id:0.02 blosum:-0.00 compass:0.11 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:265.70)
Query          1 meinadftkpvvidtdQLEWRPSPM---KGVERRMLDRiggevarATSIVRYA------P     51
d1uasa1        1 ---------------lGVQGKKVQSdngLEVWAGPLSN-------NRKAVVLWnrqsyqA     38

Query         52 GSR----fsahTHDGGEEFIVLDgvfqdehgdypAGTYVRNppttsHVPGSAE----GCT    103
d1uasa1       39 TITahwsniglAGSVAVTARDLW-----------AHSSFAA----qGQISASVaphdCKM     83

Query        104 IFVKLWqfdpadrtqfsknm    123
d1uasa1       84 YVLTPN--------------     89


hit structure      alignment
FAST alignment (Normalized score: 3.49 Raw score:365.20)
Query          1 MEINADFTKPVVIDTD-QLEWRPSPMK-------GVERRMLDRIGGEVAR--ATSIVRYA     50
d1uasa1        1 ----------------LGVQGKK----VQSDNGLEVWAGPL---------SNNRKAVVL-     30

Query         51 P--------GSRFSAHT--------HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTS-     93
d1uasa1       31 -WNRQSYQATITA----HWSNIGLAGSVAVTARDL-----------WAHSSFAA-----Q     69

Query         94 HVPGSA-----EGCTIFVKLWQFDPADRTQFSKNM-    123
d1uasa1       70 GQISA-SVAPHDCKMYVLTP---------------N     89


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:52.97)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK----GVERRMLDRIGGEVARATSIVRYAP-----     51
d1uasa1        1 ---L--------G----VQGKKV-QSDNGLEVWAGPLSN-------NRKAVVLWNRQSYQ     37

Query         52 GSRFSAH------THDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAE---GC    102
d1uasa1       38 ATITAHWSNIGLA-GSVAVTARDLW-----------AHSSFAA---QGQISASVAPHDCK     82

Query        103 TIFVKLWQFDPADRTQFSKNM    123
d1uasa1       83 MYVLT--PN------------     89


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.16)
DALI match                   
Query         41 ARATSIVRYAPG     52
d1uasa1       78 PHDCKMYVLTPN     89



hit structures. 
top
41: d1bvp12 BTV vp7,​ central (top) domain (cs: 2.679)

SCOP Superfamily: Viral protein domain  |  SCOP Fold: Viral protein domain  |  SCOP Class: All beta proteins

Consensus: 0.50  Contact: 733
Modified z-scores:
dali:0.97 daliz:0.92 gdtts:0.95 tmscore:0.98 rmsd:0.49 AHM:0.61 LBcontacta:0.95 LBcontactb:0.94 LHM:0.23
id:0.86 blosum:0.15 compass:0.40 pearson:0.90
Scaled scores:
dali:0.69 daliz:0.32 gdtts:0.44 tmscore:0.49 rmsd:0.68 AHM:0.53 LBcontacta:0.57 LBcontactb:0.67 LHM:0.22
id:0.01 blosum:0.06 compass:0.04 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:305.60)
Query          1 ---------MEINadftkpvvIDTDqleWRPSPmKGVERRMLDRiggevarATSIVRYAP     51
d1bvp12        1 parqpygffLETE--------ETFQpgrWFMRAaQAVTAVVCGP-------DMIQVSLNA     45

Query         52 GSRFSAH--------thDGGEEFIVLD-------------GVFQDEhgdypagTYVRNPP     90
d1bvp12       46 GARGDVQqifqgrndpmMIYLVWRRIEnfamaqgnsqqtqAGVTVSvggvdmrAGRIIAW    105

Query         91 TT--SHVPGSAE--GCTIFVKLWQFDPadrtqfsknm    123
d1bvp12      106 DGqaALHVHNPTqqNAMVQIQVVFYIS--------md    134


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:342.70)
Query          1 MEINADFTK------------PVVIDTDQLEWRPSPM--------KGVERRMLDRIGGEV     40
d1bvp12        1 ---------PARQPYGFFLETEETFQP----------GRWFMRAAQAVTAVVC-------     34

Query         41 AR--ATSIVRYAPGSRFSAHTHD--------------GGEEFIVLD--------------     70
d1bvp12       35 --GPDMIQVSLNAGARG------DVQQIFQGRNDPMMIYLVWRR--IENFAMAQGNSQQT     84

Query         71 ---GVFQDEHGDYPAGTYVRNPPTTS------HVPGSA---EGCTIFVKLWQFDPADRTQ    118
d1bvp12       85 QAGVTVSVGGVDMRAGRIIA------WDGQAALHVHN-PTQQNAMVQIQ-----------    126

Query        119 FSKNM--------    123
d1bvp12      127 -----VVFYISMD    134


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:58.26)
Query          1 -----------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRY     49
d1bvp12        1 PARQPYGFFLETEET--------FQPG-RWFMRA-AQAVTAVVCGP-------DMIQVSL     43

Query         50 APGSRFSAHT-H-------DGGEEFIVL------------DG-VFQ-D--EHGDYPAGTY     85
d1bvp12       44 NAGARGDVQQIFQGRNDPMMIYLVWRRIENFAMAQGNSQQTQAGVTVSVGGVDMR---AG    100

Query         86 VRNPPTT-SH-VPGSAE--GCTIFVKLWQFDPA--DRTQFSKNM    123
d1bvp12      101 RIIAWDGQAALHVHNPTQQNAMVQIQV-VFYISMD---------    134


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.34)
DALI match                              
Query         71 GVFQDEHGDYPAGTYVRNPPTTS     93
d1bvp12        7 GFFLETEETFQPGRWFMRAAQAV     29



top
42: d1j0ha2 Neopullulanase (cs: 2.645)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.57  Contact: 470
Modified z-scores:
dali:0.97 daliz:0.95 gdtts:0.97 tmscore:0.98 rmsd:0.35 AHM:0.40 LBcontacta:0.93 LBcontactb:0.89 LHM:0.19
id:0.87 blosum:0.34 compass:0.48 pearson:0.81
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.65 tmscore:0.62 rmsd:0.76 AHM:0.62 LBcontacta:0.66 LBcontactb:0.70 LHM:0.25
id:0.04 blosum:0.08 compass:0.06 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:263.80)
Query          1 meinadftkpvvidtdqLEWRPSPM-----KGVERRMLDRiggevaraTSIVRYAP----     51
d1j0ha2        1 -----------------GEISFLHAddemnYLIYKKTDGD--------ETVLVIINrsdq     35

Query         52 -GSRFsaHTHDgGEEFIVLDgvfqdehgdypAGTYVRNpptTSHVPGSA---EGCTIFVK    107
d1j0ha2       36 kADIPipLDAR-GTWLVNLL-----------TGERFAA--eAETLCTSLppyGFVLYAIE     81

Query        108 LWqfdpadrtqfsknm    123
d1j0ha2       82 HW--------------     83


hit structure      alignment
FAST alignment (Normalized score: 3.76 Raw score:380.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM-------KGVERRMLDRIGGEVAR-ATSIVRYAP-     51
d1j0ha2        1 -----------------GEISFL--HADDEMNYLIYKKTD---------GDETVLVI--I     30

Query         52 -----GSRFS--AHTHDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPT--TSHVPGSA--E    100
d1j0ha2       31 NRSDQKADI-PIPLDAR-GTWLVNL-----------LTGERFAA---EAETLCTSLPPYG     74

Query        101 GCTIFVKLWQFDPADRTQFSKNM-    123
d1j0ha2       75 FVLYAIEH---------------W     83


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:48.71)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM--K--GVERRMLDR-IGGEVARATSIVRYAP---G     52
d1j0ha2        1 ------------G----EI-SFLHADDEMNYLIYKKTDGD-------ETVLVIINRSDQK     36

Query         53 SRFSAH-THDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTS--HVPGSAE-GCTIFVKL    108
d1j0ha2       37 ADIPIPLDA-RGTWLVNLL-----------TGERFAA---EAETLCTSLPPYGFVLYAIE     81

Query        109 WQFDPADRTQFSKNM    123
d1j0ha2       82 -HW------------     83


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.28)
DALI match                                           
Query         83 GTYVRNPPTTSHVP----GSAEGCTIFVKLWQFDPA    114
d1j0ha2        1 GEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQK     36



top
43: d1omia1 Listeriolysin regulatory protein PrfA,​ N-​terminal domain (svm: 1.388)

SCOP Superfamily: cAMP-​binding domain-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.37  Contact: 524
Modified z-scores:
dali:0.97 daliz:0.97 gdtts:0.96 tmscore:0.97 rmsd:0.25 AHM:0.28 LBcontacta:0.91 LBcontactb:0.87 LHM:0.14
id:0.86 blosum:0.72 compass:0.67 pearson:0.93
Scaled scores:
dali:0.77 daliz:0.51 gdtts:0.63 tmscore:0.63 rmsd:0.81 AHM:0.72 LBcontacta:0.65 LBcontactb:0.72 LHM:0.42
id:0.05 blosum:0.13 compass:0.07 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:274.20)
Query          1 meinadftkpvvidtdqlewrpspmkgverrMLDRiggevaraTSIVRYAPGSR--fsAH     58
d1omia1        1 ------------------------gsefkkyLETN-------gIKPKQFHKKELifnqWD     29

Query         59 THdgGEEFIVLDGVFQDE----------HGDYPAGTYVRNP----PTTS--HVPGSAE-G    101
d1omia1       30 PQ--EYCIFLYDGITKLTsisengtimnLQYYKGAFVIMSGfidtETSVgyYNLEVISeQ     87

Query        102 CTIFVKL-WQFD-----------------------padrtqfsknm    123
d1omia1       88 ATAYVIKiNELKellsknlthffyvfqtlqkqvsyslakfndfsin    133


hit structure      alignment
FAST alignment (Normalized score: 3.55 Raw score:454.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR-----------ATSIVRY     49
d1omia1        1 ------------------------------------------GSEFKKYLETNGIKPKQF     18

Query         50 APGSRFSAHT------HDGGEEFIVLDGVFQD-----------EHGDYPAGTYVRNPP--     90
d1omia1       19 HKKE------LIFNQWDPQEYCIFLYDGITK-LTSISENGTIMNLQYYKGAFVIMS--GF     69

Query         91 ------TTSHVPGS-AEGCTIFVKLWQFDPADRTQFSKNM--------------------    123
d1omia1       70 IDTETSVGYYNLEVISEQATAYV-----------------IKINELKELLSKNLTHFFYV    112

Query        124 ---------------------    124
d1omia1      113 FQTLQKQVSYSLAKFNDFSIN    133


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:41.23)
Query          1 --------------MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARAT-S     45
d1omia1        1 GSEFKKYLETNGIK--------------------------------------PKQFHKKE     22

Query         46 I-VRYAPGSRFSAHTHDGGEEFIVLDG----VFQDEHGDYPAGTYVRNPPTTSHVPG---     97
d1omia1       23 LIFNQWD-PQEYCIFLYDGITKLTSISENGT---------IMNLQYYKGA-FVIMSGFID     71

Query         98 ---SAEGCTIFVK--LWQ-----------------------------FDPADRTQ--FS-    120
d1omia1       72 TETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQK-------QVSYSL    124

Query        121 -KN------M    123
d1omia1      125 AKFNDFSIN-    133


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.66)
DALI match                  
Query         66 FIVLDGVFQDE     76
d1omia1       63 FVIMSGFIDTE     73



top
44: d1pmia_ Phosphomannose isomerase (hh: 0.970)

SCOP Superfamily: RmlC-​like cupins  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.52  Contact: 878
Modified z-scores:
dali:0.99 daliz:0.98 gdtts:0.96 tmscore:0.98 rmsd:0.45 AHM:0.55 LBcontacta:0.97 LBcontactb:0.97 LHM:0.27
id:0.94 blosum:0.28 compass:0.36 pearson:0.98
Scaled scores:
dali:0.72 daliz:0.40 gdtts:0.45 tmscore:0.50 rmsd:0.66 AHM:0.52 LBcontacta:0.60 LBcontactb:0.71 LHM:0.21
id:0.04 blosum:0.08 compass:0.18 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 5.6 Raw score:447.10)
Query          1 ------------------------------------------------------------      1
d1pmia_        1 sseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpyaelwmgthpsvpska     60

Query          1 ------------------------------------------------------------      1
d1pmia_       61 idlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiekvlsiqahpdkklgaq    120

Query          1 ---------------MEIN-----------------------------------------      4
d1pmia_      121 lhaadpknypddnhkPEMAiavtdfegfcgfkpldqlaktlatvpelneiigqelvdefi    180

Query          5 ------------------------------------------------------------      5
d1pmia_      181 sgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtakllertdrepqvfkdidsr    240

Query          5 ----------------------adftkPVVIDTD--------------------------     16
d1pmia_      241 lpeliqrlnkqfpndiglfcgclllnhVGLNKGEamflqakdphayisgdiiecmaasdn    300

Query         17 ------------------------------qlEWRPSP--MKGV-ERRMLdRIGGeVARA     43
d1pmia_      301 vvragftpkfkdvknlvemltysyesvekqkmPLQEFPrsKGDAvKSVLY-DPPI-AEFS    358

Query         44 TSIVRYAP--GSRFSAHTHDGGEEFIVLDGVFQDE-------HGDYPAGTYVRNPPTTSH     94
d1pmia_      359 VLQTIFDKskGGKQVIEGLNGPSIVIATNGKGTIQitgddstKQKIDTGYVFFVAPGSSI    418

Query         95 VPGSAE-----GCTIFVKLWQfdpadrtqfsknm    123
d1pmia_      419 ELTADSanqdqDFTTYRAFVE------------a    440


hit structure      alignment
FAST alignment (Normalized score: 3.03 Raw score:704.90)
Query          1 MEINADF--TKPVVIDTDQLEWRPSPMKGV------------------------------     28
d1pmia_        1 -------SSEKLFRI---QCGYQNY-----DWGKIGSSSAVAQFVHNSDPSITIDETKPY     45

Query         29 ERRMLDRIGGEVA---------------------------------------------RA     43
d1pmia_       46 AELWM--------GTHPSVPSKAIDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFL     97

Query         44 TSIVRYAPGSRFSAHTHD----------------------GGEEFIVLDGVFQDE-----     76
d1pmia_       98 FKVLSI--EKVLSIQAH-PDKKLGAQLHAADPKNYPDDNHKPEMAIAV-TDFEG-FCGFK    152

Query         77 ------------------------------------------------------------     77
d1pmia_      153 PLDQLAKTLATVPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTD    212

Query         77 ------------------------------------------------------HGDYPA     82
d1pmia_      213 DDVIKQQTAKLLERTDREPQVFKDIDSRLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNK    272

Query         83 GTYVRNPPTTSHVPGSAE-GCTIFVKLWQFDPADRTQFSKNM------------------    123
d1pmia_      273 GEAMFLQAKDPHAY----ISGDIIECMA--------------ASDNVVRAGFTPKFKDVK    314

Query        124 ------------------------------------------------------------    124
d1pmia_      315 NLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVI    374

Query        124 ------------------------------------------------------------    124
d1pmia_      375 EGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTTY    434

Query        124 ------    124
d1pmia_      435 RAFVEA    440


hit structure      alignment
TMalign alignment (TM-score: 0.58 Raw score:70.91)
Query          1 ------------------------------------------------------------      1
d1pmia_        1 SSEKLFRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKA     60

Query          1 -----------------------------------------------------MEINAD-      6
d1pmia_       61 IDLNNQTLRDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHP-----DK    115

Query          7 -----------------FTKPVVIDT--D-------------------------------     16
d1pmia_      116 KLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLATVPELNEIIGQEL    175

Query         17 ------------------------------------------------------------     17
d1pmia_      176 VDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFK    235

Query         17 ----------------------------------Q---L---------------------     18
d1pmia_      236 DIDSRLPELIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECM    295

Query         19 -----------------------------------E-WRPSP---M--KGVERRMLDRIG     37
d1pmia_      296 AASDNVVRAGFTPKFKDVKNLVEMLTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIA    355

Query         38 GEVARATSIVRYAP---GSRFSAHTHDGGEEFIVLDGVFQDE-------HGDYPAGTYVR     87
d1pmia_      356 ---EFSVL-QTIFDKSKGGKQVIEGLNGPSIVIATNGKGTIQITGDDSTKQKIDTGYVFF    411

Query         88 NPPTTSHVPGSA---E--GCTIFVKLWQFDPADRTQFSKNM    123
d1pmia_      412 VAPGSSIELTADSANQDQDFTTYRAFVE--A----------    440


hit structure      alignment
HHsearch alignment (Probability: 0.12 E-value:0.10)
DALI match                       ..........*****..... ............***********
Query          3 INADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTHDG     62
d1pmia_      320 LTYSYESVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEGLNG    379

DALI match       **************        ***********************     ******
Query         63 GEEFIVLDGVFQDEH-------GDYPAGTYVRNPPTTSHVPGSAE-----GCTIFV    106
d1pmia_      380 PSIVIATNGKGTIQITGDDSTKQKIDTGYVFFVAPGSSIELTADSANQDQDFTTYR    435



top
45: d1ahsa_ RDV p8,​ central (top) domain (cs: 2.564)

SCOP Superfamily: Viral protein domain  |  SCOP Fold: Viral protein domain  |  SCOP Class: All beta proteins

Consensus: 0.32  Contact: 642
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.95 tmscore:0.97 rmsd:0.44 AHM:0.48 LBcontacta:0.95 LBcontactb:0.93 LHM:0.21
id:0.87 blosum:0.07 compass:0.45 pearson:0.87
Scaled scores:
dali:0.72 daliz:0.37 gdtts:0.50 tmscore:0.50 rmsd:0.70 AHM:0.61 LBcontacta:0.62 LBcontactb:0.71 LHM:0.31
id:0.02 blosum:0.01 compass:0.04 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:283.60)
Query          1 ----MEINadftkpvvidtdqlewrPSPMKGVERRMLDRiggevarATSIVRYAPGSRFS     56
d1ahsa_        1 tgpyAGAV---------evqqsgryYVPQGRTRGGYINS-------NIAEVCMDAGAAGQ     44

Query         57 AH---------thDGGEEFIVLD-------------GVFQDEhgdypagtYVRNPPTT--     92
d1ahsa_       45 VNallaprrgdavMIYFVWRPLRifcdpqgaslesaPGTFVTvdgvnvaaGDVVAWNTia    104

Query         93 SHVPGSAE--GCTIFVKLwQFDPadrtqfsknm    123
d1ahsa_      105 PVNVGNPGarRSILQFEV-LWYT----------    126


hit structure      alignment
FAST alignment (Normalized score: 2.77 Raw score:344.90)
Query          1 MEINADFTKPV---------VIDTDQLEWRPSP------MKGVERRMLDRIGGEVAR--A     43
d1ahsa_        1 -----------TGPYAGAVEVQQS---------GRYYVPQGRTRGGYI---------NSN     31

Query         44 TSIVRYAPGSRFSAHTH------------DGGEEFIVLD---------------------     70
d1ahsa_       32 IAEVCMDAGAAG-----QVNALLAPRRGDAVMI------YFVWRPLRIFCDPQGASLESA     80

Query         71 GVFQDE----HGDYPAGTYVRNPPTTSHVPGS--AEGCTIFVKLWQFDPADRTQFSKNM-    123
d1ahsa_       81 PGTF--VTVDGVNVAAGDVVAWNTIAPVNVGNPGARRSILQFE----------------V    122

Query        124 ----    124
d1ahsa_      123 LWYT    126


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:56.34)
Query          1 -------MEI-NADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYA--     50
d1ahsa_        1 TGPYAGAVEVQ----------QSG--RYYVPQGRTRGGYINS---------NIAEVCMDA     39

Query         51 PGSRFSAH-TH--D--G-GEEFIVLD-----------------GVFQDEHGDYPAGTYVR     87
d1ahsa_       40 GAAGQVNALLAPRRGDAVMIYFVWRPLRIFCDPQGASLESAPGTFVTVDGVNVAAGDVVA     99

Query         88 NPPTTSHVPGSAE----GCTIFVKLWQFDPADRTQFSKNM    123
d1ahsa_      100 WNT-IAPVNVGNPGARRSILQFEVL-WYT-----------    126


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.37)
DALI match       .....      . ........*
Query         72 VFQDEHGDYPAGTYVRNPPTTS     93
d1ahsa_       84 FVTVDGVNVAAGDVVAWNTIAP    105



hit structures. 
top
46: d1szna1 Melibiase (cs: 2.413)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.50  Contact: 493
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.96 tmscore:0.97 rmsd:0.38 AHM:0.43 LBcontacta:0.93 LBcontactb:0.90 LHM:0.21
id:0.92 blosum:0.23 compass:0.50 pearson:0.86
Scaled scores:
dali:0.75 daliz:0.42 gdtts:0.58 tmscore:0.57 rmsd:0.76 AHM:0.64 LBcontacta:0.63 LBcontactb:0.70 LHM:0.26
id:0.05 blosum:0.06 compass:0.09 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:253.60)
Query          1 meinadftkpvVIDTdqlEWRPSPM-------------KGVERRMLDriggevaraTSIV     47
d1szna1        1 -----------VYGQ---PATPYKWginpdwtfnvtypAEFWAGPSS--------kGHLV     38

Query         48 RYAP-----GSRF-----sahtHDGGEEFIVLDgvfqdehgdypAGTY-VRNPpttshvP     96
d1szna1       39 LMVNtlditATKEakwneipglSAGHYEVRDVW-----------SDKDlGCLS----syK     83

Query         97 GSA---EGCTIFVKLWQFDPadrtqfsknm    123
d1szna1       84 AAVaahDTAVILVGKKCQRW----------    103


hit structure      alignment
FAST alignment (Normalized score: 2.44 Raw score:274.60)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM---------------KGVERRMLDRIGGEVARA--     43
d1szna1        1 --------------VYGQPATPY--KWGINPDWTFNVTYPAEFWAGP-----------SS     33

Query         44 -TSIVRYAPGSRFSAHT-------------------HDGGEEFIVLDGVFQDEHGDYP--     81
d1szna1       34 KGHLVLMV---------NTLDITATKEAKWNEIPGLSAGHYEVRD-------------VW     71

Query         82 AGTYVRNPPTTSHVPGS------------AEGCTIFVKLWQFDPADRTQFSKNM-    123
d1szna1       72 SDKDL------------GCLSSYKAAVAAHDTAVILVGKKCQR-----------W    103


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:53.28)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK-------------GVERRMLD-RIGGEVARATSI     46
d1szna1        1 -----------VY---GQPATPYKWGINPDWTFNVTYPAEFWAGPSSK---------GHL     37

Query         47 VRYAP----GSRFSAHT------HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVP     96
d1szna1       38 VLMVNTLDITATKEAKWNEIPGLSAGHYEVRDVW-----------SDKDLGCL--SSY-K     83

Query         97 G-SA--EGCTIFVKLWQFDPADRTQFSKNM    123
d1szna1       84 AAVAAHDTAVILVGK-KCQRW---------    103


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.18)
DALI match              ..  *******      .  ....
Query         19 EWRPSPMKG--VERRMLDRIGGEVARATSIV     47
d1szna1       16 DWTFNVTYPAEFWAGPSSK-----GHLVLMV     41



top
47: d1dcsa_ Deacetoxycephalosporin C synthase (svm: 0.713)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.50  Contact: 683
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.35 AHM:0.32 LBcontacta:0.97 LBcontactb:0.95 LHM:0.19
id:0.88 blosum:0.14 compass:0.39 pearson:0.87
Scaled scores:
dali:0.74 daliz:0.44 gdtts:0.55 tmscore:0.60 rmsd:0.75 AHM:0.70 LBcontacta:0.62 LBcontactb:0.70 LHM:0.34
id:0.03 blosum:0.05 compass:0.09 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:369.50)
Query          1 ------------------------------------meinadftkpvviDTDQLE-----     19
d1dcsa_        1 mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdLVIDFFehgse     60

Query         20 ----------------WRPSpmkgVERRMlDRIG--------------------------     37
d1dcsa_       61 aekravtspvptmrrgFTGL----SMCYS-MGTAdnlfpsgdferiwtqyfdrqytasra    115

Query         38 --------------------gEVARATSIVRYAPgsRFSAHTHDG-GEEFIVLDG----V     72
d1dcsa_      116 varevlratgtepdggveaflDCEPLLRFRYFPQ-lRMAPHYDLSmVTLIQQTPCangfV    174

Query         73 FQDE-----HGDYPAG--tYVRNPPT-----------TSHVPG----saEGCTIFVKLWQ    110
d1dcsa_      175 SLQAevggaFTDLPYRpdaVLVFCGAiatlvtggqvkAPRHHVaapiagSSRTSSVFFLR    234

Query        111 --------------------------------fdpadrtqfsknm    123
d1dcsa_      235 pnadftfsvplarecgfdvsldgetatfqdwiggnyvnirrtska    279


hit structure      alignment
FAST alignment (Normalized score: 2.85 Raw score:528.50)
Query          1 MEINADFTKPVVI-----------------------------------------------     13
d1dcsa_        1 -------------MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSA     47

Query         14 --DTDQLEWRPSPMKG---------------------------VERRMLDRIGGE-----     39
d1dcsa_       48 KDLVID----------FFEHGSEAEKRAVTSPVPTMRRGFTGLSMCYS-------MGTAD     90

Query         40 -----------------------------------------------VARATSIVRYAPG     52
d1dcsa_       91 NLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFP--    148

Query         53 S--RFSAHTH-DGGEEFIVLD------GVFQDE-----HGDYP--AGTYVRNPP------     90
d1dcsa_      149 -QLRMAPHYDLSMVTLIQQT-PCANGFVSLQA-EVGGAFTDLPYRPDAVLVFC-GAIATL    204

Query         91 -----TTSHVPGSA------EGCTIFVKLWQFDPADRTQFSKNM----------------    123
d1dcsa_      205 VTGGQVKAPRHHV-AAPIAGSSRTSSVF----------------FLRPNADFTFSVPLAR    247

Query        124 --------------------------------    124
d1dcsa_      248 ECGFDVSLDGETATFQDWIGGNYVNIRRTSKA    279


hit structure      alignment
TMalign alignment (TM-score: 0.54 Raw score:66.36)
Query          1 ---------------------------------------------MEINADFTKPVVI--     13
d1dcsa_        1 MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELK-----------SAKD     49

Query         14 DTD-QL---------------------EWRPSPMKGVERRMLDRIG--------------     37
d1dcsa_       50 LVIDFFEHGSEAEKRAVTSPVPTMRRGFTGL-----SMCYS-MGTADNLFPSGDFERIWT    103

Query         38 -----------------------------------GEVARATSIVRYAPGSRFSAHTHDG     62
d1dcsa_      104 QYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDC---EPLLRFRYFPQLRMAPHYDLSM    160

Query         63 GEEFIVLDG----V-FQDEH----GDYPAG--TYVRNPPT-----------TSHVPGSAE    100
d1dcsa_      161 VTLIQQTPCANGFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAP    220

Query        101 ---G-CTIFVKLWQF---DP----------------------------------------    113
d1dcsa_      221 IAGSSRTSSVFFLRPNAD-FTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSKA    279

Query        114 ADRTQFSKNM    123
d1dcsa_      280 ----------    280


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.10)
DALI match       .............  *********........  ......              
Query         39 EVARATSIVRYAPGSRFSAHTHDGGEEFIVLD--GVFQDEHGDYPAGTYVRNPP     90
d1dcsa_      136 LDCEPLLRFRYFPQLRMAPHYDLSMVTLIQQTPCANGFVSLQAEVGGAFTDLPY    189



top
48: d1gp6a_ Anthocyanidin synthase (cs: 2.312)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.54  Contact: 800
Modified z-scores:
dali:0.98 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.34 AHM:0.38 LBcontacta:0.94 LBcontactb:0.92 LHM:0.29
id:0.77 blosum:0.09 compass:0.25 pearson:0.74
Scaled scores:
dali:0.71 daliz:0.40 gdtts:0.55 tmscore:0.60 rmsd:0.74 AHM:0.64 LBcontacta:0.55 LBcontactb:0.65 LHM:0.20
id:0.01 blosum:0.02 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:426.60)
Query          1 ------------------------------------------------------------      1
d1gp6a_        1 vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek     60

Query          1 -----------------------meinadftkpvviDTDQLE------------------     19
d1gp6a_       61 irencieelkkasldwgvmhlinhgipadlmervkkAGEEFFslsveekekyandqatgk    120

Query         20 --wRPSP--------mKGVERRMLDRIG--------------------------------     37
d1gp6a_      121 iqgYGSKlannasgqlEWEDYFFHLAYPeekrdlsiwpktpsdyieatseyakclrllat    180

Query         38 ------------------------GEVARATSIVRYAPG-------SRFSAHTHDGGEEF     66
d1gp6a_      181 kvfkalsvglglepdrlekevgglEELLLQMKINYYPKCpqpelalGVEAHTDVSALTFI    240

Query         67 IVLDGVFQDE------HGDYPAG-TYVRNPPT-----------TSHVPGSAE---gCTIF    105
d1gp6a_      241 LHNMVPGLQLfyegkwVTAKCVPdSIVMHIGDtleilsngkykSILHRGLVNkekvRISW    300

Query        106 VKLWQ-------------------------------fdpadrtqfsknm    123
d1gp6a_      301 AVFCEppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqeel    349


hit structure      alignment
FAST alignment (Normalized score: 3.03 Raw score:628.60)
Query          1 MEINADFTKPVVI-----------------------------------------------     13
d1gp6a_        1 -------------VAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVP     47

Query         14 -------------------------------------------------DTDQL------     18
d1gp6a_       48 TIDLKNIESDDEKIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEE-FFSLSV    106

Query         19 ----------------EWRPSPM----------KGVERRMLDRI----------------     36
d1gp6a_      107 EEKEKYANDQATGKIQGYGS---KLANNASGQLEWEDYFFH---LAYPEEKRDLSIWPKT    160

Query         37 -------------------------------------------GGEVARATSIVRYAPGS     53
d1gp6a_      161 PSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYP---    217

Query         54 ---------RFSAHTH-DGGEEFIVLDG-VFQDE-----HGDYP--AGTYVRNPP-----     90
d1gp6a_      218 KCPQPELALGVEAHTDVSALTFILHNMVPGLQL-FYEGKWVTAKCVPDSIVMHI-GDTLE    275

Query         91 ------TTSHVPGSA-----EGCTIFVKLWQFDPADRTQFSKNM----------------    123
d1gp6a_      276 ILSNGKYKSILHRG-LVNKEKVRISWAV----------------FCEPPKDKIVLKPLPE    318

Query        124 -------------------------------    124
d1gp6a_      319 MVSVESPAKFPPRTFAQHIEHKLFGKEQEEL    349


hit structure      alignment
TMalign alignment (TM-score: 0.57 Raw score:70.16)
Query          1 ------------------------------------------------------------      1
d1gp6a_        1 VAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEK     60

Query          1 ---------------------------------MEINADFTKPVVI--DT-DQL------     18
d1gp6a_       61 IRENCIEELKKASLDWGVMHLINHGIPADLMER------------VKKAGEEFFSLSVEE    108

Query         19 EW-------------RPSP--------MKGVERRMLDR-----IG---------------     37
d1gp6a_      109 KEKYANDQATGKIQGYGSKLANNASGQLEWEDYFF-HLAYPEEKRDLSIWPKTPSDYIEA    167

Query         38 ----------------------------------------GEVARATSIVRYA-P--G--     52
d1gp6a_      168 TSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEEL---LLQMKINYYPKCPQPEL    224

Query         53 SR-FSAHTHDG-GEEFIVLDGVFQD------EHGDYPAG-TYVRNPPT-----------T     92
d1gp6a_      225 ALGVEAHTDVSALTFILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKS    284

Query         93 SHVPGSAE---GCTIFVKLWQFD------P-A----------------------------    114
d1gp6a_      285 ILHRGLVNKEKVRISWAVF-CEPPKDKIVLKPLPEMVSVESPAKFPPRTFAQHIEHKLFG    343

Query        115 ------DRTQFSKNM    123
d1gp6a_      344 KEQEEL---------    349


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.23)
DALI match        *************    ..........................              
Query         37 GGEVARATSIVRYA----PGSRFSAHTHDGGEEFIVLDGVFQDEHGDYPAGTYVRNPP     90
d1gp6a_      204 LEELLLQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGKWVTAKC    261



top
49: d1nofa1 Glycosyl hydrolase family 5 xylanase (cs: 2.264)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.42  Contact: 541
Modified z-scores:
dali:0.97 daliz:0.93 gdtts:0.87 tmscore:0.93 rmsd:0.55 AHM:0.53 LBcontacta:0.93 LBcontactb:0.92 LHM:0.20
id:0.79 blosum:0.21 compass:0.38 pearson:0.85
Scaled scores:
dali:0.73 daliz:0.40 gdtts:0.40 tmscore:0.43 rmsd:0.66 AHM:0.58 LBcontacta:0.63 LBcontactb:0.72 LHM:0.30
id:0.02 blosum:0.05 compass:0.07 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:261.60)
Query          1 -------------MEINadftkpvvidtdqlewRPSPMKGVERRMlDRIGGevARATSIV     47
d1nofa1        1 dtvkidanvnyqiGALR-------------iqaTENPQSNVHLTA-YKNTD--GKMVIVA     44

Query         48 RYA-PGSRF----sahthDGGEEFIVLDGvfqdehgdyPAGTY-VRNPPT---TSHVPgs     98
d1nofa1       45 VNTnDSDQMlslnisnanVTKFEKYSTSA--------sLNVEYgGSSQVDssgKATVW-l     95

Query         99 aEGCTIFVKLWqfdpadrtqfsknm    123
d1nofa1       96 nPLSVTTFVSK--------------    106


hit structure      alignment
FAST alignment (Normalized score: 2.55 Raw score:291.10)
Query          1 MEINADFTKPVVIDTDQLEWRP----------------------SPMKGVERRMLDRIGG     38
d1nofa1        1 ----------------------DTVKIDANVNYQIGALRIQATENPQSNVHLTAY-----     33

Query         39 EVA-----RATSIVRYAP---GSRFSAHTHD---------GGEEFIVLDGVFQDEHGDYP     81
d1nofa1       34 ---KNTDGKMVIVAVNT-NDSDQML------SLNISNANVTKFEKYS-------------     70

Query         82 AGT---------YVRNP---PTTSHVP-GSAEGCTIFVKLWQFDPADRTQFSKNM-    123
d1nofa1       71 ---TSASLNVEYGGSS-QVDSSGKATVWLNP-LSVTTFVS---------------K    106


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:52.78)
Query          1 -----M-E-IN-ADFTKPVVIDT---DQLEWRPSPMKGVERRMLDR---IGGEVARATSI     46
d1nofa1        1 DTVKIDANVNYQ-----IGAL-RIQA-----TENPQSNVHLTAYKNTDG------KMVIV     43

Query         47 VRYAPGSRFSAHT------HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPT-----TSHV     95
d1nofa1       44 AVNTNDSDQMLSLNISNAN-VTKFEKYS-TSA-------SLNVEYGGSSQVDSSGK-ATV     93

Query         96 PGSAEGCTIFVKLWQFDPADRTQFSKNM    123
d1nofa1       94 WLNP-LSVTTFV--SK------------    106


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.25)
DALI match                                 
Query         98 SAEGCTIFVKLWQFDPADRTQFSKNM    123
d1nofa1       35 NTDGKMVIVAVN--TNDSDQMLSLNI     58



top
50: d1g5aa1 Amylosucrase (cs: 2.259)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.59  Contact: 438
Modified z-scores:
dali:0.95 daliz:0.91 gdtts:0.94 tmscore:0.96 rmsd:0.40 AHM:0.52 LBcontacta:0.90 LBcontactb:0.88 LHM:0.22
id:0.47 blosum:0.14 compass:0.46 pearson:0.90
Scaled scores:
dali:0.70 daliz:0.37 gdtts:0.54 tmscore:0.50 rmsd:0.72 AHM:0.59 LBcontacta:0.59 LBcontactb:0.69 LHM:0.31
id:-0.02 blosum:0.03 compass:0.07 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:216.90)
Query          1 meinadftkpvvidtdQLEWRPSPMKGVERRMLDRiggevarATSIVRYAP--GSRFSAH     58
d1g5aa1        1 ----------------RLVTFNTNNKHIIGYIRNN-------ALLAFGNFSeyPQTVTAH     37

Query         59 ---tHDGGEEFIVldgvfqdehgdypagTYVRNppttSHVPGSAEGCTIFVKLWqfdpad    115
d1g5aa1       38 tlqaMPFKAHDLI---------------GGKTV--slNQDLTLQPYQVMWLEIA------     74

Query        116 rtqfsknm    123
d1g5aa1       75 --------     75


hit structure      alignment
FAST alignment (Normalized score: 3.30 Raw score:314.70)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR--ATSIVRYAP---GSRF     55
d1g5aa1        1 ----------------RLVTFNTNNKHIIGYIR---------NNALLAFGNF-SEYPQTV     34

Query         56 SAHTHDGG---------EEFIVLDGVFQDEHGDYP-AGTYVRNPPTT-SHVPGSAEGCTI    104
d1g5aa1       35 --------TAHTLQAMPFKAHDL------------IGGKTVS-----LNQDLTLQPYQVM     69

Query        105 FVKLWQFDPADRTQFSKNM--    123
d1g5aa1       70 WLE----------------IA     74


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:47.80)
Query          1 MEINADFTKPVVIDTDQL-EWRPSPMK-GVERRMLDRIGGEVARATSIVRYAP-G-SRFS     56
d1g5aa1        1 --R--------------LV--TFNTNNKHIIGYIRNN-------ALLAFGNFSEYPQTVT     35

Query         57 AH---THDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDP    113
d1g5aa1       36 -AHTLQAMPFKAHDLI-------------GGKTVS---LNQDLTLQPYQVMWLEI-A---     74

Query        114 ADRTQFSKNM    123
d1g5aa1       75 ----------     75


hit structure      alignment
HHsearch alignment (Probability: 0.00 E-value:0.73)
DALI match                       
Query          6 DFTKPVVIDTDQLEWR     21
d1g5aa1       56 SLNQDLTLQPYQVMWL     71



hit structures. 
top
51: d1su4a1 Calcium ATPase,​ transduction domain A (cs: 2.233)

SCOP Superfamily: Calcium ATPase,​ transduction domain A  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.37  Contact: 487
Modified z-scores:
dali:0.95 daliz:0.90 gdtts:0.96 tmscore:0.98 rmsd:0.40 AHM:0.41 LBcontacta:0.93 LBcontactb:0.91 LHM:0.17
id:0.72 blosum:0.15 compass:0.26 pearson:0.96
Scaled scores:
dali:0.70 daliz:0.32 gdtts:0.49 tmscore:0.48 rmsd:0.73 AHM:0.64 LBcontacta:0.58 LBcontactb:0.68 LHM:0.34
id:-0.00 blosum:0.04 compass:0.12 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:204.40)
Query          1 meinadftkpvvidTDQL-EWRPSPmkgverrmldriggevarATSIVRYapGSRFsaht     59
d1su4a1        1 --------emgkvyRADRkSVQRIK-------------ardivPGDIVEV--AVGD----     33

Query         60 hdggEEFIVLDG---vFQDE---------HGDYPAG-------------TYVRNppttSH     94
d1su4a1       34 -kvpADIRILSIksttLRVDqsiltgesvSVIKHTEpvpdpravnqdkkNMLFS----GT     88

Query         95 VPGSAeGCTIFVKLWQF----DPADRtqfsknm    123
d1su4a1       89 NIAAG-KALGIVATTGVsteiGKIRD-----qm    115


hit structure      alignment
FAST alignment (Normalized score: 2.12 Raw score:251.80)
Query          1 MEINADFTKPVVIDTDQ----------LEWRPSPMKGVERRMLDRIGGEVAR------AT     44
d1su4a1        1 -----------------EMGKVYRADRKSVQRI-------------------KARDIVPG     24

Query         45 SIVRYAPGSRFSAHTHDGG---EEFIVLDG-------VFQDEH---------GDYPAGTY     85
d1su4a1       25 DIVEVAVGD----------KVPADIRIL--SIKSTTLRVDQ--SILTGESVSVIKHT---     67

Query         86 VRNP-----PTTSH----------VPGS-AEGCTIFVKLWQFDPADRTQFSKNM------    123
d1su4a1       68 ----EPVPDPRAV-NQDKKNMLFSGTNIAAGKALGI------------------VATTGV    104

Query        124 -----------    124
d1su4a1      105 STEIGKIRDQM    115


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:51.60)
Query          1 -----MEINADFTKPVVIDTDQL--EWRPSPMKGVERRMLDRIGGEVARAT-SIVRYAPG     52
d1su4a1        1 EMGKV---------------YRADRKSVQRI-------------KARDIVPGDIVEV---     29

Query         53 SRFSAHTHDGGEEFIVLDG---VFQDE---------HGDYPAG-------------TYVR     87
d1su4a1       30 AVGD-KVP---ADIRILSIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLF     85

Query         88 NPPTTSHVPGSAEGCTIFV-KLWQFD-PADRT---QFSKNM    123
d1su4a1       86 S----GTNIAAG-KALGIVATTGVSTEIGKIRDQM------    115


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.07)
DALI match                   
Query         82 AGTYVRNPPTTS     93
d1su4a1       23 PGDIVEVAVGDK     34



top
52: d1u79a_ FKBP13 (cs: 2.137)

SCOP Superfamily: FKBP-​like  |  SCOP Fold: FKBP-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.42  Contact: 289
Modified z-scores:
dali:0.92 daliz:0.90 gdtts:0.95 tmscore:0.96 rmsd:0.34 AHM:0.38 LBcontacta:0.84 LBcontactb:0.82 LHM:0.36
id:0.87 blosum:0.20 compass:0.30 pearson:0.86
Scaled scores:
dali:0.76 daliz:0.44 gdtts:0.58 tmscore:0.54 rmsd:0.78 AHM:0.65 LBcontacta:0.56 LBcontactb:0.66 LHM:0.14
id:0.04 blosum:0.04 compass:0.10 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:225.10)
Query          1 meinadftkpvvidtdqLEWRPSPmKGVERRMLDRIGGEVAratsivryapgsrfsahth     60
d1u79a_        1 -----------------CEFSVSP-SGLAFCDKVVGYGPEA---------------vkgq     27

Query         61 DGGEEFIVLDGvfqdehgdyPAGTYV-----RNPPT---tSHVP----------------     96
d1u79a_       28 LIKAHYVGKLE-------ngKVFDSSynrgkPLTFRigvgEVIKgwdqgilgsdgippml     80

Query         97 ------------GSAE-----------------GCTIFVKLWQFDpadrtqfsknm    123
d1u79a_       81 tggkrtlrippeLAYGdrgagckggsclippasVLLFDIEYIGKA-----------    125


hit structure      alignment
FAST alignment (Normalized score: 2.16 Raw score:268.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRML-DRIGGEV-------------------     40
d1u79a_        1 -----------------CEFSVS-PSGLAFCDKVVGYGP--EAVKGQLIKAHYVGKLENG     40

Query         41 ----------------------------------------ARATSIVRYAPGSRFSAHTH     60
d1u79a_       41 KVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPP---------     91

Query         61 DGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGS--------------------AE    100
d1u79a_       92 --------------------------------------ELAYGDRGAGCKGGSCLIPPAS    113

Query        101 GCTIFVKLWQFDPADRTQFSKNM----    123
d1u79a_      114 VLLFDIEY---------------IGKA    125


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:50.23)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVA-RATSIVRYAPGSRFSAHT     59
d1u79a_        1 -----------------CEFSVS-PSGLAFCDKVVGYGPEAV----------------KG     26

Query         60 HDGGEEFIVLDG--VFQDEHGDYPAGTYV-----RNPPTT--SHVP--------------     96
d1u79a_       27 QLIKAHYVGKLENG---------KVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIP     77

Query         97 ----------------GSA----------------EGCTIFVKLWQFDPADRTQFSKNM    123
d1u79a_       78 PMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEY-IGKA----------    125


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.73)
DALI match                           
Query         51 PGSRFSAHTHDGGEEFIVLD     70
d1u79a_      101 GCKGGSCLIPPASVLLFDIE    120



top
53: d1uhva1 Beta-​D-​xylosidase (cs: 2.090)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.43  Contact: 538
Modified z-scores:
dali:0.96 daliz:0.92 gdtts:0.94 tmscore:0.96 rmsd:0.43 AHM:0.45 LBcontacta:0.95 LBcontactb:0.91 LHM:0.24
id:0.94 blosum:0.60 compass:0.49 pearson:0.94
Scaled scores:
dali:0.73 daliz:0.39 gdtts:0.50 tmscore:0.49 rmsd:0.69 AHM:0.59 LBcontacta:0.66 LBcontactb:0.73 LHM:0.23
id:0.06 blosum:0.12 compass:0.10 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:261.50)
Query          1 ------------MEINadftkpvvidtdqlEWRPspmkgvERRMlDRIGgeVARATSIVR     48
d1uhva1        1 mikvrvpdfsdkKEML--------------YRDE------HMLV-TRRD--DGSVALIAW     37

Query         49 YA-------PGSRFS----ahthDGGEEFIVLDG--------------------vfqdeh     77
d1uhva1       38 NEvmdktenPDEDYEveipvrfrDVFIKRQLIDEehgnpwgtwihmgrprypskeqvntl     97

Query         78 gdypaGTYVRNPPT-----tSHVPGSAEGCTIFVKLWqFDPA-------drtqfsknm    123
d1uhva1       98 revakPEIMTSQPVandgylNLKFKLGKNAVVLYELT-ERIDesstyiglddskingy    154


hit structure      alignment
FAST alignment (Normalized score: 1.99 Raw score:274.30)
Query          1 MEINADFTKPVVIDTDQLEWRPS-----------------PMKGVERRMLDRIGGEVAR-     42
d1uhva1        1 -----------------------MIKVRVPDFSDKKEMLYRDEHMLVTRR---------D     28

Query         43 -ATSIVRYAPGSRF--------------SAHTHD----GGEEFIVLDGVFQDEHGDYP--     81
d1uhva1       29 DGSVALIA------WNEVMDKTENPDEDYEVEI-PVRFRDVFIKRQ------------LI     69

Query         82 ----------------------------------AGTYVRNPP----TTSHVPGSA---E    100
d1uhva1       70 DEEHGNPWGTWIHMGRPRYPSKEQVNTLREVAKPEIMTSQPV-ANDGYLNLKFKL-GKNA    127

Query        101 GCTIFVKLWQFDPADRTQFSKNM---------------------    123
d1uhva1      128 VVLYEL-----------------TERIDESSTYIGLDDSKINGY    154


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:53.37)
Query          1 ---------ME--IN-ADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVR     48
d1uhva1        1 MIKVRVPDFSDKKEML---------------YRD----EHMLVT-RRDD---GSVALIAW     37

Query         49 YA-------PGSRFSAHT-H---DGGEEFIVLDGVFQDEHGDYPA---------------     82
d1uhva1       38 NEVMDKTENPDEDYEVEIPVRFRDVFIKRQL-IDE-------EHGNPWGTWIHMGRPRYP     89

Query         83 -------------GTYVRNPPTT-----SHVPGSAEGCTIFVKLWQFDPADR--------    116
d1uhva1       90 SKEQVNTLREVAKPEIMTSQPVANDGYLNLKFKLGKNAVVLYEL-TERIDESSTYIGLDD    148

Query        117 ------TQFSKNM    123
d1uhva1      149 SKINGY-------    154


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.59)
DALI match                           
Query         34 DRIGGEVARATSIVRYAPGS     53
d1uhva1      108 SQPVANDGYLNLKFKLGKNA    127



top
54: d1gh5a_ Antifungal protein AFP1 (cs: 2.021)

SCOP Superfamily: gamma-​Crystallin-​like  |  SCOP Fold: gamma-​Crystallin-​like  |  SCOP Class: All beta proteins

Consensus: 0.63  Contact: 420
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.96 tmscore:0.97 rmsd:0.32 AHM:0.37 LBcontacta:0.90 LBcontactb:0.84 LHM:0.29
id:0.74 blosum:0.06 compass:0.63 pearson:0.50
Scaled scores:
dali:0.70 daliz:0.37 gdtts:0.58 tmscore:0.56 rmsd:0.77 AHM:0.61 LBcontacta:0.61 LBcontactb:0.63 LHM:0.13
id:0.01 blosum:-0.02 compass:0.00 pearson:0.01

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:195.60)
Query          1 meinadftkpvvidtdqlewrpspmKGVERR----mldriggevaRATSiVRYAPgSRFS     56
d1gh5a_        1 -------------------------MINRTDcnensyleihnnegRDTL-CFANA-GTMP     33

Query         57 AHTHdGGEEFIVLDGVFQDE-----------HGDYPAGTYVRN-PPTTSHVPGSAegcti    104
d1gh5a_       34 VAIY-GVNWVESGNNVVTLQfqrnlsdprleTITLQKWGSWNPgHIHEILSIRIY-----     87

Query        105 fvklwqfdpadrtqfsknm    123
d1gh5a_       88 -------------------     88


hit structure      alignment
FAST alignment (Normalized score: 2.57 Raw score:265.70)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGE---------------------     39
d1gh5a_        1 ---------------------------------------MINRTDCNENSYLEIHNNEGR     21

Query         40 -----VARATSIVRYAPGSR--FSAHT-HDGGEEFIVLDGVFQDEHGDYPA--------G     83
d1gh5a_       22 DTLCFANAGTMPVAI-----YGVNWVESGNNVVTLQF--------------QRNLSDPRL     62

Query         84 TYVRNPPTTSHVPGS--AEGCTIFVKLWQFDPADRTQFSKNM--    123
d1gh5a_       63 ETITLQKWGSWNP--GHIHEI-LSIR----------------IY     87


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:47.11)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRM-----------LDRIGGEVARATSIVRY     49
d1gh5a_        1 ------------------------MINRTDCNENSYLEIHNNE--------GRDTL-CFA     27

Query         50 APGSRFSAHTHDGGEEFIVLDGVFQDE-----------HGDYPAGTYVRN-PPTTSHVPG     97
d1gh5a_       28 NA-GTMPVAIY-GVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIR     85

Query         98 SAEGCTIFVKLWQFDPADRTQFSKNM    123
d1gh5a_       86 IY------------------------     87


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.02)
DALI match                                                   
Query         18 LEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTHD     61
d1gh5a_       39 VNWVESGNNVVTLQFQRNLSDPRLETITLQKW--GSWNPGHIHE     80



top
55: d1odma_ Isopenicillin N synthase (svm: 0.754)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.43  Contact: 741
Modified z-scores:
dali:0.98 daliz:0.98 gdtts:0.97 tmscore:0.98 rmsd:0.35 AHM:0.35 LBcontacta:0.97 LBcontactb:0.95 LHM:0.21
id:0.99 blosum:0.71 compass:0.50 pearson:0.92
Scaled scores:
dali:0.74 daliz:0.44 gdtts:0.56 tmscore:0.61 rmsd:0.74 AHM:0.68 LBcontacta:0.63 LBcontactb:0.72 LHM:0.31
id:0.10 blosum:0.14 compass:0.18 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:397.60)
Query          1 -----------------------------------------meinadftkpvviDTDQL-     18
d1odma_        1 svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqKTKEFh     60

Query         19 --------------------------eWRPS--pmKGVERRmLDRI--------------     36
d1odma_       61 msitpeekwdlairaynkehqdqvragYYLSipgkKAVESF-CYLNpnftpdhpriqakt    119

Query         37 -------------------------------------------------------GGEVA     41
d1odma_      120 pthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkPDDTL    179

Query         42 RATSIVRYAP----------------gsRFSAHTHDG-GEEFIVlDGVFQDE--------     76
d1odma_      180 ASVVLIRYPYldpypeaaiktaadgtklSFEWHEDVSlITVLYQ-SNVQNLQvetaagyq    238

Query         77 HGDYPAGTYVRNPPT------------TSHVPGSA-EGCTIFVKLWQ-------------    110
d1odma_      239 DIEADDTGYLINCGSymahltnnyykaPIHRVKWVnAERQSLPFFVNlgydsvidpfdpr    298

Query        111 ------------------fdpadrtqfsknm    123
d1odma_      299 epngksdreplsygdylqnglvslinkngqt    329


hit structure      alignment
FAST alignment (Normalized score: 2.86 Raw score:575.10)
Query          1 MEINADFTKPVVI-----------------------------------------------     13
d1odma_        1 -------------SVSKANVPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHGI     47

Query         14 -------DTDQLEWRPSPM-------------------------------------KGVE     29
d1odma_       48 NVQRLSQKTKE--------FHMSITPEEKWDLAIRAYNKEHQDQVRAGYYLSIPGKKAVE     99

Query         30 RRMLDRIGGEV-------------------------------------------------     40
d1odma_      100 SFCY-------LNPNFTPDHPRIQAKTPTHEVNVWPDETKHPGFQDFAEQYYWDVFGLSS    152

Query         41 --------------------------ARATSIVRYAPGS-------------------RF     55
d1odma_      153 ALLKGYALALGKEENFFARHFKPDDTLASVVLIRYP---YLDPYPEAAIKTAADGTKLSF    209

Query         56 SAHTH-DGGEEFIVLDG-VFQDE-----HGDYP--AGTYVRNPP-------------TTS     93
d1odma_      210 EWHEDVSLITVLYQSNVQNLQV-ETAAGYQDIEADDTGYLINC-GSYMAHLTNNYYKAPI    267

Query         94 HV-PGSAEGCTIFVKLWQFDPADRTQFSKNM-----------------------------    123
d1odma_      268 HRVKWVNAERQSLPF----------------FVNLGYDSVIDPFDPREPNGKSDREPLSY    311

Query        124 ------------------    124
d1odma_      312 GDYLQNGLVSLINKNGQT    329


hit structure      alignment
TMalign alignment (TM-score: 0.31 Raw score:38.36)
Query          1 ------------------------------------------------------------      1
d1odma_        1 SVSKANVPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHGINVQRLSQKTKEFH     60

Query          1 --M---EIN----ADFTKPVVI-D-TDQLEWRPSPMKGVERRMLDRI-------GGEVAR     42
d1odma_       61 MSITPEEKWDLAI------RAYNKEHQDQV----------RAGYYLSIPGKKAV-----E     99

Query         43 ATSIVRYAP------------------------------GSRFSAHT--HDGGEEF--IV     68
d1odma_      100 SFCYLNPNFTPDHPRIQAKTPTHEVNVWPDETKHPGFQD------FAEQ----Y-YWD--    146

Query         69 LDGVFQDE-HGDY-----------------PAGTYVRNPPTTSHVPGSAEGCTIFVKLWQ    110
d1odma_      147 ----VFGLSSALLKGYALALGKEENFFARH----------------FKPDDTLASVVLIR    186

Query        111 ------------------------------------FDPA----------------DR-T    117
d1odma_      187 YPYLDPYPEAAIKTAADGTKLSFEWHEDVSLITVLYQSNVQNLQVETAAGYQDIEADDTG    246

Query        118 QFSKNM------------------------------------------------------    123
d1odma_      247 YLINCGSYMAHLTNNYYKAPIHRVKWVNAERQSLPFFVNLGYDSVIDPFDPREPNGKSDR    306

Query        124 -----------------------    124
d1odma_      307 EPLSYGDYLQNGLVSLINKNGQT    329


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.80)
DALI match           ............... .......              
Query         50 APGSRFSAHTHDGGEEFIVLDGVFQDEHGDYPAGTYVRNPP     90
d1odma_      202 ADGTKLSFEWHEDVSLITVLYQSNVQNLQVETAAGYQDIEA    242



hit structures. 
top
56: d1nlqa_ Chromatin decondensation protein 1 (Crp1,​ Nlp) (svm: 0.812)

SCOP Superfamily: Nucleoplasmin-​like core domain  |  SCOP Fold: Nucleoplasmin-​like/​VP (viral coat and capsid proteins)  |  SCOP Class: All beta proteins

Consensus: 0.26  Contact: 589
Modified z-scores:
dali:0.96 daliz:0.95 gdtts:0.96 tmscore:0.97 rmsd:0.32 AHM:0.31 LBcontacta:0.93 LBcontactb:0.88 LHM:0.15
id:0.91 blosum:0.19 compass:0.29 pearson:0.75
Scaled scores:
dali:0.72 daliz:0.42 gdtts:0.59 tmscore:0.59 rmsd:0.76 AHM:0.70 LBcontacta:0.65 LBcontactb:0.68 LHM:0.39
id:0.05 blosum:0.04 compass:0.03 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:244.70)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldriggevARATSIVRYAP-GSRFsAHT     59
d1nlqa_        1 ----------------------------------------EESFYGVTLTAeSDSV-TWD     19

Query         60 H------dGGEEF-IVLD---------gVFQDE------HGDYP--------AGTY-VRN     88
d1nlqa_       20 VdedyargQKLVIkQILLgaeakenefnVVEVNtpkdsvQIPIAvlkagetrAVNPdVEF     79

Query         89 PPtTSHVPGSAE---gCTIFVKLWQFDpadrtqfsknm    123
d1nlqa_       80 YE-SKVTFKLIKgsgpVYIHGHNIKDD-----------    105


hit structure      alignment
FAST alignment (Normalized score: 2.21 Raw score:251.60)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTH     60
d1nlqa_        1 ----------------------------------------EESFYGVTLT----------     10

Query         61 ----------------DGGEE-FIVLD------------GVFQDEHGDYP----------     81
d1nlqa_       11 AESDSVTWDVDEDYARGQKLVIKQIL-LGAEAKENEFNVVEVNT------PKDSVQIPIA     63

Query         82 ---------AGTYVRNPPTTSHVPGSAE-------GCTIFVKLWQFDPADRTQFSKNM-    123
d1nlqa_       64 VLKAGETRAVNPDVEFY---ESKVTF--KLIKGSGPVYIHGH--NIKD----------D    105


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:47.05)
Query          1 --MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR---ATSIVRY-----A     50
d1nlqa_        1 EE----------------------SFYG------------VTLTAESDSVTWDVDEDYAR     26

Query         51 PGSRFSAHTHD---------GGEEFIVLDGVFQDEHGDYPAGTYVR-NPP----T--TSH     94
d1nlqa_       27 GQKLVIKQILLGAEAKENEFNVVEVNTPK-----------DSVQIPIAVLKAGETRAVNP     75

Query         95 VPGSAEGCTIFVKLWQFDP-------------ADRTQFSKNM    123
d1nlqa_       76 DVEF-YESKVTFKL-IKGSGPVYIHGHNIKDD----------    105


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.12)
DALI match                        
Query        101 GCTIF--VKLWQFDPAD    115
d1nlqa_        6 GVTLTAESDSVTWDVDE     22



top
57: d1szba1 Mannose-​binding protein associated serine protease 2,​ MASP2 (svm: 0.927)

SCOP Superfamily: Spermadhesin,​ CUB domain  |  SCOP Fold: CUB-​like  |  SCOP Class: All beta proteins

Consensus: 0.45  Contact: 463
Modified z-scores:
dali:0.87 daliz:0.84 gdtts:0.92 tmscore:0.93 rmsd:0.39 AHM:0.39 LBcontacta:0.84 LBcontactb:0.81 LHM:0.21
id:0.58 blosum:0.10 compass:0.28 pearson:0.83
Scaled scores:
dali:0.70 daliz:0.32 gdtts:0.53 tmscore:0.48 rmsd:0.72 AHM:0.65 LBcontacta:0.54 LBcontactb:0.64 LHM:0.27
id:-0.02 blosum:-0.01 compass:0.09 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 1.9 Raw score:212.50)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldrigGEVARATSIVRYA--------pG     52
d1szba1        1 ----------------------------------lgpKWPEPVFGRLASPgfpgeyandQ     26

Query         53 SRFsaHTHD---GGEEFIVLDG----------------vfqdEHGDY-----------PA     82
d1szba1       27 ERR-wTLTAppgYRLRLYFTHFdlelshlceydfvklssgakVLATLcgqestdteraPG     85

Query         83 GTYVRNPPTTshVPGSAE---------GCTIFVKLWQfdpadrtqfsknm    123
d1szba1       86 KDTFYSLGSS-lDITFRSdysnekpftGFEAFYAAED-------------    121


hit structure      alignment
FAST alignment (Normalized score: 2.54 Raw score:310.10)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIG---GEVARATSIVRYA-------     50
d1szba1        1 -------------------------------------LGPKWPEPVFGRLA--SPGFPGE     21

Query         51 ----PGSRFSAHTHD----GGEEFIVLD------------GVFQD------EHGDY----     80
d1szba1       22 YANDQERR-WTLT--APPGYRLRLYFT-HFDLELSHLCEYDFVK-LSSGAKVLATLCGQE     76

Query         81 -------PAGTYVRNPPT--TSHVPGSAE-----------GCTIFVKLWQFDPADRTQFS    120
d1szba1       77 STDTERAPGKDTFYS---LGSSLDITF--RSDYSNEKPFTGFEAFYA-------------    118

Query        121 KNM---    123
d1szba1      119 ---AED    121


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:48.91)
Query          1 ----MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYA-----P     51
d1szba1        1 LGPK-----------------------------------WP---EPVFGRLASPGFPGEY     22

Query         52 ---GSRFSAHTHDG---GEEFIVLDG-----------VFQDE----H-GDY---------     80
d1szba1       23 ANDQERRW-TLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTE     81

Query         81 --PAGTYVRNPPTTSHVPGSAE---------GCTIFVKLWQFDPADRTQFSKNM    123
d1szba1       82 RAPGKDTFYSLGSSLD-ITFRSDYSNEKPFTGFEAFYAA-ED------------    121


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.17)
DALI match                           
Query         98 SAEGCTIFVKLWQFDPADRT    117
d1szba1       34 APPGYRLRLYFTHFDLELSH     53



top
58: d1ds1a_ Clavaminate synthase (svm: 1.210)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.41  Contact: 616
Modified z-scores:
dali:0.97 daliz:0.96 gdtts:0.98 tmscore:0.98 rmsd:0.34 AHM:0.37 LBcontacta:0.95 LBcontactb:0.93 LHM:0.28
id:0.83 blosum:0.11 compass:0.31 pearson:0.86
Scaled scores:
dali:0.74 daliz:0.41 gdtts:0.59 tmscore:0.62 rmsd:0.80 AHM:0.70 LBcontacta:0.59 LBcontactb:0.69 LHM:0.21
id:0.03 blosum:0.02 compass:0.09 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:335.00)
Query          1 -----------------------meiNADF------------------------------      7
d1ds1a_        1 tsvdctaygpelralaarlprtpradLYAFldaahtaaaslpgalataldtfnaegsedg     60

Query          8 ----------------------tkpVVIDTdqlewrpspmkgverrmldRIGGE-vARAT     44
d1ds1a_       61 hlllrglpveadadlpttpsstpapEDRSL-ltmeamlglvgrrlglhtGYRELrsGTVY    119

Query         45 SIVRY----------APGSRFSAHTHD-------GGEEFIVLDGV----FQDE-------     76
d1ds1a_      120 HDVYPspgahhlsseTSETLLEFHTEMayhrlqpNYVMLACSRADhertAATLvasvrka    179

Query         77 ------------------------------------------------------------     77
d1ds1a_      180 lplldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellape    239

Query         77 --------------------HGDYPAGTYVRNPPT-TSHVPGSAE------gCTIFVKLw    109
d1ds1a_      240 dpadkeavaalskaldevteAVYLEPGDLLIVDNFrTTHARTPFSprwdgkdRWLHRVY-    298

Query        110 QFDPA-----------drtqfsknm    123
d1ds1a_      299 IRTDRngqlsggeragdvvaftprg    323


hit structure      alignment
FAST alignment (Normalized score: 2.01 Raw score:400.40)
Query          1 MEINADFTKPVVIDTD--------------------------------------------     16
d1ds1a_        1 ----------------TSVDCTAYGPELRALAARLPRTPRADLYAFLDAAHTAAASLPGA     44

Query         17 ------------------------------QLEWRPSPMKGVERRMLDR-----------     35
d1ds1a_       45 LATALDTFNAEGSEDGHLLLRGLPVEADADLPTTP--------------SSTPAPEDRSL     90

Query         36 ------------------IGGEVAR-----ATSIVRY----------APGSRFSAHTH--     60
d1ds1a_       91 LTMEAMLGLVGRRLGLHTGYRE---LRSGTVYHDVYPSPGAHHLSSETSETLLEFHT-EM    146

Query         61 ------DGGEEFIVLD-----GVFQDE---------------------------------     76
d1ds1a_      147 AYHRLQPNYVMLACS-RADHERTAAT-LVASVRKALPLLDERTRARLLDRRMPCCVDVAF    204

Query         77 -------------------------------------------------------HGDYP     81
d1ds1a_      205 RGGVDDPGAIAQVKPLYGDADDPFLGYDRELLAPEDPADKEAVAALSKALDEVTEAVYLE    264

Query         82 AGTYVRN-PPTTSHVPGSAE-----------GCTIFVKLWQFDPADRTQFSKNM------    123
d1ds1a_      265 PGDLLIVDNFRTTHA-----RTPFSPRWDGKDRWLHRV----------------YIRTDR    303

Query        124 --------------------    124
d1ds1a_      304 NGQLSGGERAGDVVAFTPRG    323


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:45.51)
Query          1 ------------------------------M--EI-NA--DF--T---------------      8
d1ds1a_        1 TSVDCTAYGPELRALAARLPRTPRADLYAFLDAAHTAAASLPGALATALDTFNAEGSEDG     60

Query          9 -----KPVVIDTDQLEW---RPSPMKGVE---R--RML--DR---IG--GEVA--RATSI     46
d1ds1a_       61 HLLLRGLPVEADADLPTTPS-----STPAPEDRSLLTMEAMLGLVGRRLGLHTGY-----    110

Query         47 VRYAPGSRFSAH-----THDGGE-EFIVLDGVFQDEHG-DYPAGTYVRNPPTT-------     92
d1ds1a_      111 --------RELRSGTVY-----HD-V-Y-PSPGAHHLSSETSETLLEFHTEMAYHRLQPN    154

Query         93 ---------------------------------------------SHVP-----------     96
d1ds1a_      155 YVMLACSRADHERTAATLVASVRKALPLLDERTRARLLDRRMPCCVDVAFRGGVDDPGAI    214

Query         97 --------------------------------------------------GSAEGCTIF-    105
d1ds1a_      215 AQVKPLYGDADDPFLGYDRELLAPEDPADKEAVAALSKALDEVTEAVYLE--------PG    266

Query        106 VKLWQFD-PADRTQFSKNM----------------------------------------    123
d1ds1a_      267 -DLLIVDNFRT-THARTPFSPRWDGKDRWLHRVYIRTDRNGQLSGGERAGDVVAFTPRG    323


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.26)
DALI match       ***********
Query         79 DYPAGTYVRNP     89
d1ds1a_      262 YLEPGDLLIVD    272



top
59: d1otja_ Taurine/​alpha-​ketoglutarate dioxygenase TauD (svm: 0.777)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.39  Contact: 605
Modified z-scores:
dali:0.96 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.33 AHM:0.35 LBcontacta:0.94 LBcontactb:0.89 LHM:0.20
id:0.71 blosum:0.31 compass:0.37 pearson:0.74
Scaled scores:
dali:0.75 daliz:0.45 gdtts:0.61 tmscore:0.63 rmsd:0.77 AHM:0.68 LBcontacta:0.61 LBcontactb:0.66 LHM:0.31
id:0.01 blosum:0.06 compass:0.10 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 2.5 Raw score:309.70)
Query          1 ------------------------------------------meinadftkpvvidtdql     18
d1otja_        1 serlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqrala     60

Query         19 ewrpspmkgveRRMLDRiggevarATSIVRYA--pGSRF-SAHTH-------DGGEEFIV     68
d1otja_       61 qrfgelhihpvYPHAEG-----vdEIIVLDTHndnPPDNdNWHTDvtfietpPAGAILAA    115

Query         69 LDG---vFQDE-------------------------------------------------     76
d1otja_      116 KELpstgGDTLwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwre    175

Query         77 ------------------------------------------------------------     77
d1otja_      176 avaknppllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqv    235

Query         77 HGDYPAGTYVRNPPT-TSHVPGSAE---GCTIFVKLwQFDPAdrtqfsknm    123
d1otja_      236 RWRWQPNDIAIWDNRvTQHYANADYlpqRRIMHRAT-ILGDK----pfyra    281


hit structure      alignment
FAST alignment (Normalized score: 2.15 Raw score:399.10)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1otja_        1 ------------------------------------------SERLSITPLGPYIGAQIS     18

Query         43 ------------------------------------------------------------     43
d1otja_       19 GADLTRPLSDNQFEQLYHAVLRHQVVFLRDQAITPQQQRALAQRFGELHIHPVYPHAEGV     78

Query         43 -ATSIVRYAPGSR--------FSAHTH--------DGGEEFIVLD----GVFQDE-----     76
d1otja_       79 DEIIVLDT-----HNDNPPDNDNWHT-DVTFIETPPAGAILAAK-ELPSTGGD--TLWTS    129

Query         77 ------------------------------------------------------------     77
d1otja_      130 GIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYKYRKTEEEHQRWREAVAKNPPLLHPVVR    189

Query         77 ----------------------------------------------HGDYPAGTYVRN-P     89
d1otja_      190 THPVSGKQALFVNEGFTTRIVDVSEKESEALLSFLFAHITKPEFQVRWRWQPNDIAIWDN    249

Query         90 PTTSHVPGS---AEGCTIFVKLWQFDPADRTQFSKNM-----------    123
d1otja_      250 RVTQHYANADYLPQRRIMHRA----------------TILGDKPFYRA    281


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:44.55)
Query          1 ------------------------------------------------------------      1
d1otja_        1 SERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVVFLRDQAITPQQQRALA     60

Query          1 ---------MEINADFTKPVVIDTDQLEWRPSPM------------KGVERRMLDRIGGE     39
d1otja_       61 QRFGELHIH---------------------PVYPHAEGVDEIIVLD---------THNDN     90

Query         40 VARATSIVRY--A----PGSRFSAHTH-DGG---EEFIVLDGV-----------------     72
d1otja_       91 -PPDNDNWHTDVTFIETPPAGA-ILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGL    148

Query         73 ------------------------------------------------------------     73
d1otja_      149 RAEHDFRKSFPEYKYRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTR    208

Query         73 -----------------------FQDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLW    109
d1otja_      209 IVDVSEKESEALLSFLFAHITKP--------EFQVRWRWQPNDIAIWDNRV-TQHYANAD    259

Query        110 QF-DP-----------------ADRTQFSKNM    123
d1otja_      260 YLPQRRIMHRATILGDKPFYRA----------    281


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.15)
DALI match       ***********
Query         79 DYPAGTYVRNP     89
d1otja_      238 RWQPNDIAIWD    248



top
60: d1nzia1 Complement C1S component (svm: 1.044)

SCOP Superfamily: Spermadhesin,​ CUB domain  |  SCOP Fold: CUB-​like  |  SCOP Class: All beta proteins

Consensus: 0.38  Contact: 508
Modified z-scores:
dali:0.91 daliz:0.90 gdtts:0.93 tmscore:0.95 rmsd:0.34 AHM:0.41 LBcontacta:0.91 LBcontactb:0.88 LHM:0.22
id:0.80 blosum:0.26 compass:0.31 pearson:0.89
Scaled scores:
dali:0.72 daliz:0.37 gdtts:0.56 tmscore:0.54 rmsd:0.75 AHM:0.63 LBcontacta:0.68 LBcontactb:0.76 LHM:0.27
id:0.02 blosum:0.06 compass:0.10 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:200.00)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldriggeVARATSIVRYA---------p     51
d1nzia1        1 ---------------------------------------EPTMYGEILSPnypqaypsev     21

Query         52 GSRF-sahthDGGEEFIVLDG-----------vFQDE--HGDYP-----------aGTYV     86
d1nzia1       22 EKSWdievpeGYGIHLYFTHLdielsencaydsVQIIseEGRLCgqrssnnphspiVEEF     81

Query         87 RNPPtTSHVPGSA---------eGCTIFVKLWQFdpadrtqfsknm    123
d1nzia1       82 QVPY-NKLQVIFKsdfsneerftGFAAYYVATDI------------    114


hit structure      alignment
FAST alignment (Normalized score: 2.36 Raw score:279.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR---ATSIVRYA-------     50
d1nzia1        1 ------------------------------------------EPTMYGEIL--SPNYPQA     16

Query         51 ----PGSRFSAHTHD----GGEEFIVLD------------GVFQD---EHGDYPA-----     82
d1nzia1       17 YPSEVEKS-WDIE--VPEGYGIHLYFT-HLDIELSENCAYDSVQ-IISEEGRL--CGQRS     69

Query         83 --------GTYVRNPPT--TSHVPGSAE-----------GCTIFVKLWQFDPADRTQFSK    121
d1nzia1       70 SNNPHSPIVEEFQV---PYNKLQVIF--KSDFSNEERFTGFAAYYV--------------    110

Query        122 NM----    123
d1nzia1      111 --ATDI    114


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:44.70)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVER-RMLDRIGGEVA-R----ATSIVRYA---P     51
d1nzia1        1 -------------------EPT--MY-GEIL---SP-N-YPQAYPSEVEKSWDIEVPEGY     33

Query         52 GSRFSAHTHDGG--------EEFIVLDGVFQDEHGDYPAGTYVRNPPTT---------SH     94
d1nzia1       34 GIHLYFTHLDIELSENCAYDSVQII--S-E------E----GR-LCGQRSSNNPHSPIVE     79

Query         95 VPGSAEGCTIFVKLWQF--D-PAD------------RTQFSKNM    123
d1nzia1       80 EFQVPYNKLQVIFK-SDFSNEERFTGFAAYYVATDI--------    114


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.28)
DALI match                                
Query         98 SAEGCTIFVKLWQFDPADRTQFSKN    122
d1nzia1       29 VPEGYGIHLYFTHLDIELSENCAYD     53



hit structures. 
top
61: d1k5ja_ Nucleoplasmin core (svm: 0.735)

SCOP Superfamily: Nucleoplasmin-​like core domain  |  SCOP Fold: Nucleoplasmin-​like/​VP (viral coat and capsid proteins)  |  SCOP Class: All beta proteins

Consensus: 0.16  Contact: 521
Modified z-scores:
dali:0.93 daliz:0.92 gdtts:0.93 tmscore:0.96 rmsd:0.35 AHM:0.33 LBcontacta:0.91 LBcontactb:0.87 LHM:0.15
id:0.72 blosum:0.15 compass:0.21 pearson:0.68
Scaled scores:
dali:0.71 daliz:0.37 gdtts:0.54 tmscore:0.54 rmsd:0.74 AHM:0.70 LBcontacta:0.65 LBcontactb:0.68 LHM:0.37
id:0.01 blosum:0.03 compass:0.03 pearson:0.05

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:212.20)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldriggevARATSIVRYAP-GSRFSAHt     59
d1k5ja_        1 ----------------------------------------VSLIWGCELNEqNKTFEFK-     19

Query         60 hdGGEEF-IVLD--------gVFQDE-----HGDYP--------AGTY--VRNPptTSHV     95
d1k5ja_       20 -eHQLALrTVCLgdkakdefhIVEIVtqeekSVPIAtlkpsilpMATMvgIELT--PPVT     76

Query         96 PGSAE---gCTIFVKLWQfdpadrtqfsknm    123
d1k5ja_       77 FRLKAgsgpLYISGQHVA-------------     94


hit structure      alignment
FAST alignment (Normalized score: 1.63 Raw score:175.40)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRY---APGSRFSA     57
d1k5ja_        1 ----------------------------------------VSLIWGCELNEQNKTF----     16

Query         58 HTHDG---GEEFIVLD--------------GVFQDE-HGDYP---------------AGT     84
d1k5ja_       17 -----EFKEHQLALR-TVCLGDKAKDEFHIVEIVTQEEKSV-PIATLKPSILPMATMVGI     69

Query         85 YVRNPPTTS-HVPGSAEG--------CTIFVKLWQFDPADRTQFSKNM---    123
d1k5ja_       70 EL-------TPPVTF---RLKAGSGPLYISGQ----------------HVA     94


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:42.33)
Query          1 ---MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSA     57
d1k5ja_        1 VSL-----------------------IWG-C-E-LNEQ-------NKTFEFKEHQLAL-R     26

Query         58 HTHD---G----GEEFIVLDGVFQDEHGDYPAGTYVRNPP----T--TSHV-PGSAEGCT    103
d1k5ja_       27 TVCLGDKAKDEFHIVEIVTQ----------EEKSVPIATLKPSILPMATMVGIEL-TPPV     75

Query        104 IFVKLWQF-----------DPADRTQFSKNM    123
d1k5ja_       76 TFRLKAGSGPLYISGQHVA------------     94


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.46)
DALI match                        
Query          9 KPVVIDTDQLEWRPSPM     25
d1k5ja_       37 EFHIVEIVTQEEKSVPI     53



top
62: d1nx4a_ Carbapenem synthase,​ CarC (svm: 0.677)

SCOP Superfamily: Clavaminate synthase-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.37  Contact: 569
Modified z-scores:
dali:0.96 daliz:0.97 gdtts:0.97 tmscore:0.98 rmsd:0.29 AHM:0.32 LBcontacta:0.93 LBcontactb:0.86 LHM:0.25
id:0.63 blosum:0.23 compass:0.61 pearson:0.64
Scaled scores:
dali:0.76 daliz:0.48 gdtts:0.67 tmscore:0.66 rmsd:0.77 AHM:0.66 LBcontacta:0.65 LBcontactb:0.68 LHM:0.17
id:0.00 blosum:0.04 compass:0.06 pearson:0.07

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:278.30)
Query          1 ----------------------meinadftkpvvidtdqlewrpspmkgverrmldrigg     38
d1nx4a_        1 seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay     60

Query         39 eVARA--TSIVRY------apGSRFSAHTH-------DGGEEFIVLDG-----vfQDEH-     77
d1nx4a_       61 gTIVErdTLKLEGekgkivtgRGQLPFHADgglllsqVDQVFLYAAEIknvkfrgATTVc    120

Query         78 ------------------------------------------------------------     78
d1nx4a_      121 dhalacqempahllrvleeetfevrvlwfkvpvftdlgwvrkmliyfpfdegqpaswepr    180

Query         78 ----------------------------GDYPAGTYVRNPPT-TSHVPGSA----EGCTI    104
d1nx4a_      181 ivgftdhetqaffqelgaflkqpryyykHFWEDGDLLIMDNRrVIHEREEFndddIVRRL    240

Query        105 FVKLWQfdpadrtqfsknm    123
d1nx4a_      241 YRGQTA------------d    247


hit structure      alignment
FAST alignment (Normalized score: 1.99 Raw score:347.50)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR------------------     42
d1nx4a_        1 ------------------------------------------SEIVKFNPVMASGFGAYI     18

Query         43 ------------------------------------------------ATSIVRYAPG--     52
d1nx4a_       19 DHRDFLEAKTETIKNLLMRQGFVVVKNLDIDSDTFRDIYSAYGTIVERDTLKLEG---EK     75

Query         53 -------SRFSAHTH--------DGGEEFIVLDGVFQDE---------------------     76
d1nx4a_       76 GKIVTGRGQLPFHA-DGGLLLSQVDQVFLYAA-------EIKNVKFRGATTVCDHALACQ    127

Query         77 ------------------------------------------------------------     77
d1nx4a_      128 EMPAHLLRVLEEETFEVRVLWFKVPVFTDLGWVRKMLIYFPFDEGQPASWEPRIVGFTDH    187

Query         77 --------------------HGDYPAGTYVRN-PPTTSHVPGSA--------EGCTIFVK    107
d1nx4a_      188 ETQAFFQELGAFLKQPRYYYKHFWEDGDLLIMDNRRVIHE----REEFNDDDIVRRLYRG    243

Query        108 LWQFDPADRTQFSKNM----    123
d1nx4a_      244 ----------------QTAD    247


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:44.82)
Query          1 ------------------------------------------------------------      1
d1nx4a_        1 SEIVKFNPVMASGFGAYIDHRDFLEAKTETIKNLLMRQGFVVVKNLDIDSDTFRDIYSAY     60

Query          1 --MEINADFTKPVVIDTDQLEWRPSPMK--------GVERRMLDRIGGE--VARATSI-V     47
d1nx4a_       61 GT------------------------IVERDTLKLE--------GEKGKIVTGRGQLPFH     88

Query         48 RYA-----PGSRFSAHTHDG--G---EEFIVLDGV-------------------------     72
d1nx4a_       89 ADGGLLLSQVDQVFLYAAEIKNVKFRGATTVCDHALACQEMPAHLLRVLEEETFEVRVLW    148

Query         73 -------------------------------------------------------FQDEH     77
d1nx4a_      149 FKVPVFTDLGWVRKMLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGAFLKQP-----    203

Query         78 GDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQF-DPAD---------RTQFSKNM    123
d1nx4a_      204 ---RYYYKHFWE-DGDLLIMDNRRVIHEREEFNDDDIVRRLYRGQTAD--------    247


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.21)
DALI match       ***********
Query         79 DYPAGTYVRNP     89
d1nx4a_      210 FWEDGDLLIMD    220



top
63: d1sfpa_ Acidic seminal fluid protein (ASFP) (svm: 0.609)

SCOP Superfamily: Spermadhesin,​ CUB domain  |  SCOP Fold: CUB-​like  |  SCOP Class: All beta proteins

Consensus: 0.17  Contact: 542
Modified z-scores:
dali:0.85 daliz:0.76 gdtts:0.89 tmscore:0.93 rmsd:0.42 AHM:0.41 LBcontacta:0.91 LBcontactb:0.87 LHM:0.16
id:0.80 blosum:0.19 compass:0.19 pearson:0.66
Scaled scores:
dali:0.66 daliz:0.23 gdtts:0.44 tmscore:0.43 rmsd:0.73 AHM:0.67 LBcontacta:0.59 LBcontactb:0.65 LHM:0.37
id:0.02 blosum:0.05 compass:0.04 pearson:0.04

hit structure      alignment
DALI alignment (Z-score: 1.6 Raw score:179.20)
Query          1 meinadftkpvvidtdqlewrpspMKGVerrmldriggeVARATSIVRY--aPGSRF---     55
d1sfpa_        1 --------------------lprnTNCG-------gilkEESGVIATYYgpkTNCVWtiq     33

Query         56 sahthDGGEEF-IVLDG----VFQD--------EHGDYPAGTYVRNPP-TTSHVPGSAE-    100
d1sfpa_       34 mppeyHVRVSIqYLQLNcnkeSLEIidglpgspVLGKICEGSLMDYRSsGSIMTVKYIRe     93

Query        101 ----gcTIFVKLWqFDPAdrtqfsknm    123
d1sfpa_       94 pehpasFYEVLYFqDPQA---------    111


hit structure      alignment
FAST alignment (Normalized score: 2.42 Raw score:282.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVAR-------------ATSIV     47
d1sfpa_        1 ------------------------------------------LPRNTNCGGILKEESGVI     18

Query         48 RYA-------PGSRFSAHTHD----GGEEFIVLD--------GVFQD---------EHGD     79
d1sfpa_       19 ---ATYYGPKTNCV-WTIQ--MPPEYHVRVSIQ-YLQLNCNKESLE-IIDGLPGSPVLGK     70

Query         80 Y--PAGTYVRNPPT-TSHVPGS-------AEGCTIFVKLWQFDPADRTQFSKNM-----    123
d1sfpa_       71 ICEGSLMDYRSS--GSIMTVKYIREPEHPASFYEVLYF----------------QDPQA    111


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:46.42)
Query          1 ---MEINADFTKPVVIDTDQLEWRPSPMKGVER-RMLDRIG--GEVARATSIVRYA---P     51
d1sfpa_        1 LPRNTNC----------G--G-ILKE-ES-GVIA---TYYGPK----TNCVWTIQMPPEY     38

Query         52 GSRFSAHTHDGG----EEFIVLDG-VFQDEHGDYPAGTYVRNPPTTS-HVPGSAEGCTIF    105
d1sfpa_       39 HVRVSIQYLQLNCNKESLEIIDGLP---------GSPVLGKICE-GSLMDYRSSGSIMTV     88

Query        106 VKLWQF--D--P------------ADRTQFSKNM    123
d1sfpa_       89 KYI-REPEHPASFYEVLYFQDPQA----------    111


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.17)
DALI match                                                 
Query         83 GTYVRNPPTTSHVPGSAEG-CTIFVKLWQFDPADRTQFSKNM    123
d1sfpa_        8 GGILKEESGVIATYYGPKTNCVWTI-----QMPPEYHVRVSI     44



top
64: d1pg6a_ Hypothetical protein SPyM3 0169 (SPyM18 0222,​ SPS0176) (svm: 1.183)

SCOP Superfamily: TRAP-​like  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.00  Contact: 424
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.86 tmscore:0.89 rmsd:0.45 AHM:0.52 LBcontacta:0.83 LBcontactb:0.83 LHM:0.44
id:0.45 blosum:0.09 compass:0.44 pearson:0.94
Scaled scores:
dali:0.76 daliz:0.44 gdtts:0.47 tmscore:0.42 rmsd:0.67 AHM:0.55 LBcontacta:0.56 LBcontactb:0.71 LHM:0.04
id:-0.02 blosum:-0.04 compass:0.14 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 1.2 Raw score:194.30)
Query          1 meinadftkpvvidtdqlewrpspmkGVERRMLDriggevaRATSIVRYAPGSRfsahth     60
d1pg6a_        1 --------------------------RMRFTIDQ----nmqFPLVEIDLEHGGS---vyl     27

Query         61 dggEEFIVlDGVFQDEH--------gdypagtyvrnppTTSHVPGSAEGCTIFVKLWQ--    110
d1pg6a_       28 qqgSMVYH-TENVTLNTklnglgklvgaigrsmvsgesMFITQAMSNGDGKLALAPNTpg     86

Query        111 ----------fdpADRT-------------------------------------------    117
d1pg6a_       87 qivalelgekqyrLNDGaflaldgsaqykmerqniggglfvmtteglgtllansfgsikk    146

Query        118 ------------------------------------------------------------    118
d1pg6a_      147 itldggtmtidnahvvawsreldydihlengfmqsigtgegvvntfrghgeiyiqslnle    206

Query        118 ----qfsknm    123
d1pg6a_      207 qfagtlkryl    216


hit structure      alignment
FAST alignment (Normalized score: 0.88 Raw score:142.80)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRY-----------     49
d1pg6a_        1 -------------------------------------------------RMRFTIDQNMQ     11

Query         50 ------------------------------------------------------------     50
d1pg6a_       12 FPLVEIDLEHGGSVYLQQGSMVYHTENVTLNTKLNGLGKLVGAIGRSMVSGESMFITQAM     71

Query         50 -----------APGSRFSAHTHD-GGEEFIVLDGVFQDEHGDYPA---------------     82
d1pg6a_       72 SNGDGKLALAPNTPGQIVALELGEKQYRL----------------NDGAFLALDGSAQYK    115

Query         83 ---------GTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNM----------    123
d1pg6a_      116 MERQNIGGGLFVMTTEGLGTLLANSFGSI---------------------KKITLDGGTM    154

Query        124 ------------------------------------------------------------    124
d1pg6a_      155 TIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGHGEIYIQSLNLEQFAGTLKR    214

Query        124 --    124
d1pg6a_      215 YL    216


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:41.00)
Query          1 -----------------------MEINADFTKPVVIDTDQLEWRPSPM------------     25
d1pg6a_        1 RMRFTIDQNMQFPLVEIDLEHGG---------------------SVYLQQGSMVYHTENV     39

Query         26 KGVER------RMLDRIGG-EV--AR-ATS-----IVRYA---PGSRFSAHT--HDGGEE     65
d1pg6a_       40 TLNTKLNGLGK------LVGAIGRSMVSGESMFIT-QAMSNGDGKLALAPNTPG------     86

Query         66 FIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFD----PAD------    115
d1pg6a_       87 ---------QIVALELGEKQYRLND-GAFLAL---DGSAQYKM-ERQNIGGGLFVMTTEG    132

Query        116 -------------------------R--T-QFSKNM------------------------    123
d1pg6a_      133 LGTLLANSFGSIKKITLDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTF    192

Query        124 ------------------------    124
d1pg6a_      193 RGHGEIYIQSLNLEQFAGTLKRYL    216


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.43)
DALI match                        
Query         63 GEEFIVLDGVFQDEHGD     79
d1pg6a_       22 GGSVYLQQGSMVYHTEN     38



top
65: d1m7xa2 1,​4-​alpha-​glucan branching enzyme (svm: -1.634)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.36  Contact: 499
Modified z-scores:
dali:0.92 daliz:0.86 gdtts:0.91 tmscore:0.93 rmsd:0.53 AHM:0.61 LBcontacta:0.88 LBcontactb:0.87 LHM:0.23
id:0.80 blosum:0.25 compass:0.14 pearson:0.73
Scaled scores:
dali:0.69 daliz:0.32 gdtts:0.46 tmscore:0.44 rmsd:0.63 AHM:0.50 LBcontacta:0.56 LBcontactb:0.67 LHM:0.18
id:0.01 blosum:0.07 compass:0.07 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 2.5 Raw score:200.10)
Query          1 meinadftkpvvidtdQLEWRPSPM------kGVERRMLDRiggevaraTSIVRYAPG--     52
d1m7xa2        1 ----------------PYGFEWLVVddkersvLIFVRRDKE-------gNEIIVASNFtp     37

Query         53 -sRFSA-hthdgGEEFIVLDGV---fqdehGDYPaGTYVRNPPT-------tshvPGSA-     99
d1m7xa2       38 vpRHDYrfginqPGKWREILNTdsmhyhgsNAGN-GGTVHSDEIashgrqhslslTLPPl     96

Query        100 EGCTIFVKLwqfdpadrtqfsknm    123
d1m7xa2       97 ATIWLVREA--------------e    106


hit structure      alignment
FAST alignment (Normalized score: 2.09 Raw score:238.20)
Query          1 MEINADFTKPVVIDTDQL--EWRPSPMK----------GVERRMLDRIGGEVAR--ATSI     46
d1m7xa2        1 ------------------PYGFEW----LVVDDKERSVLIFVRRD---------KEGNEI     29

Query         47 VRYAPGSRFSAHTHDGG------------------EEFIVLDGVFQDEHGDYP-------     81
d1m7xa2       30 IVA--------------SNFTPVPRHDYRFGINQPGKWREI------------LNTDSMH     63

Query         82 -------AGTYVRNPPTTS----------HVPGS---AEGCTIFVKLWQFDPADRTQFSK    121
d1m7xa2       64 YHGSNAGNGGTVHSD----EIASHGRQHSLSLT-LPPLATIWLVRE--------------    104

Query        122 NM--    123
d1m7xa2      105 --AE    106


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:49.28)
Query          1 MEINADFTKPVVIDTDQL-EWRPSPMK---GVERRMLDR--IGGEVARATSIVRYA-PGS     53
d1m7xa2        1 -PYG-------------FE--WLVVDDKERSVLIFVRRDKEG-----NEIIVASNFTPVP     39

Query         54 RFSAH-----THDGGEEF-IVLDGVF----QDEHGDYPAGTYVRNPPTT----------S     93
d1m7xa2       40 RHDYRFGINQ--PGKWREILN-TDSMHYHG----SNAG---NGGTVHSDEIASHGRQHSL     89

Query         94 HVPGSAEGCTIFVKLWQFDPADRTQFSKNM    123
d1m7xa2       90 SLTLP-PLATIWLVR-EAE-----------    106


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match                                            
Query         11 VVIDTDQLEWR----PSPMKGVERRMLDRIGGEVARA     43
d1m7xa2       31 VASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGS     67



hit structures. 
top
66: d1gjwa1 Maltosyltransferase (svm: -1.748)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.62  Contact: 342
Modified z-scores:
dali:0.91 daliz:0.90 gdtts:0.91 tmscore:0.93 rmsd:0.40 AHM:0.44 LBcontacta:0.90 LBcontactb:0.86 LHM:0.14
id:0.73 blosum:0.22 compass:0.64 pearson:0.78
Scaled scores:
dali:0.77 daliz:0.45 gdtts:0.58 tmscore:0.52 rmsd:0.75 AHM:0.64 LBcontacta:0.72 LBcontactb:0.76 LHM:0.42
id:0.02 blosum:0.03 compass:0.01 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:189.40)
Query          1 meinadftkpvvidtdqLEWRPspmKGVERRMlDRIGgevARATSIVRYAP-GSRFsaht     59
d1gjwa1        1 --------------gkfENLTT---KDLVMYS-YEKN---GQKIVIAANVGkEPKE----     35

Query         60 hdggEEFIVldgvfqdehgdypaGTYVRNPpttshvPGSAeGCTIFVKLwqfdpadrtqf    119
d1gjwa1       36 -itgGRVWN--------------GKWSDEE----kvVLKP-LEFALVVQ-----------     64

Query        120 sknm    123
d1gjwa1       65 ----     65


hit structure      alignment
FAST alignment (Normalized score: 2.44 Raw score:216.50)
Query          1 MEINADFTKPVVIDTDQLEWRPSP-------MKGVERRMLDRIGGEV---ARATSIVRYA     50
d1gjwa1        1 ------------------------GKFENLTTKDLVMYSY-------EKNGQKIVIAANV     29

Query         51 PGSRFSAHTHDGG--------EEFIVLDGVFQDEHGDYPAGTYVRNPPTTS-HVPGSAE-    100
d1gjwa1       30 G------------KEPKEITGGRVW--------------NGKWSD------EEKVVLK-P     56

Query        101 GCTIFVKLWQFDPADRTQFSKNM--    123
d1gjwa1       57 LEFALV-----------------VQ     64


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:44.50)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDR-IGGEVARATSIVRYAPGSRFSAHT     59
d1gjwa1        1 -GKF--------------ENLTT--KDLVMYSYEKNG-----QKIVIAANVGKEPK-EI-     36

Query         60 HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQF    119
d1gjwa1       37 T--GGRVWN--------------GKWSDE---EKV-VLKP-LEFALVVQ-----------     64

Query        120 SKNM    123
d1gjwa1       65 ----     65


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.05)
DALI match       .         
Query         68 VLDGVFQDEH     77
d1gjwa1       41 VWNGKWSDEE     50



top
67: d1f53a_ Killer toxin-​like protein SKLP (svm: -1.353)

SCOP Superfamily: gamma-​Crystallin-​like  |  SCOP Fold: gamma-​Crystallin-​like  |  SCOP Class: All beta proteins

Consensus: 0.57  Contact: 392
Modified z-scores:
dali:0.92 daliz:0.90 gdtts:0.93 tmscore:0.95 rmsd:0.37 AHM:0.37 LBcontacta:0.87 LBcontactb:0.82 LHM:0.35
id:0.49 blosum:0.09 compass:0.64 pearson:0.61
Scaled scores:
dali:0.69 daliz:0.34 gdtts:0.50 tmscore:0.48 rmsd:0.72 AHM:0.65 LBcontacta:0.55 LBcontactb:0.60 LHM:0.04
id:-0.03 blosum:-0.01 compass:0.01 pearson:0.03

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:180.80)
Query          1 meinadftkpvvidtdqlewrpspmkGVER-----rmldriggeVARATSIVRYAPGSRF     55
d1f53a_        1 -------------------------iDHVPcrggenflkiwshsGGQQSVDCYANRGRID     35

Query         56 SAHthdggEEFIVLDGVFQD-----EHGDYPAGTYVRNPPTT-SHVPGSAEgctifvklw    109
d1f53a_       36 FGG--wwvDKISTGNNDLIYydangDSVRVDRWHDITYPNRPpKVNSIEIL---------     84

Query        110 qfdpadrtqfsknm    123
d1f53a_       85 --------------     85


hit structure      alignment
FAST alignment (Normalized score: 2.32 Raw score:236.10)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGE----------------VARAT     44
d1f53a_        1 ---------------------------IDHV--------PCRGGENFLKIWSHSGGQQSV     25

Query         45 SIVRYAP--GSRFSAHTHDGG-------EEFIVLDGVFQDE------HGDYPAGTYVRNP     89
d1f53a_       26 DCY----ANRGRI--------DFGGWWVDKISTGNNDLIY-YDANGDSVRVDRWHDITYP     72

Query         90 PTTS------HVPGSAEGCTIFVKLWQFDPADRTQFSKNM--    123
d1f53a_       73 ----NRPPKVNSIE--------------------------IL     84


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:46.51)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERR-ML----------DRIGGEVARATSIVRY     49
d1f53a_        1 -------------------------IDHVPCRGGENFLKIWSHS-----GGQQSVD-CYA     29

Query         50 APGSRFSAHTHDGGEEFIVLDGVFQDE----HG-DYPAGTYVRNPP-TTSHVPGSAEGCT    103
d1f53a_       30 NRGRIDFGGWW--VDKISTGNNDLIYYDANGDSVRVDRWHDITYPNRPPKVNSIEIL---     84

Query        104 IFVKLWQFDPADRTQFSKNM    123
d1f53a_       85 --------------------     85


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.36)
DALI match                        
Query        101 GCTIFVKLWQFDPADRT    117
d1f53a_        8 GGENFLKIWSHSGGQQS     24



top
68: d1ji2a2 Maltogenic amylase (svm: -2.026)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.28  Contact: 390
Modified z-scores:
dali:0.92 daliz:0.89 gdtts:0.93 tmscore:0.95 rmsd:0.39 AHM:0.44 LBcontacta:0.91 LBcontactb:0.87 LHM:0.21
id:0.81 blosum:0.35 compass:0.57 pearson:0.80
Scaled scores:
dali:0.71 daliz:0.39 gdtts:0.58 tmscore:0.53 rmsd:0.73 AHM:0.64 LBcontacta:0.66 LBcontactb:0.72 LHM:0.25
id:0.04 blosum:0.07 compass:0.04 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:213.00)
Query          1 meinadftkpvvidtdqLEWRPSPM-----kGVERRMLDRiggevaraTSIVRYAPG---     52
d1ji2a2        1 -----------------GNVRSWHAdkqanlYAFVRTVQD--------QHVGVVLNNrge     35

Query         53 sRFSA--hthdggEEFIVLDgvfqdehgdypAGTYVRNPPtTSHVPGS--AEGCTIFVKl    108
d1ji2a2       36 kQTVLlqvpesggKTWLDCL-----------TGEEVHGKQ-GQLKLTLrpYQGMILWNG-     82

Query        109 wqfdpadrtqfsknm    123
d1ji2a2       83 --------------r     83


hit structure      alignment
FAST alignment (Normalized score: 2.53 Raw score:255.60)
Query          1 MEINADFTKPVVIDTDQLEWRPSPM-----------KGVERRMLDRIGGEV----ARATS     45
d1ji2a2        1 -------------------------GNVRSWHADKQANLYAFV--------RTVQDQHVG     27

Query         46 IVRYAPGSR-----FSAHTHDGG-----EEFIVLDGVFQDEHGDYP-AGTYVRNPPTTSH     94
d1ji2a2       28 VVLNN----RGEKQTVLLQV---PESGGKTWLDC------------LTGEEVHG-KQGQL     67

Query         95 VPGSAEGCTIFVKLWQFDPADRTQFSKNM---    123
d1ji2a2       68 KLTLRPYQGMILW----------------NGR     83


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:46.07)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK-----GVERRMLDRIGGEVARATSIVRYA-P---     51
d1ji2a2        1 --GN----------------VRSWHADKQANLYAFVRTVQ------DQHVGVVLNNRGEK     36

Query         52 GSRFSAHTHDG-GEEFIVLDGVFQDEHGDYPAGTYVRNPPTTS-HVPGSAE--GCTIFVK    107
d1ji2a2       37 QTVLL-QVPESGGKTWLDCL-----------TGEEVHG---KQGQLKLTLRPYQGMILWN     81

Query        108 LWQFDPADRTQFSKNM    123
d1ji2a2       82 G-R-------------     83


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.39)
DALI match                                    
Query         41 ARATSIVRYAPGSRFSAHTHDGGEEFIVL     69
d1ji2a2        1 GNVRSWHADKQANLYAFVRTVQDQHVGVV     29



top
69: d7taaa1 Fungal alpha-​amylase (svm: -1.857)

SCOP Superfamily: Glycosyl hydrolase domain  |  SCOP Fold: Glycosyl hydrolase domain  |  SCOP Class: All beta proteins

Consensus: 0.26  Contact: 365
Modified z-scores:
dali:0.91 daliz:0.89 gdtts:0.86 tmscore:0.90 rmsd:0.41 AHM:0.53 LBcontacta:0.88 LBcontactb:0.83 LHM:0.16
id:0.58 blosum:0.16 compass:0.25 pearson:0.70
Scaled scores:
dali:0.75 daliz:0.41 gdtts:0.48 tmscore:0.45 rmsd:0.72 AHM:0.58 LBcontacta:0.63 LBcontactb:0.70 LHM:0.39
id:-0.01 blosum:0.01 compass:0.07 pearson:0.07

hit structure      alignment
DALI alignment (Z-score: 2.5 Raw score:202.00)
Query          1 meinadftkpvvidtdQLEWRPSpMKGVERRMLDRIggevARATSIVRYAPG--------     52
d7taaa1        1 ---------------yKNWPIYK-DDTTIAMRKGTD----GSQIVTILSNKGasgdsytl     40

Query         53 -srfsahthDGGEEFIVldgvfqdehgdypagTYVRNPPT---tshvPGSAeGCTIFVKL    108
d7taaa1       41 slsgagytaGQQLTEVI---------------GCTTVTVGsdgnvpvPMAG-GLPRVLYP     84

Query        109 wqfdpadrtqfsknm    123
d7taaa1       85 ----teklagskics     95


hit structure      alignment
FAST alignment (Normalized score: 2.30 Raw score:248.90)
Query          1 MEINADFTKPVVIDTDQLEWRPS-------PMKGVERRMLDRIGGEV---ARATSIVRY-     49
d7taaa1        1 -----------------------YKNWPIYKDDTTIAMRK-------GTDGSQIVTILSN     30

Query         50 -APGSRFSAHTHD-------------GGEEFIVLDGVFQDEHGDYP-AGTYVRNPPTTSH     94
d7taaa1       31 KGASG--------DSYTLSLSGAGYTAGQQLTEV------------IGCTTVTVGSDGNV     70

Query         95 VPGSAEGCTIFVKLWQFDPADRTQFSKNM-------------    123
d7taaa1       71 PVPMAGGLPRVL-----------------YPTEKLAGSKICS     95


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:48.39)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK----GVERRMLDRIGGEVARATSIVRYAP-G---     52
d7taaa1        1 -----------------YKNWPI-YKDDTTIAMRKGTD--------GSQIVTILSNKGAS     34

Query         53 ---SRFSAHT---HDGGEEFIVLDGVFQDEHGDYPAGTYVRNPPTTSHVPGS--AEGCTI    104
d7taaa1       35 GDSYTL-SLSGAGYTAGQQLTEVI-----------GCTTVTVGSDGNVPVPMAGGLPRVL     82

Query        105 FVK--------LWQFDPADRTQFSKNM    123
d7taaa1       83 YPTEKLAGSKI--------------CS     95


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.68)
DALI match                                                          
Query          8 TKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVR---YAPGSRF     55
d7taaa1        3 NWPIYKDDTTIAMRKGTDGSQIVTILSNKGASGDSYTLSLSGAGYTAGQQL     53



top
70: d1flca1 Hemagglutinin domain of haemagglutinin-​esterase-​fusion glycoprotein HEF1 (svm: -1.808)

SCOP Superfamily: Viral protein domain  |  SCOP Fold: Viral protein domain  |  SCOP Class: All beta proteins

Consensus: 0.44  Contact: 431
Modified z-scores:
dali:0.91 daliz:0.89 gdtts:0.93 tmscore:0.93 rmsd:0.35 AHM:0.40 LBcontacta:0.90 LBcontactb:0.87 LHM:0.25
id:0.59 blosum:0.20 compass:0.64 pearson:0.72
Scaled scores:
dali:0.72 daliz:0.37 gdtts:0.54 tmscore:0.50 rmsd:0.75 AHM:0.63 LBcontacta:0.62 LBcontactb:0.71 LHM:0.23
id:-0.01 blosum:0.03 compass:0.01 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 2.1 Raw score:239.00)
Query          1 meinadftkpvvidtdqlewrpspMKGVERRMLD-RIGGE--------------------     39
d1flca1        1 --------------------cmslVNALDKTIPLqVTAGTagncnnsflknpalytqevk     40

Query         40 ------varATSIVRYAP--------GSRFsaHTHD--------------GGEEFIVLdg     71
d1flca1       41 psenkcgkeNLAFFTLPTqfgtyeckLHLVasCYFIydskevynkrgcdnYFQVIYDS--     98

Query         72 vfqdehgdypAGTY-VRNP--------------pTTSHVPGSAeGCTIFVKLWQ--fdpa    114
d1flca1       99 ----------FGKVvGGLDnrvspytgnsgdtptMQCDMLQLK-PGRYSVRSSPrfllmp    147

Query        115 drtqfsknm    123
d1flca1      148 ersycfdmk    156


hit structure      alignment
FAST alignment (Normalized score: 1.34 Raw score:186.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSP------------MKGVERRMLDRIGGEVAR------     42
d1flca1        1 ------------------------CMSLVNALDKTIPLQVTAG-----------TAGNCN     25

Query         43 -----ATSIVRYAPGSRF--------------SAHTHD------------GGEEFIVLD-     70
d1flca1       26 NSFLKNPALYTQ------EVKPSENKCGKENLAFFT--LPTQFGTYECKLHLVASC---Y     74

Query         71 ----------------GVFQDEHGDYPA----------------------------GTYV     86
d1flca1       75 FIYDSKEVYNKRGCDNYFQV--------IYDSFGKVVGGLDNRVSPYTGNSGDTPTMQCD    126

Query         87 RN-PPTTSHVPGSAE--GCTIFVKLWQFDPADRTQFSKNM--------    123
d1flca1      127 MLQLKPGRYSVR---SSPRFLLMPE---------------RSYCFDMK    156


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:51.31)
Query          1 ----MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLD-RIGGE-------------VAR     42
d1flca1        1 CMSL------------------------VNALDKTIPLQVTAGTAGNCNNSFLKNPALYT     36

Query         43 -------------ATSIVRYAP------G--SRFSAHTHDG---------------GEEF     66
d1flca1       37 QEVKPSENKCGKENLAFFTLPTQFGTYECKLHLV-ASCYFIYDSKEVYNKRGCDNYFQVI     95

Query         67 IVLDGVFQDEHGDYPAGTYVRNP---------------PTTSHVPGSAEGCTIFVKLWQF    111
d1flca1       96 YDS------------FGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQL-KPGRYSVRS-SP    141

Query        112 DP-------------ADRTQFSKNM    123
d1flca1      142 RFLLMPERSYCFDMK----------    156


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.25)
DALI match                                 
Query         73 FQDEHGDYPAGTYVRNPPTTSHVPGS     98
d1flca1       75 FIYDSKEVYNKRGCDNYFQVIYDSFG    100



hit structures. 
top
71: d1k45a_ Carbohydrate binding module from a thermostable xylanase (svm: -1.556)

SCOP Superfamily: Galactose-​binding domain-​like  |  SCOP Fold: Galactose-​binding domain-​like  |  SCOP Class: All beta proteins

Consensus: 0.33  Contact: 626
Modified z-scores:
dali:0.89 daliz:0.83 gdtts:0.85 tmscore:0.90 rmsd:0.51 AHM:0.54 LBcontacta:0.92 LBcontactb:0.89 LHM:0.21
id:0.90 blosum:0.15 compass:0.63 pearson:0.66
Scaled scores:
dali:0.66 daliz:0.27 gdtts:0.39 tmscore:0.41 rmsd:0.65 AHM:0.56 LBcontacta:0.60 LBcontactb:0.66 LHM:0.28
id:0.03 blosum:0.03 compass:0.01 pearson:0.03

hit structure      alignment
DALI alignment (Z-score: 2.2 Raw score:270.20)
Query          1 meinadftkpvvidtdqLEWR--------------pspmKGVERRMLDRIggevARATSI     46
d1k45a_        1 --mlvaninggfestpaGVVTdlaegvegwdlnvgssvtNPPVFEVLETSdapeGNKVLA     58

Query         47 VRYAPG---srfsAHTHD-----------gGEEFIVLDgVFQD---------------EH     77
d1k45a_       59 VTVNGVgnnpwdiEATAFpvnvrpgvtytyTIWARAEQdGAVVsftvgnqsfqeygrlHE    118

Query         78 GDYPAgTYVRNP-----------pTTSHVPGSA--EGCTIFVKLwqFDPAdrtqfsknm    123
d1k45a_      119 QQITT-EWQPFTfeftvsdqetviRAPIHFGYAanVGNTIYIDG-lAIAS-------qp    168


hit structure      alignment
FAST alignment (Normalized score: 1.93 Raw score:277.90)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMK----------------------------------     26
d1k45a_        1 --------------------------MLVANINGGFESTPAGVVTDLAEGVEGWDLNVGS     34

Query         27 ----GVERRMLDRIGGEVAR---------ATSIVRYAP-------GSRFSAHTHD-----     61
d1k45a_       35 SVTNPPVFEVL---------ETSDAPEGNKVLAVTVN-GVGNNPWDIEA------TAFPV     78

Query         62 ---------GGEEFIVLD--GVFQDE---------------HGDYPAGTYVRNPPTT---     92
d1k45a_       79 NVRPGVTYTYTIWARAEQDGAVVS--FTVGNQSFQEYGRLHEQQITT-EWQPFT---FEF    132

Query         93 ---------SHVPGSAE------GCTIFVKLWQFDPADRTQFSKNM---------    123
d1k45a_      133 TVSDQETVIRAPIHF--GYAANVGNTIYI-----------------DGLAIASQP    168


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:50.28)
Query          1 -------------------MEINADFTKPVVIDTDQLEWRPSPMKGVERRML--DRIGGE     39
d1k45a_        1 MLVANINGGFESTPAGVVT------------------DLAEG-VEGWDLNVGSSVTNPPV     41

Query         40 ------------------VAR-------ATSIVRYAPG--------SRFSAHTH--D-GG     63
d1k45a_       42 FEVLETSDAPEGNKVLAVTVNGVGNNPWDIEATAFPVNVRPGVTYT-YTIWARAEQDGAV    100

Query         64 EEFIVLDG---VFQDEHGDYPAG-TYVRNPPT--TSHVP---------GSAEGCTIFVKL    108
d1k45a_      101 VSFTV-GNQSF---------QEYGRLHEQQITTEWQPFTFEFTVSDQE--TVIRAPIHFG    148

Query        109 WQFDP---------------ADRTQFSKNM    123
d1k45a_      149 YAANVGNTIYIDGLAIASQP----------    168


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.22)
DALI match                      
Query         76 EHGDYPAGTYVRNPP     90
d1k45a_       26 EGWDLNVGSSVTNPP     40



top
72: d1gwma_ Non-​catalytic protein 1,​ Ncp1 (svm: -1.180)

SCOP Superfamily: Galactose-​binding domain-​like  |  SCOP Fold: Galactose-​binding domain-​like  |  SCOP Class: All beta proteins

Consensus: 0.41  Contact: 544
Modified z-scores:
dali:0.93 daliz:0.92 gdtts:0.90 tmscore:0.93 rmsd:0.40 AHM:0.40 LBcontacta:0.92 LBcontactb:0.90 LHM:0.25
id:0.98 blosum:0.67 compass:0.65 pearson:0.91
Scaled scores:
dali:0.72 daliz:0.39 gdtts:0.47 tmscore:0.49 rmsd:0.74 AHM:0.66 LBcontacta:0.65 LBcontactb:0.74 LHM:0.30
id:0.11 blosum:0.14 compass:0.03 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 2.7 Raw score:258.90)
Query          1 meinadftkpvvidtdqlewrpSPMKGVERRMLDriggevarATSIVRYAPGS-------     53
d1gwma_        1 mnvratytvifknasglpngydNWGWGCTLSYYG--------GAMIINPQEGKygavslk     52

Query         54 --rfsahthdgGEEFIVlDGVFQD-----------EHGDYPAG-tYVRNP-------ptt     92
d1gwma_       53 rnsgsfrggslRFDMKN-EGKVKIlvenseadekfEVETISPSdeYVTYIldvdfdlpfd    111

Query         93 SHVPGS--AEGCTIFVKLWQ------fdPADR---tqfsknm    123
d1gwma_      112 RIDFQDapGNGDRIWIKNLVhstgsaddFVDPinlehhhhhh    153


hit structure      alignment
FAST alignment (Normalized score: 3.06 Raw score:419.30)
Query          1 MEINADFTKPVVIDTDQLEWRP----------------------SPMKGVERRMLDRIGG     38
d1gwma_        1 ----------------------MNVRATYTVIFKNASGLPNGYDNWGWGCTLSYY-----     33

Query         39 EVAR-ATSIVRYAP--GSRFSAHTHDG--------------GEEFIVLDGVFQD------     75
d1gwma_       34 ----GGAMIINPQEGKYGAV-------SLKRNSGSFRGGSLRFDMK-NEGKVK-ILVENS     80

Query         76 ------EHGDYPA----GTYVRNPPTTS---------HVPGS--AEGCTIFVKLW---QF    111
d1gwma_       81 EADEKFEVETIS-PSDEYVTYILD----VDFDLPFDRIDFQDAPGNGDRIWI---KNLVH    132

Query        112 DPADRTQFSKNM------------------    123
d1gwma_      133 STG---------SADDFVDPINLEHHHHHH    153


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:46.69)
Query          1 ---------------MEINADFTKPVVIDTDQLEWRPSPMKGVERR-M--LDRIGGE-VA     41
d1gwma_        1 MNVRATYTVIFKNAS--------------------GLPN---GYDNWGWGCTLSYYGGAM     37

Query         42 RA--------TSIVRY--APGSRFSAHTHDGG---EEFIVLDGV---FQDEHGDYPAGTY     85
d1gwma_       38 IINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILV-ENSEAD--------EKFEV     88

Query         86 VRNP-P---TTSHVPG-S-AEGCTIFVKL-----WQF-----------------------    111
d1gwma_       89 ETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPINLEH    148

Query        112 -----DPADRTQFSKNM    123
d1gwma_      149 HHHHH------------    153


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.31)
DALI match                          
Query         14 DTDQLEWRPSPMKGVERRM     32
d1gwma_      109 PFDRIDFQDAPGNGDRIWI    127



top
73: d1hn0a2 Chondroitin ABC lyase I,​ N-​terminal domain (svm: -1.468)

SCOP Superfamily: Galactose-​binding domain-​like  |  SCOP Fold: Galactose-​binding domain-​like  |  SCOP Class: All beta proteins

Consensus: 0.39  Contact: 646
Modified z-scores:
dali:0.92 daliz:0.87 gdtts:0.93 tmscore:0.96 rmsd:0.50 AHM:0.55 LBcontacta:0.89 LBcontactb:0.90 LHM:0.20
id:0.78 blosum:0.21 compass:0.54 pearson:0.89
Scaled scores:
dali:0.69 daliz:0.29 gdtts:0.46 tmscore:0.48 rmsd:0.68 AHM:0.57 LBcontacta:0.51 LBcontactb:0.64 LHM:0.32
id:0.01 blosum:0.06 compass:0.08 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:241.20)
Query          1 --------------------MEINadftkpvvidtdqlewrpSPMK-GVERRMLDrigge     39
d1hn0a2        1 atsnpafdpknlmqseiyhfAQNN--------------pladFSSDkNSILTLSD-krsi     45

Query         40 VARATSIVRYAPGSR-------------------fsahthdgGEEFIVLD---gvFQDE-     76
d1hn0a2       46 MGNQSLLWKWKGGSSftlhkklivptdkeaskawgrsstpvfSFWLYNEKpidgyLTIDf    105

Query         77 --------------HGDYPAGTYVRNPPT--------tsHVPGSAE---GCTIFVKLwqF    111
d1hn0a2      106 geklistseaqagfKVKLDFTGWRAVGVSlnndlenvdsIRFKAPSnvsQGEIYIDR-iM    164

Query        112 DPA----dRTQF----sknm    123
d1hn0a2      165 FSVddaryQWSDyqvktrls    184


hit structure      alignment
FAST alignment (Normalized score: 2.62 Raw score:393.60)
Query          1 MEINADFTKPVVIDTDQLEWRPSP-------------------------------MKGVE     29
d1hn0a2        1 ------------------------ATSNPAFDPKNLMQSEIYHFAQNNPLADFSSDKNSI     36

Query         30 RRMLDRIGGEVA--------RATSIVRYAPGSRFSAHTHD--------------------     61
d1hn0a2       37 LTL---------SDKRSIMGNQSLLWKWKGGSSF------TLHKKLIVPTDKEASKAWGR     81

Query         62 -----GGEEFIVLD---GVFQDE---------------HGDYPA---GTYVRNPPTTS--     93
d1hn0a2       82 SSTPVFSFWLYNEKPIDGYLT--IDFGEKLISTSEAQAGFKVK-LDFTGWRAV-----GV    133

Query         94 -----------HVPGS----AEGCTIFVKLWQ-------FDPADRTQFSKNM--------    123
d1hn0a2      134 SLNNDLENVDSIRFK-APSNVSQGEIYI----DRIMFSVDDARYQWS-----DYQVKTRL    183

Query        124 -    124
d1hn0a2      184 S    184


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:56.68)
Query          1 ME------------------INADFTKPVVIDT-DQLEWRP-SPMK--GVERR------M     32
d1hn0a2        1 ATSNPAFDPKNLMQSEIYHF------------AQ--NNPLADFSSDKNSILTLSDKRSI-     45

Query         33 LDRIGGEVARAT-SIVRYAPG-SRFS-AH-----TH---------------DGGEEFIVL     69
d1hn0a2       46 ----------MGNQSLLWKWKGGSSFT-LHKKLI-VPTDKEASKAWGRSSTPVFSFWLYN     93

Query         70 DGVF--QD------------------EHGDYPAGTYVRNPPT--TSH------VPGS---     98
d1hn0a2       94 EKPIDGYLTIDFGEKLISTSEAQAGFKVKLDFTGWRAVGVSLNNDLENVDSIRFKAPSNV    153

Query         99 -AEGCTIFVKLWQFDPAD-RTQFSK------NM    123
d1hn0a2      154 SQGEIYIDRIMFSVDDARYQWSDYQVKTRLS--    184


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.17)
DALI match                            ****........     ***************    
Query          3 INADFTKPVVIDTDQLEWRP-SPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAH     58
d1hn0a2        8 DPKNLMQSEIYHFAQNNPLADFSSDKNSILTLSDKRSIMGNQSLLWKWKGGSSFTLH     64



top
74: d1ig3a1 Thiamin pyrophosphokinase,​ substrate-​binding domain (svm: -1.785)

SCOP Superfamily: Thiamin pyrophosphokinase,​ substrate-​binding domain  |  SCOP Fold: Double-​stranded beta-​helix  |  SCOP Class: All beta proteins

Consensus: 0.35  Contact: 460
Modified z-scores:
dali:0.85 daliz:0.81 gdtts:0.89 tmscore:0.91 rmsd:0.40 AHM:0.38 LBcontacta:0.88 LBcontactb:0.83 LHM:0.13
id:0.62 blosum:0.12 compass:0.33 pearson:0.84
Scaled scores:
dali:0.66 daliz:0.28 gdtts:0.47 tmscore:0.42 rmsd:0.70 AHM:0.64 LBcontacta:0.60 LBcontactb:0.65 LHM:0.39
id:-0.01 blosum:0.01 compass:0.09 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 2.0 Raw score:181.00)
Query          1 meinadftkpvvidtdqlewrpspmkgverrmldriggevARATSIVRYapgsRFSAHT-     59
d1ig3a1        1 ----------------------------------------DSLIYLLQP----GKHRLHv     16

Query         60 ----hdGGEEFIV-LDGV--FQDE------HGDYPAG--TYVR-NPPTT--SHVPGSaeg    101
d1ig3a1       17 dtgmegSWCGLIPvGQPCnqVTTTglkwnlTNDVLGFgtLVSTsNTYDGsgLVTVET--d     74

Query        102 CTIFVKLWQfdpadrtqfsknm    123
d1ig3a1       75 HPLLWTMAI-----------ks     85


hit structure      alignment
FAST alignment (Normalized score: 2.18 Raw score:223.30)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRF--SAH     58
d1ig3a1        1 ------------------------------------------DSLIYLLQP----GKHRL     14

Query         59 THD------GGEEFIVLDG---VFQDE--------HGDYPAGTY-----VRNPPT----T     92
d1ig3a1       15 HV-DTGMEGSWCGLIPVGQPCNQVTT-TGLKWNLTNDVLGF---GTLVSTSNT--YDGSG     67

Query         93 SHVPGSAEGCTIFVKLWQFDPADRTQFSKNM--    123
d1ig3a1       68 LVTVETDHPLLWTMAI---------------KS     85


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:46.09)
Query          1 MEINADFTKPVVIDTDQLEWRPSPMKGVERRMLDRIGGEVARATSIVRYAPGSRFSAHTH     60
d1ig3a1        1 ---------------------------------D---------SLIYLLQP-GKHR-LHV     16

Query         61 D-G-G-EEFIVLD---GV--FQDE----H-G-DYPA----GTY-VRNPPTT-SHVPGSAE    100
d1ig3a1       17 DTGMEGSWCGLIPVGQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYD-GSGLVTVETDH     75

Query        101 GCTIFVKLWQFDPADRTQFSKNM    123
d1ig3a1       76 PLLWTMAI-KS------------     85


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.67)
DALI match                                     
Query         21 RPSPMKGVERRMLDRIGGEVARATSIVRYA     50
d1ig3a1       16 VDTGMEGSWCGLIPVGQPCNQVTTTGLKWN     45