HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T0611d2
Query:
T0611_Ad2.pdb
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1ui5a2 A-​factor receptor homolog CprB Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 7.72 1.372 0.32 10.2 8.3 0.61
2 d1t56a2 Ethr repressor Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 7.41 1.356 0.73 9.2 8.6 0.56
3 d1vi0a2 Hypothetical transcriptional regulator YsiA Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 7.13 1.375 0.79 8.6 8.0 0.54
4 d1rkta2 Hypothetical transcriptional regulator YfiR Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 6.64 1.098 0.76 8.3 8.4 0.54
5 d1jt6a2 Multidrug binding protein QacR Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 6.64 1.100 0.01 9.1 9.1 0.55
6 d1t33a2 Putative transcriptional repressor YbiH Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 6.23 1.098 0.22 8.2 7.3 0.55
7 d1pb6a2 Hypothetical transcriptional regulator YcdC Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 5.30 1.019 0.84 5.2 6.1 0.49
8 d1sgma2 Putative transcriptional regulator YxaF Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 5.23 1.375 0.16 6.6 7.9 0.49
9 d2tcta2 Tetracyclin repressor (Tet-​repressor,​ TetR) Tetracyclin repressor-​like,​ C-​terminal domain Tetracyclin repressor-​like,​ C-​terminal domain All α 3.75 0.789 0.06 6.8 1.8 0.47
10 d1f7ca_ Graf GTPase activation domain,​ GAP GTPase activation domain,​ GAP All α 2.822 -0.730 0.02 4.0 2.6 0.34
11 d1t11a1 Trigger factor,​ C-​terminal domain TF C-​terminus (Pfam 05698) TF C-​terminus (Pfam 05698) All α 2.685 -0.933 0.08 3.6 2.6 0.38
12 d1kf6a1 Fumarate reductase Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain Spectrin repeat-​like All α 2.683 -1.098 0.01 4.5 3.9 0.43
13 d1bg1a1 STAT3b STAT STAT-​like All α 2.663 -0.539 0.41 5.6 2.8 0.46
14 d1neka1 Succinate dehydogenase Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain Spectrin repeat-​like All α 2.615 -0.780 0.01 4.4 3.8 0.43
15 d1owaa_ Spectrin alpha chain Spectrin repeat Spectrin repeat-​like All α 2.438 -0.475 0.08 6.4 2.9 0.40
16 d1s35a2 Spectrin beta chain Spectrin repeat Spectrin repeat-​like All α 2.430 -1.208 0.06 5.7 3.7 0.42
17 d1j1ja_ Translin Translin alpha-​alpha superhelix All α 2.396 -1.365 0.06 3.9 3.6 0.41
18 d1cuna1 Spectrin alpha chain Spectrin repeat Spectrin repeat-​like All α 2.391 -1.236 0.05 6.3 3.0 0.44
19 d1n5ua1 Serum albumin Serum albumin-​like Serum albumin-​like All α 2.389 -1.162 0.01 4.9 2.7 0.41
20 d1n5ua2 Serum albumin Serum albumin-​like Serum albumin-​like All α 2.382 -0.344 0.01 5.0 2.5 0.40
21 d1jnra1 Adenylylsulfate reductase A subunit Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain Spectrin repeat-​like All α 2.364 -1.493 0.01 4.4 4.0 0.44
22 d1iq0a1 Arginyl-​tRNA synthetase (ArgRS) Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases All α 2.352 -0.843 0.03 5.1 2.0 0.43
23 d1a5ta1 delta prime subunit DNA polymerase III clamp loader subunits,​ C-​terminal domain DNA polymerase III clamp loader subunits,​ C-​terminal domain All α 2.349 -0.771 0.03 4.2 3.0 0.42
24 d1n1ba2 (+)-​bornyl diphosphate synthase Terpenoid synthases Terpenoid synthases All α 2.314 -0.756 0.02 4.7 1.7 0.51
25 d1s35a1 Spectrin beta chain Spectrin repeat Spectrin repeat-​like All α 2.310 -1.119 0.14 5.8 3.3 0.41
26 d1hs7a_ Vam3p N-​terminal domain t-​snare proteins STAT-​like All α 2.307 -0.482 0.03 6.0 4.8 0.43
27 d1fcya_ Retinoic acid receptor gamma (RAR-​gamma) Nuclear receptor ligand-​binding domain Nuclear receptor ligand-​binding domain All α 2.261 -0.588 0.16 4.1 1.8 0.51
28 d1ivsa2 Valyl-​tRNA synthetase (ValRS) Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases All α 2.238 -0.841 0.29 4.2 2.7 0.41
29 d1pbwa_ p85 alpha subunit RhoGAP domain GTPase activation domain,​ GAP GTPase activation domain,​ GAP All α 2.230 -0.975 0.02 3.1 3.2 0.45
30 d1fx8a_ Glycerol uptake facilitator protein GlpF Aquaporin-​like Aquaporin-​like mem 2.212 -0.890 0.01 3.0 3.1 0.50
31 d1ls1a1 Signal sequence recognition protein Ffh Domain of the SRP/​SRP receptor G-​proteins Four-​helical up-​and-​down bundle All α 2.202 -1.046 0.04 3.8 3.4 0.31
32 d1fioa_ Sso1 t-​snare proteins STAT-​like All α 2.171 -0.245 0.32 4.5 3.4 0.44
33 d1hf8a1 Clathrin assembly lymphoid myeloid leukaemia protein,​ Calm GAT-​like domain Spectrin repeat-​like All α 2.161 0.537 0.03 5.5 3.2 0.40
34 d1quua2 alpha-​actinin Spectrin repeat Spectrin repeat-​like All α 2.127 -1.049 0.05 5.1 2.4 0.33
35 d1pq1a_ Apoptosis regulator Bcl-​xL Bcl-​2 inhibitors of programmed cell death Toxins'​ membrane translocation domains mem 2.121 -0.870 0.04 3.5 2.5 0.40
36 d1mija_ Homeo-​prospero domain of Prospero protein Homeodomain-​like DNA/​RNA-​binding 3-​helical bundle All α 2.110 -1.321 0.01 3.1 2.3 0.40
37 d1sxja1 Replication factor C1 DNA polymerase III clamp loader subunits,​ C-​terminal domain DNA polymerase III clamp loader subunits,​ C-​terminal domain All α 2.099 -1.173 0.01 2.8 2.2 0.40
38 d1hx1b_ BAG-​family molecular chaperon regulator-​1,​ BAG1 BAG domain Spectrin repeat-​like All α 2.092 -0.169 0.02 6.2 2.7 0.39
39 d1m62a_ Silencer of death domains,​ Sodd (Bag4) BAG domain Spectrin repeat-​like All α 2.09 0.664 0.01 5.5 3.2 0.36
40 d1nq7a_ Orphan nuclear receptor ROR-​beta Nuclear receptor ligand-​binding domain Nuclear receptor ligand-​binding domain All α 2.083 -0.477 0.07 3.4 4.1 0.49
41 d1quua1 alpha-​actinin Spectrin repeat Spectrin repeat-​like All α 2.081 -1.138 0.21 5.0 2.5 0.42
42 d1hcia1 alpha-​actinin Spectrin repeat Spectrin repeat-​like All α 2.076 -1.076 0.05 4.9 3.0 0.34
43 d1kxpd2 Vitamin D binding protein Serum albumin-​like Serum albumin-​like All α 2.074 -1.157 0.01 3.9 2.1 0.42
44 d1gnwa1 Class phi GST Glutathione S-​transferase (GST),​ C-​terminal domain Glutathione S-​transferase (GST),​ C-​terminal domain All α 2.058 -1.348 0.08 4.4 2.7 0.33
45 d1us7b_ Hsp90 co-​chaperone CDC37 Hsp90 co-​chaperone CDC37 Hsp90 co-​chaperone CDC37 All α 2.048 -1.547 0.03 2.8 3.6 0.40
46 d1j4na_ Aquaporin-​1 Aquaporin-​like Aquaporin-​like mem 2.044 -0.799 0.01 2.7 3.0 0.48
47 d1oedc_ Acetylcholine receptor protein,​ delta chain Neurotransmitter-​gated ion-​channel transmembrane pore Neurotransmitter-​gated ion-​channel transmembrane pore mem 2.020 -1.188 0.03 5.0 4.4 0.37
48 d1n5ua3 Serum albumin Serum albumin-​like Serum albumin-​like All α 2.009 -1.185 0.01 4.7 2.7 0.39
49 d1okta1 Pf GST Glutathione S-​transferase (GST),​ C-​terminal domain Glutathione S-​transferase (GST),​ C-​terminal domain All α 2.004 -1.453 0.03 4.1 2.5 0.39
50 d1aw9a1 Class phi GST Glutathione S-​transferase (GST),​ C-​terminal domain Glutathione S-​transferase (GST),​ C-​terminal domain All α 2.001 -1.286 0.07 4.5 2.3 0.39
51 d1cuna2 Spectrin alpha chain Spectrin repeat Spectrin repeat-​like All α 1.99 0.671 0.06 5.8 2.3 0.42
52 d1ugoa_ BAG-​family molecular chaperone regulator-​5,​ BAG-​5 BAG domain Spectrin repeat-​like All α 1.75 0.671 0.02 4.3 2.5 0.39
53 d1lkia_ Leukemia inhibitory factor (LIF) 4-​helical cytokines 4-​helical cytokines All α 1.02 0.672 0.01 2.4 2.3 0.36
SCOP domains with score worse than the threshold
54 d1vhma_ Hypothetical protein YebR GAF domain-​like Profilin-​like α+β 2.00 -0.478 0.03 3.5 2.9 0.35
55 d1v4aa2 Glutamine synthase adenylyltransferase GlnE,​ N-​terminal domain Nucleotidyltransferase Nucleotidyltransferase α+β 1.98 -0.925 0.03 2.8 3.4 0.40
56 d1chua1 L-​aspartate oxidase Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain Spectrin repeat-​like All α 1.97 -1.275 0.01 4.7 2.2 0.40
57 d1oe8a1 Class alpha GST Glutathione S-​transferase (GST),​ C-​terminal domain Glutathione S-​transferase (GST),​ C-​terminal domain All α 1.96 -1.172 0.04 4.8 1.7 0.41
58 d1m5ya1 Porin chaperone SurA,​ peptide-​binding domain Porin chaperone SurA,​ peptide-​binding domain Porin chaperone SurA,​ peptide-​binding domain All α 1.94 -0.621 0.15 3.1 2.1 0.33
59 d1kxpd1 Vitamin D binding protein Serum albumin-​like Serum albumin-​like All α 1.94 -1.364 0.01 3.8 2.9 0.37
60 d1hcia4 alpha-​actinin Spectrin repeat Spectrin repeat-​like All α 1.92 -0.607 0.10 5.1 2.6 0.40
61 d1f5na1 Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain All α 1.92 -0.700 0.38 3.7 2.8 0.41
62 d1n46a_ Thyroid hormone receptor beta (TR-​beta) Nuclear receptor ligand-​binding domain Nuclear receptor ligand-​binding domain All α 1.91 -0.368 0.12 3.7 1.6 0.49
63 d1rc2a_ Aquaporin Z Aquaporin-​like Aquaporin-​like mem 1.89 -0.987 0.02 3.0 2.6 0.48


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1ui5a2 A-​factor receptor homolog CprB (svm: 1.372)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.77  Contact: 766
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:1.00 tmscore:1.00 rmsd:0.33 AHM:0.37 LBcontacta:0.98 LBcontactb:0.99 LHM:0.10
id:0.92 blosum:0.14 compass:0.64 pearson:1.00
Scaled scores:
dali:0.70 daliz:0.48 gdtts:0.59 tmscore:0.69 rmsd:0.80 AHM:0.71 LBcontacta:0.35 LBcontactb:0.41 LHM:0.55
id:0.00 blosum:0.06 compass:0.06 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 10.2 Raw score:639.30)
Query          1 fqeyeklvdyyldipedrpITLEDMTFYLESVFDGLWS---YRFFHRDL-EYLLdsdprL     56
d1ui5a2        1 ------------------ySSLEALMRLTFGMARLCVQgpvLRAGLRLAtAGVP-----V     37

Query         57 RQDyREFTNRCLAAINRIFAKLADAGIIQPQPedLRSAMSLNVWLVITNWMAFlktahlt    116
d1ui5a2       38 RPL-PHPFTEWREIATSRLLDAVRQSDVHQDI--DVDSVAHTLVCSVVGTRVV-------     87

Query        117 ELKQGIYQVLTLEV-PYLTPEYRERVLALREKYRP--    150
d1ui5a2       88 REPRRLAEMWYILIrGMVPVTRRARYVTLAARLEQet    124


hit structure      alignment
FAST alignment (Normalized score: 8.29 Raw score:1131.00)
Query          1 FQEYEKLVDYYLDIPEDRPI--TLEDMTFYLESVFDGLWS---YRFFHRDLEYLLDSDPR     55
d1ui5a2        1 --------------------YSSLEALMRLTFGMARLCVQGPVLRAGLRLAT--------     32

Query         56 LRQDYR---------EFTNRCLAAINRIFAKLADAGIIQPQPED---LRSAMSLNVWLVI    103
d1ui5a2       33 ------AGVPVRPLPHPFTEWREIATSRLLDAVRQSDVH-----QDIDVDSVAHTLVCSV     81

Query        104 TNWMAFLKTA------HLTEL-KQGIYQVLTLEVPYLTPEYRERVLALREKYRP-----    150
d1ui5a2       82 ----------VGTRVVREPRRLAEMWYILI---RGMVPVTRRARYVTLAAR---LEQET    124


hit structure      alignment
TMalign alignment (TM-score: 0.61 Raw score:90.97)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLW-S--YRFFHRD-LEYLLDSDPRL     56
d1ui5a2        1 -----------------YSSLE-ALMRLTFGMARLCVQGPVLRAGLRLATA-GV---P-V     37

Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAF-LKTAHL    115
d1ui5a2       38 RPLPH-PFTEWREIATSRLLDAVRQSDVHQDI--DVDSVAHTLVCSVVGT-RVV------     87

Query        116 TELKQGIYQVL-TLEVPYLTPEYRERVLALREK-YR--P    150
d1ui5a2       88 -REPRRLAEMWYILIRGMVPVTRRARYVTLAARLEQET-    124


hit structure      alignment
HHsearch alignment (Probability: 0.32 E-value:0.01)
DALI match                                     *************************. . .
Query         46 LEYLLDSDPRLRQDYREF------------TNRCLAAINRIFAKLADAGIIQPQPEDLRS     93
d1ui5a2       14 MARLCVQGPVLRAGLRLATAGVPVRPLPHPFTEWREIATSRLLDAVRQSDVHQDIDVD-S     72

DALI match           ............   .   ....    ******.............
Query         94 AMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLA    143
d1ui5a2       73 ----VAHTLVCSVVGTRVVREPRRLAE----MWYILIRGMVPVTRRARYV    114



top
2: d1t56a2 Ethr repressor (svm: 1.356)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.61  Contact: 644
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.31 AHM:0.45 LBcontacta:0.99 LBcontactb:0.99 LHM:0.19
id:0.95 blosum:0.27 compass:0.55 pearson:1.00
Scaled scores:
dali:0.71 daliz:0.50 gdtts:0.57 tmscore:0.67 rmsd:0.80 AHM:0.68 LBcontacta:0.38 LBcontactb:0.46 LHM:0.42
id:0.02 blosum:0.08 compass:0.13 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 9.2 Raw score:578.80)
Query          1 fqeyeklvdyyldipedrpiTLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY     60
d1t56a2        1 ----------------adtdRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELW     44

Query         61 REFTNRCLAAINRIFAKLADAGIIQPQPedLRSAMSLNVWLVITNWMAFL--KTAH---L    115
d1t56a2       45 STFMQKWIAYTAAVIDAERDRGAAPRTL--PAHELATALNLMNERTLFASfaGEQPsvpE    102

Query        116 TELK-QGIYQVLTLEVPYltpeyrervlalrekyrp    150
d1t56a2      103 ARVLdTLVHIWVTSIYGE------------------    120


hit structure      alignment
FAST alignment (Normalized score: 8.62 Raw score:1156.00)
Query          1 FQEYEKLVDYYLDIPEDRPI----TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRL     56
d1t56a2        1 --------------------ADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEV     40

Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQ--PEDLRSAMSLNVWLVITNWMAFLKTAH    114
d1t56a2       41 AELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASF-------     93

Query        115 LTE--------LKQGIYQVLTLEVPYLTPEYRERVLALREKYRP-----    150
d1t56a2       94 ---AGEQPSVPEARVLDTLVHIWVT-------------------SIYGE    120


hit structure      alignment
TMalign alignment (TM-score: 0.56 Raw score:84.62)
Query          1 FQEYEKLVDYYLDIPEDRPITL-EDMTFYLESVFDGLWSYRFFHRD-LEYLLDSDPRLRQ     58
d1t56a2        1 -----------------ADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVE-VAE     42

Query         59 DYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNW-MAFL-K-TAH-    114
d1t56a2       43 LWSTFMQKWIAYTAAVIDAERDRGAAPRTL--PAHELATALNLMNERTLFASFAGEQPSV    100

Query        115 LTELKQGI-YQVLTLEVPYLTPEYRERVLALREKYRP    150
d1t56a2      101 --PEARVLDTLVHIWVTSIYGE---------------    120


hit structure      alignment
HHsearch alignment (Probability: 0.73 E-value:0.00)
DALI match       ************************************************************
Query         23 EDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAG     82
d1t56a2        7 NMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRG     66

DALI match       ******. ...... ...............    ..*****.......
Query         83 IIQPQPEDLRSAMSLNVWLVITNWMAFLKT----AHLTELKQGIYQVL    126
d1t56a2       67 AAPRTLPAHELATA-LNLMNERTLFASFAGEQPSVPEARVLDTLVHIW    113



top
3: d1vi0a2 Hypothetical transcriptional regulator YsiA (svm: 1.375)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.77  Contact: 623
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.34 AHM:0.37 LBcontacta:0.97 LBcontactb:0.99 LHM:0.12
id:1.00 blosum:0.59 compass:0.39 pearson:0.99
Scaled scores:
dali:0.71 daliz:0.50 gdtts:0.54 tmscore:0.65 rmsd:0.79 AHM:0.71 LBcontacta:0.35 LBcontactb:0.40 LHM:0.54
id:0.08 blosum:0.12 compass:0.14 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 8.6 Raw score:541.40)
Query          1 fqeyeklvdyyldipedrpITLEDMTFYLESVFDGLWS---YRFFH-RDLEylLDSDPrL     56
d1vi0a2        1 -------------------TAKEKLALVISKHFSLLAGdhnLAIVTqLELR--QSNLE-L     38

Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQPedLRSAMSLNVWLVITNWMAFLKTAH-l    115
d1vi0a2       39 RQKINEILKGYLNILDGILTEGIQSGEIKEGL--DVRLARQMIFGTIDETVTTWVMNDqk     96

Query        116 TELK-QGIYQVLTLEVPyltpeyrervlalrekyrp    150
d1vi0a2       97 YDLVaLSNSVLELLVSG---------------ihnk    117


hit structure      alignment
FAST alignment (Normalized score: 8.02 Raw score:1063.00)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRD--LEYLLD--SDPRL     56
d1vi0a2        1 -------------------TAKEKLALVISKHFSLLAGDHNLAI-VTQLEL--RQSNLEL     38

Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQPED---LRSAMSLNVWLVITNWMAFLKTA    113
d1vi0a2       39 RQKINEILKGYLNILDGILTEGIQSGEIK-----EGLDVRLARQMIFGTIDETVTTWVMN     93

Query        114 HLT----ELKQG-IYQVLTLEVPYLTPEYRERVLALREKYRP------    150
d1vi0a2       94 ---DQKYDLVALSNSVLELLV---------------------SGIHNK    117


hit structure      alignment
TMalign alignment (TM-score: 0.54 Raw score:80.72)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLW-S--YRFF-HRDLEYLLD-SDPR     55
d1vi0a2        1 -------------------TAKEKLALVISKHFSLLAGDHNLAIVTQLELRQ-SNL-EL-     38

Query         56 LRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL--KT-    112
d1vi0a2       39 RQK-INEILKGYLNILDGILTEGIQSGEIKEGL--DVRLARQMIFGTIDETVTTWVMNDQ     95

Query        113 AHLTELK-QGIYQVLTLEVP----YLTPEYRERVLALREKYRP    150
d1vi0a2       96 -KY-DLVALSNSVLELLVSGIHNK-------------------    117


hit structure      alignment
HHsearch alignment (Probability: 0.79 E-value:0.00)
DALI match       ****************........ .  ..... **************************
Query         23 EDMTFYLESVFDGLWSYRFFHRDL-EYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADA     81
d1vi0a2        4 EKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQS     63

DALI match       *****  ..  ........................ ...........
Query         82 GIIQP--QPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVL    126
d1vi0a2       64 GEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELL    110



top
4: d1rkta2 Hypothetical transcriptional regulator YfiR (svm: 1.098)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.82  Contact: 609
Modified z-scores:
dali:1.00 daliz:0.98 gdtts:0.99 tmscore:1.00 rmsd:0.40 AHM:0.54 LBcontacta:0.98 LBcontactb:1.00 LHM:0.16
id:0.99 blosum:0.42 compass:0.62 pearson:0.99
Scaled scores:
dali:0.71 daliz:0.48 gdtts:0.49 tmscore:0.59 rmsd:0.77 AHM:0.63 LBcontacta:0.39 LBcontactb:0.51 LHM:0.40
id:0.05 blosum:0.10 compass:0.07 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 8.3 Raw score:537.00)
Query          1 fqeyeklvdyyldipedrpITLEDMTFYLESVFDG-----lwsYRFFHRDLEyLLDSDPR     55
d1rkta2        1 -------------------SVWASISSYLDELTEGlrdvadtlAPVQFEYLV-TAWRNEE     40

Query         56 LRQDYREFTNRCLAAINRIFAKLADAGIIQPQPedLRSAMSLNVWLVITNWMAFLKTAHL    115
d1rkta2       41 RRQYLEKRYDLFVERFSRLLQKGIDQGEFQPVQ--PLATIAKFFLNMNDGIIQNALYFDE     98

Query        116 --tELKQGIYQVLTLEVP--YLTPeyrervlalrekyrp    150
d1rkta2       99 ekaDVSGLAESAKLYLKTvlQADE--------------k    123


hit structure      alignment
FAST alignment (Normalized score: 8.40 Raw score:1141.00)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWS------YRFFHRDLEYLLDSDP     54
d1rkta2        1 -------------------SVWASISSYLDELTEGLR-DVADTLAPVQFEYLV-TAWRNE     39

Query         55 RLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPED----LRSAMSLNVWLVITNWMAFL    110
d1rkta2       40 ERRQYLEKRYDLFVERFSRLLQKGIDQGEF------QPVQPLATIAKFFLNMNDGIIQNA     93

Query        111 KTAHLT--ELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP-------    150
d1rkta2       94 LYFDEEKADVSGLAESAKLYLKT-------------------VLQADEK    123


hit structure      alignment
TMalign alignment (TM-score: 0.54 Raw score:81.07)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDM-TFYLES-VFDG--LW--SYR-FFHRDLEYLL-DS     52
d1rkta2        1 ------------------SVWA-SISSYLDELT-EGLRD-VADTLAPVQFEYLVT-AWRN     38

Query         53 DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-K    111
d1rkta2       39 EE-RRQYLEKRYDLFVERFSRLLQKGIDQGEFQ-PV-QPLATIAKFFLNMNDGIIQNALY     95

Query        112 T---AHLTELKQ-GIYQVLTLEVP--YLTPEYRERVLALREKYRP    150
d1rkta2       96 FDEEKA--DV-SGLAESAKLYLKTVLQAD--E-K-----------    123


hit structure      alignment
HHsearch alignment (Probability: 0.76 E-value:0.00)
DALI match       ...........           ......... ****************************
Query         25 MTFYLESVFDG--------LWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFA     76
d1rkta2        2 VWASISSYLDELTEGLRDVADTLAPVQFEYLVTAWRNEERRQYLEKRYDLFVERFSRLLQ     61

DALI match       ************. . . ************  ......... ***************...
Query         77 KLADAGIIQPQPEDLRSAMSLNVWLVITNW--MAFLKTAHLTELKQGIYQVLTLEVPYLT    134
d1rkta2       62 KGIDQGEFQPVQPLA-T-IAKFFLNMNDGIIQNALYFDEEKADVSGLAESAKLYLKTVLQ    119

DALI match       . 
Query        135 PE    136
d1rkta2      120 AD    121



top
5: d1jt6a2 Multidrug binding protein QacR (svm: 1.100)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.85  Contact: 623
Modified z-scores:
dali:1.00 daliz:0.99 gdtts:0.99 tmscore:1.00 rmsd:0.37 AHM:0.47 LBcontacta:0.97 LBcontactb:0.99 LHM:0.16
id:0.99 blosum:0.37 compass:0.66 pearson:0.99
Scaled scores:
dali:0.70 daliz:0.48 gdtts:0.54 tmscore:0.63 rmsd:0.77 AHM:0.66 LBcontacta:0.34 LBcontactb:0.40 LHM:0.44
id:0.07 blosum:0.09 compass:0.03 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 9.1 Raw score:559.70)
Query          1 fqeyeklvdyyldipedrPITLEDMTFYLESVFDGLWSYrFFHRDLEYLLDSDP---RLR     57
d1jt6a2        1 ------------------KTNREKFYLYNELSLTTEYYY-PLQNAIIEFYTEYYktnSIN     41

Query         58 QDYREFTNRCLAAINRIFAKLADAGIIQPQpedLRSAMSLNVWLVITNWMAFLKTAhLTE    117
d1jt6a2       42 EKMNKLENKYIDAYHVIFKEGNLNGEWSIN---DVNAVSKIAANAVNGIVTFTHEQnINE     98

Query        118 LK-QGIYQVLTLEVPYLtpeyrervlalrekyrp    150
d1jt6a2       99 RIkLMNKFSQIFLNGLS-----------------    115


hit structure      alignment
FAST alignment (Normalized score: 9.07 Raw score:1192.00)
Query          1 FQEYEKLVDYYLDIPEDRPI--TLEDMTFYLESVFDGLWSY-RFFHRDLEYLLDS---DP     54
d1jt6a2        1 --------------------KTNREKFYLYNELSLTTEY--YYPLQNAIIEFYTEYYKTN     38

Query         55 RLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPED----LRSAMSLNVWLVITNWMAFL    110
d1jt6a2       39 SINEKMNKLENKYIDAYHVIFKEGNLNGE-------WSINDVNAVSKIAANAVNGIVTFT     91

Query        111 KTAHLTELK-QGIYQVLTLEVPYLTPEYRERVLALREKYRP--    150
d1jt6a2       92 HEQNINERIKLMNKFSQIFLNG-------------------LS    115


hit structure      alignment
TMalign alignment (TM-score: 0.55 Raw score:82.19)
Query          1 FQEYEKLVDYYLDIPEDRPIT-LEDMTFYLESVFDGLWSY--RFFHRD-LEYLLDS-DP-     54
d1jt6a2        1 -------------------KTNREKFYLYNELSLTTEYYYPLQNAIIEFYTE--YYK-TN     38

Query         55 RLR-QDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTA    113
d1jt6a2       39 SINEK-MNKLENKYIDAYHVIFKEGNLNGEWS-IN--DVNAVSKIAANAVNGIVTFTHEQ     94

Query        114 HLTELK-QGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1jt6a2       95 NINERIKLMNKFSQIFLNGLS-----------------    115


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.36)
DALI match                        
Query        132 YLTPEYRERVLALREKY    148
d1jt6a2       35 YKTNSINEKMNKLENKY     51



hit structures. 
top
6: d1t33a2 Putative transcriptional repressor YbiH (svm: 1.098)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.63  Contact: 605
Modified z-scores:
dali:1.00 daliz:0.98 gdtts:0.99 tmscore:1.00 rmsd:0.36 AHM:0.42 LBcontacta:0.96 LBcontactb:0.97 LHM:0.16
id:0.92 blosum:0.08 compass:0.47 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.46 gdtts:0.51 tmscore:0.61 rmsd:0.78 AHM:0.68 LBcontacta:0.30 LBcontactb:0.35 LHM:0.41
id:0.01 blosum:0.03 compass:0.10 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 8.2 Raw score:550.00)
Query          1 fqeyeklvdyyldipeDRPITL--EDMTFYLESVFDGLWS--YRFFHRDLEYLLDSDPRL     56
d1t33a2        1 ----------------APDRDAirELILLACKNMIMLLTQedTVNLSKFISREQLSPTSA     44

Query         57 RQDYRE-FTNRCLAAINRIFAKLadagiIQPQ-PEDLRSAMSLNVWLVITNWMAFLKTAH    114
d1t33a2       45 YQLVHEqVIDPLHTHLTRLVAAY-----TGCDaNDTRMILHTHALLGEVLAFRLGKETIL     99

Query        115 ------------LTELK-QGIYQVLTLEVPYLTpeyrervlalrekyrp    150
d1t33a2      100 lrtgwpqfdeekAELIYqTVTCHIDLILHGLTQ----------------    132


hit structure      alignment
FAST alignment (Normalized score: 7.34 Raw score:1033.00)
Query          1 FQEYEKLVDYYLDIPEDRPI------TLEDMTFYLESVFDGL--WSYRFFHRDLEYLLDS     52
d1t33a2        1 --------------------APDRDAIRELILLACKNMIMLLTQEDTVNLSKFISREQLS     40

Query         53 DPRLRQDYR-EFTNRCLAAINRIFAKLADAGIIQPQP--EDLRSAMSLNVWLVITNWMAF    109
d1t33a2       41 PTSAYQLVHEQVIDPLHTHLTRLVAAY------TGCDANDTRMILHTHALLGEVLAFRLG     94

Query        110 LKTAH-----------LTELKQGIYQVL----TLEVPYLTPEYRERVLALREKYRP--    150
d1t33a2       95 KET--ILLRTGWPQFDEEKAELIYQTVTCHIDLILHGL------------------TQ    132


hit structure      alignment
TMalign alignment (TM-score: 0.55 Raw score:82.33)
Query          1 FQEYEKLVDYYLDIPEDRPI-T-LEDMTFYLESVFDGLWS--YRFFHRDL-EYLLDSDPR     55
d1t33a2        1 ----------------APDRDAIRELILLACKNMIMLLTQEDTVNLSKFISREQLSPTS-     43

Query         56 LRQDYRE-FTNRCLAAINRIFAKLADAGIIQPQP--EDLRSAMSLNVWLVITNWMAFLKT    112
d1t33a2       44 AYQLVHEQVIDPLHTHLTRLVAAYT------GCDANDTRMILHTHALLGEVLAFRLGKET     97

Query        113 AH--------LT-ELK-QGIYQVLTLEVPYLT-PEY-RERVLALREKYRP    150
d1t33a2       98 ILLRTGWPQFDEEKAELIYQTVTCHIDLILHGL--TQ-------------    132


hit structure      alignment
HHsearch alignment (Probability: 0.22 E-value:0.01)
DALI match                                                                   
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY     60
d1t33a2       53 IDPLHTHLTRLVAAYTGCDANDTRMILHTHALLGEVLAFRLGKETILLRTGWPQFDEEKA    112

DALI match                           
Query         61 REFTNRCLAAINRIFAKLAD     80
d1t33a2      113 ELIYQTVTCHIDLILHGLTQ    132



top
7: d1pb6a2 Hypothetical transcriptional regulator YcdC (svm: 1.019)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.62  Contact: 535
Modified z-scores:
dali:0.99 daliz:0.92 gdtts:0.97 tmscore:0.99 rmsd:0.41 AHM:0.40 LBcontacta:0.86 LBcontactb:0.90 LHM:0.16
id:0.98 blosum:0.63 compass:0.57 pearson:1.00
Scaled scores:
dali:0.61 daliz:0.32 gdtts:0.41 tmscore:0.50 rmsd:0.74 AHM:0.69 LBcontacta:0.23 LBcontactb:0.27 LHM:0.40
id:0.04 blosum:0.13 compass:0.24 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 5.2 Raw score:410.20)
Query          1 fqeyeklvdyyldipedrPITL-EDMTFYLESVFDGLWSYRFFHRDL-EYLLDSDPRLRQ     58
d1pb6a2        1 ------------------DFAPlAAIKEYIRLKLEVSRDYPQASRLFcMEMLAGAPLLMD     42

Query         59 DYREFTNRCLAAINRIFAKLADAGIIQPQpedlRSAMSLNVWLVITNWMAFLKTAH----    114
d1pb6a2       43 ELTGDLKALIDEKSALIAGWVKSGKLAPI---dPQHLIFMIWASTQHYADFAPQVEavtg     99

Query        115 --------LTELK-QGIYQVLTLEVpyltpeyrervlalrekyrp    150
d1pb6a2      100 atlrdevfFNQTVeNVQRIIIEGIR------------------pr    126


hit structure      alignment
FAST alignment (Normalized score: 6.06 Raw score:833.30)
Query          1 FQEYEKLVDYYLDIPEDRPI---TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD----SD     53
d1pb6a2        1 --------------------DFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLL     40

Query         54 PRLR-QDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKT    112
d1pb6a2       41 MDELTGDLKALIDE----KSALIAGWVKSGKLAPI---DPQHLIFMIWASTQHYADF---     90

Query        113 A----------------HLTEL-KQGIYQVLTLEVPYLTPEYRERVLALREKYRP---    150
d1pb6a2       91 -APQVEAVTGATLRDEVFFNQTVENVQRIIIEGI---------------------RPR    126


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:73.98)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDL-EYLLD--SDPRLR     57
d1pb6a2        1 -----------------DFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGA-PL--L     40

Query         58 QDYR-EFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAH--    114
d1pb6a2       41 MDELTGDLKALIDEKSALIAGWVKSGKLAPI---DPQHLIFMIWASTQHYADFAPQVEAV     97

Query        115 -----L-T-ELK-QGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1pb6a2       98 TGATLRDEVFFNQTVENVQRIIIEGIRPR---------------    126


hit structure      alignment
HHsearch alignment (Probability: 0.84 E-value:0.00)
DALI match       .*********************** .**********************************
Query         22 LEDMTFYLESVFDGLWSYRFFHRD-LEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1pb6a2        5 LAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVK     64

DALI match       ******* .     ******************           ................ 
Query         81 AGIIQPQPEDLRSAMSLNVWLVITNWMAFLKT---------AHLTELKQGIYQVLTLEVP    131
d1pb6a2       65 SGKLAPIDPQH---LIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIE    121

DALI match            
Query        132 YLTPE    136
d1pb6a2      122 GIRPR    126



top
8: d1sgma2 Putative transcriptional regulator YxaF (svm: 1.375)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.69  Contact: 603
Modified z-scores:
dali:1.00 daliz:0.96 gdtts:0.98 tmscore:0.99 rmsd:0.44 AHM:0.49 LBcontacta:0.89 LBcontactb:0.88 LHM:0.27
id:0.96 blosum:0.08 compass:0.31 pearson:0.98
Scaled scores:
dali:0.66 daliz:0.40 gdtts:0.49 tmscore:0.55 rmsd:0.74 AHM:0.65 LBcontacta:0.26 LBcontactb:0.27 LHM:0.27
id:0.03 blosum:0.03 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 6.6 Raw score:427.30)
Query          1 fqeyeklvdyyldipedrpitLEDMTFYLESVFDGLWS--------yRFFHRDLEYLLDS     52
d1sgma2        1 ---------------------SDPVEAIQLFIKKTASQfdntesikgIPVGLLASETALI     39

Query         53 DPRLRQDYREFTNRCLAAINRIFAKLAdagiiqpQPEDLRSAMSLNVWLVITNWMAFLKT    112
d1sgma2       40 SEPLRTVCMKVFKSWEAVFARKLMENG-------FAEEEANQLGTLINSMIEGGIMLSLT     92

Query        113 AHLTEL-KQGIYQVLTLEVpyltpeyrervlalrekyrp    150
d1sgma2       93 NKDKTPlLLIAEQIPVLVR--------------------    111


hit structure      alignment
FAST alignment (Normalized score: 7.86 Raw score:1014.00)
Query          1 FQEYEKLVDYYLDIPEDRPI--TLEDMTFYLESVFDGLWSY----------RFFHRDLEY     48
d1sgma2        1 --------------------SDPVEAIQLFIKKTAS-----QFDNTESIKGIPVGLLASE     35

Query         49 LLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMA    108
d1sgma2       36 TALISEPLRTVCMKVFKSWEAVFARKLME-------NGFAEEEANQLGTLINSMIEGGIM     88

Query        109 FLKTAHLTE-----LKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--    150
d1sgma2       89 LSLTN----KDKTPLLLIAEQIPVL----------------------VR    111


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:73.70)
Query          1 FQEYEKLVDYYLDIPEDRPITL-EDM--TFYLESVF-DG-----LWSYRFFHRDLEYLLD     51
d1sgma2        1 -------------------SDPV-EAIQL-FIKKTASQFDNTES-IKGIPVGLLASETAL     38

Query         52 SDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-    110
d1sgma2       39 ISEPLRTVCMKVFKSWEAVFARKLME-N------GFAEEEANQLGTLINSMIEGGIMLSL     91

Query        111 KT-AHLTELKQ-GIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1sgma2       92 TNK--DKTPLLLIAEQIPVLV--R------------------    111


hit structure      alignment
HHsearch alignment (Probability: 0.16 E-value:0.07)
DALI match       ************************   ......   .   ..... ........  ....
Query         47 EYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNW    106
d1sgma2       34 SETALISEPLRTVCMKVFKSWEAV---FARKLMENGFAEEEANQL-GTLINSMI--EGGI     87

DALI match       ............************
Query        107 MAFLKTAHLTELKQGIYQVLTLEV    130
d1sgma2       88 MLSLTNKDKTPLLLIAEQIPVLVR    111



top
9: d2tcta2 Tetracyclin repressor (Tet-​repressor,​ TetR) (svm: 0.789)

SCOP Superfamily: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Fold: Tetracyclin repressor-​like,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 525
Modified z-scores:
dali:0.99 daliz:0.97 gdtts:0.98 tmscore:0.99 rmsd:0.38 AHM:0.41 LBcontacta:0.92 LBcontactb:0.96 LHM:0.15
id:0.81 blosum:0.17 compass:0.38 pearson:0.90
Scaled scores:
dali:0.72 daliz:0.50 gdtts:0.57 tmscore:0.63 rmsd:0.75 AHM:0.66 LBcontacta:0.35 LBcontactb:0.40 LHM:0.41
id:0.00 blosum:0.04 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 6.8 Raw score:446.70)
Query          1 fqeyeklvdyYLDIPedrpitleDMTFYLESVFDGLWSYR-------ffHRDLEylldsd     53
d2tcta2        1 ----------LPAAG-------eSWQSFLRNNAMSFRRALlryrdgakvHLGTR------     37

Query         54 prlRQDYREFTNRCLAAINRIFakladagiiqpqpedlRSAMSLNVWLVITNWMAFLKTA    113
d2tcta2       38 --pDEKQYDTVETQLRFMTENG---------------fSLRDGLYAISAVSHFTLGAVLE     80

Query        114 H-------------------------LTELK-QGIYQVLTLEVP-YLTPEYRervlalre    146
d2tcta2       81 QqehtaalnlppllrealqimdsddgEQAFLhGLESLIRGFEVQlTALLQIV--------    132

Query        147 kyrp    150
d2tcta2      133 ----    133


hit structure      alignment
FAST alignment (Normalized score: 1.79 Raw score:251.20)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSD-------     53
d2tcta2        1 -----------------------------------------------------LPAAGES      7

Query         54 ---------------------------------------------------PRLRQDYRE     62
d2tcta2        8 WQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAI     67

Query         63 FTNRCLAAINRIFAKLADAGIIQPQ--------------------PEDLRSAMSLNVWLV    102
d2tcta2       68 SAVSHFTLGAVLEQQEHT-------AALNLPPLLREALQIMDSDDGEQAFLHGLESLIRG    120

Query        103 ITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP------    150
d2tcta2      121 FEVQLT------------------------------------------ALLQIV    132


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:70.28)
Query          1 FQEYEKLVDYYLDIPEDRPIT-LEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQD     59
d2tcta2        1 ------------LPA--AGESWQSFLRNNAMSFRRALLRYRDGAKVHL--G---------     35

Query         60 YREFT-NR-CLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL--KT---    112
d2tcta2       36 TRPDEKQYDTVETQLRFMTE-N------GFSLRDGLYAISAVSHFTLGAVLEQQEHTAAL     88

Query        113 ------------AH-LTELKQ-GIYQVLTLEVPYLT---------PEYRERVLALREKYR    149
d2tcta2       89 NLPPLLREALQIMDS-DDGEQAFLHGLESLIRGFEVQLTALLQIV---------------    132

Query        150 P    150
d2tcta2      133 -    133


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.60)
DALI match                                                                   
Query         38 SYRFFHRDLEYLLDSDPRLRQDYREFT--NRCLAAINRIFAKLADAGIIQPQPEDLRSAM     95
d2tcta2       11 FLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGF---SLRDGLYAI     67

DALI match                                                    
Query         96 SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRER    140
d2tcta2       68 SAVSHFTLGAVLEQQEHTAALNLPPLLREALQIMDSDDGEQAFLH    112



top
10: d1f7ca_ Graf (cs: 2.822)

SCOP Superfamily: GTPase activation domain,​ GAP  |  SCOP Fold: GTPase activation domain,​ GAP  |  SCOP Class: All alpha proteins

Consensus: 0.09  Contact: 464
Modified z-scores:
dali:0.98 daliz:0.95 gdtts:0.91 tmscore:0.96 rmsd:0.48 AHM:0.47 LBcontacta:0.89 LBcontactb:0.85 LHM:0.17
id:0.80 blosum:0.11 compass:0.19 pearson:0.90
Scaled scores:
dali:0.66 daliz:0.42 gdtts:0.38 tmscore:0.44 rmsd:0.64 AHM:0.57 LBcontacta:0.31 LBcontactb:0.29 LHM:0.26
id:0.01 blosum:0.03 compass:0.10 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 4.0 Raw score:403.40)
Query          1 ---FQEYEKLVDYYLD--IPEDrPITL----------------------------edMTF     27
d1f7ca_        1 aqlDSIGFSIIKKCIHavETRGiNEQGlyrivgvnsrvqkllsilmdpeteicaeweIKT     60

Query         28 YLESVFDGLWSyRFFHrdLEYL--------------------ldsdPRLRQDYREFTNRC     67
d1f7ca_       61 ITSALKTYLRM-LPGPlmMYQFqrsfikaaklenqesrvseihslvHRLPEKNRQMLHLL    119

Query         68 LAAINRIFAkLADAgiiqpqpedlRSAMSLNVWLVITNWmaflKTAHltelkqgiyqvlt    127
d1f7ca_      120 MNHLAKVAD-NHKQ-------nlmTVANLGVVFGPTLLRptvaAIMD------------i    159

Query        128 levpyltpeyrervlalrekyrp    150
d1f7ca_      160 kfqnivieilienhekifntvpe    182


hit structure      alignment
FAST alignment (Normalized score: 2.63 Raw score:434.10)
Query          1 ---FQEYEKLVDYYLDIPEDRPI-------------------------------------     20
d1f7ca_        1 AQLDSIGFSIIKKCI--------HAVETRGINEQGLYRIVGVNSRVQKLLSILMDPETEI     52

Query         21 -----TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY---------------     60
d1f7ca_       53 CAEWEIKTITSALKTYLRM--------------------------LPGPLMMYQFQRSFI     86

Query         61 ----------------------REFTNRCLAAINRIFAKLADAGIIQP------QPEDLR     92
d1f7ca_       87 KAAKLENQESRVSEIHSLVHRLPEKNRQMLHLLMNHLAKVAD------NHKQNLMTVANL    140

Query         93 SAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--    150
d1f7ca_      141 GVVFGPTL--------------------------------------------------LR    150

Query        151 --------------------------------    151
d1f7ca_      151 PTVAAIMDIKFQNIVIEILIENHEKIFNTVPE    182


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:50.30)
Query          1 ------FQEYEKLVDYYLDIP--E----------------------------------DR     18
d1f7ca_        1 AQLDSI--------GFSIIKKCIHAVETRGINEQGLYRIVGVNSRVQKLLSILMDPETEI     52

Query         19 ---P----ITLEDMTFYLESVFDG-LWSYRFFHRDLE-Y---LLDSDPRLRQDY------     60
d1f7ca_       53 CAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQ-ESRVSEIHSLVHRLPEK    111

Query         61 ----REFTNRCLAAINR---IFAKLADAGIIQPQPEDLRS-AMSLNVWLVITNWMAFLKT    112
d1f7ca_      112 NRQM-LHLLMNHLAKVADNH-------------KQN-LMTVANLGVVFGPTLLRP--TVA    154

Query        113 AH--LTELKQG-----------------------IYQVLTLEVPYLTPEYRERVLALREK    147
d1f7ca_      155 AIMD------IKFQNIVIEILIENHEKIFNTVPE--------------------------    182

Query        148 YRP    150
d1f7ca_      183 ---    183


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.45)
DALI match                                                   
Query        106 WMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYR    149
d1f7ca_       85 FIKAAKLENQESRVSEIHSLVHR----LPEKNRQMLHLLMNHLA    124



hit structures. 
top
11: d1t11a1 Trigger factor,​ C-​terminal domain (cs: 2.685)

SCOP Superfamily: TF C-​terminus (Pfam 05698)  |  SCOP Fold: TF C-​terminus (Pfam 05698)  |  SCOP Class: All alpha proteins

Consensus: 0.38  Contact: 390
Modified z-scores:
dali:0.97 daliz:0.92 gdtts:0.75 tmscore:0.86 rmsd:0.64 AHM:0.70 LBcontacta:0.95 LBcontactb:0.96 LHM:0.18
id:0.63 blosum:0.10 compass:0.14 pearson:0.89
Scaled scores:
dali:0.67 daliz:0.41 gdtts:0.29 tmscore:0.30 rmsd:0.58 AHM:0.43 LBcontacta:0.42 LBcontactb:0.47 LHM:0.38
id:-0.02 blosum:0.01 compass:0.04 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:296.40)
Query          1 fqeyeklvdyyldipedrpitledmtfylESVFDGLWSYRFFHRDLEYLLDSDPR----l     56
d1t11a1        1 ------------lndefvarfgvaeggvdALKAEVRKNMERELKQAIKARIKEQAieglv     48

Query         57 rqdyrefTNRCLAAINRIFAKLADAGI------iqpQPEDLRSAMSLNVWLVITNWMAFL    110
d1t11a1       49 keneiqvPSALIDQEINVLRQQAAQRFggnveaaaqLPRELFEEQAKRRVVVGLLLGEVI    108

Query        111 -KTAHltelkqGIYQV-LTLEvpyltpeyrervlalrekyrp    150
d1t11a1      109 rTHELkadeekVKALItEMAT---------------------    129


hit structure      alignment
FAST alignment (Normalized score: 2.60 Raw score:361.40)
Query          1 FQEYEKLVDYYLDIPEDRPIT------------------------LEDMTFYLESVFDGL     36
d1t11a1        1 ---------------------LNDEFVARFGVAEGGVDALKAEVRKNMERELKQAIKARI     39

Query         37 WSYRFFHRDLEYLLDSDPRLRQDY------------------------------------     60
d1t11a1       40 K-----------------------EQAIEGLVKENEIQVPSALIDQEINVLRQQAAQRFG     76

Query         61 -------------REFTNRCLAAINRIFAKLADAGII--QPQPEDLRSAMSLNVWLVITN    105
d1t11a1       77 GNVEAAAQLPRELFEEQAKRRVVVGLLLGEVIRT---HELKADEEKVKALITEM------    127

Query        106 WMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--    150
d1t11a1      128 ---------------------------------------------AT    129


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:56.94)
Query          1 ----FQ--E----YEKLVDYYLDIPEDRPITLEDMTFYLESVFDGL-WSYRFFHRDLE--     47
d1t11a1        1 LNDEFVARFGVAEGGVDAL----------------------K--AEV--RK-NMERELKQ     33

Query         48 --------------------YLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP-     86
d1t11a1       34 AIKARIKEQAIEGLVKENEI-------------Q-VPSALIDQEINVLRQQAA-Q-RFGG     77

Query         87 -------QPEDLRSAMSLNVWLVITNWMAFL-KTAHLTELK-QGIYQVLTLEVPYLTPEY    137
d1t11a1       78 NVEAAAQLPRELFEEQAKRRVVVGLLLGEVIRTH-ELKADEEKVKALITEMAT-------    129

Query        138 RERVLALREKYRP    150
d1t11a1      130 -------------    130


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.04)
DALI match                                                    
Query         53 DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSL     97
d1t11a1       83 AQLPRELFEEQAKRRVVVGL-LLGEVIRTHELKADEEKVKALITE    126



top
12: d1kf6a1 Fumarate reductase (cs: 2.683)

SCOP Superfamily: Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.46  Contact: 392
Modified z-scores:
dali:0.94 daliz:0.89 gdtts:0.93 tmscore:0.95 rmsd:0.33 AHM:0.33 LBcontacta:0.85 LBcontactb:0.71 LHM:0.10
id:0.81 blosum:0.26 compass:0.29 pearson:0.89
Scaled scores:
dali:0.67 daliz:0.41 gdtts:0.50 tmscore:0.51 rmsd:0.78 AHM:0.73 LBcontacta:0.32 LBcontactb:0.29 LHM:0.58
id:0.02 blosum:0.05 compass:0.11 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:315.00)
Query          1 -----FQEYEKLVDYYLD--IPEDrpITLEDMTFYLESVFDGLWSYRFFHrdleyLLDS-     52
d1kf6a1        1 dggenWAKIRDEMGLAMEegCGIY--RTPELMQKTIDKLAELQERFKRVR----iTDTSs     54

Query         53 -dPRLRQDYREFTNRCLAAINRIFAKLADAG-------------------iiQPQPedlR     92
d1kf6a1       55 vfNTDLLYTIELGHGLNVAECMAHSAMARKEsrgahqrldegcterddvnflKHTL---A    111

Query         93 SAMslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1kf6a1      112 FRD-----------------------------------adgttrleysdvkittlppa    134


hit structure      alignment
FAST alignment (Normalized score: 3.93 Raw score:557.70)
Query          1 -----FQEYEKLVDYYLDIPED-----RPITLEDMTFYLESVFDGLWSYRFFHRDLEYLL     50
d1kf6a1        1 DGGENWAKIRDEMGLAM-----EEGCGIYRTPELMQKTIDKLAELQERFK----------     45

Query         51 DSD-----------PRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNV     99
d1kf6a1       46 ---RVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMAR-------------------     83

Query        100 WLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP---------    150
d1kf6a1       84 ---------------------------------------------------KESRGAHQR     92

Query        151 ------------------------------------------    151
d1kf6a1       93 LDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA    134


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:64.02)
Query          1 -----FQEYEKLVDYYLD--IPEDRPITLEDMTFYLESV-FDGLWSYRFFHRDLEYLLDS     52
d1kf6a1        1 DGGENWAKIRDEMGLAMEEGCG-IYRTP-ELMQKTIDKLAE-LQE--R-FKRVR--ITDT     52

Query         53 D---PRLRQDYREFTNRCLAAINRIFAKLADAG-----------I-------IQ-PQPED     90
d1kf6a1       53 SSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVN-FLKHTL-    110

Query         91 LRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPY------------LTPEYR    138
d1kf6a1      111 -AFRDADGTT---------------------------RL--EYSDVKITTLPPA------    134

Query        139 ERVLALREKYRP    150
d1kf6a1      135 ------------    135


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.41)
DALI match                                           
Query         30 ESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTN     65
d1kf6a1       11 DEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKR     46



top
13: d1bg1a1 STAT3b (cs: 2.663)

SCOP Superfamily: STAT  |  SCOP Fold: STAT-​like  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 554
Modified z-scores:
dali:0.97 daliz:0.95 gdtts:0.97 tmscore:0.98 rmsd:0.37 AHM:0.38 LBcontacta:0.87 LBcontactb:0.87 LHM:0.35
id:0.93 blosum:0.32 compass:0.33 pearson:0.95
Scaled scores:
dali:0.67 daliz:0.45 gdtts:0.57 tmscore:0.63 rmsd:0.76 AHM:0.67 LBcontacta:0.32 LBcontactb:0.31 LHM:0.19
id:0.04 blosum:0.07 compass:0.11 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 5.6 Raw score:397.90)
Query          1 ------------FQEYEKLVDYYLDI---PEDRP--------------------------     19
d1bg1a1        1 vvtekqqmleqhLQDVRKRVQDLEQKmkvVENLQddfdfnyktlksqgdsvtrqkmqqle     60

Query         20 ----iTLEDMTFYLESVFDGLWSYRFFHRDLEY---------------------lldSDP     54
d1bg1a1       61 qmltaLDQMRRSIVSELAGLLSAMEYVQKTLTDeeladwkrrqqiaciggppnicldRLE    120

Query         55 RLRQDYREFTNRCLAAINRIFAKLADAGIiqpqpedlrsaMSLNVWLVITNwmaflktah    114
d1bg1a1      121 NWITSLAESQLQTRQQIKKLEELQQKVSY----kgdpivqHRPMLEERIVE---------    167

Query        115 ltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1bg1a1      168 --------------------------lfrnlmksaf    177


hit structure      alignment
FAST alignment (Normalized score: 2.80 Raw score:456.10)
Query          1 FQEYEKLVDYYLDIPEDRPI-----------TLEDMTFYLESVFDGLWSYRFFHRDLEYL     49
d1bg1a1        1 --------------------VVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN     40

Query         50 LDS----------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRS     93
d1bg1a1       41 YK-TLKSQGDSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEY-------------     86

Query         94 AMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP---    150
d1bg1a1       87 ---------------------------------------------------------VQK     89

Query        151 ------------------------------------------------------------    151
d1bg1a1       90 TLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSY    149

Query        151 ----------------------------    151
d1bg1a1      150 KGDPIVQHRPMLEERIVELFRNLMKSAF    177


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:68.61)
Query          1 --------FQEYEKLVDYYLD--IP--EDRP-----------------------------     19
d1bg1a1        1 VVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDSVTRQKMQQLE     60

Query         20 --------ITLEDMTFYLESVFDGLWSYRFFHRDLEYLLD-------------S-DPRLR     57
d1bg1a1       61 QMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLE    120

Query         58 QDYREFTNRCLAAINRIFAKLADAG--------II-----QPQPEDLRSAMSLNVWLVIT    104
d1bg1a1      121 NWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPM----------LE-ERIVELF    169

Query        105 -N------WMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1bg1a1      170 RNLMKSAF---------------------------------------------    177


hit structure      alignment
HHsearch alignment (Probability: 0.41 E-value:0.00)
DALI match                                                                   
Query          5 EKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFT     64
d1bg1a1      102 RQQIACIGGPPNI---CLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHR    158

DALI match                          
Query         65 NRCLAAINRIFAKLADAGI     83
d1bg1a1      159 PMLEERIVELFRNLMKSAF    177



top
14: d1neka1 Succinate dehydogenase (cs: 2.615)

SCOP Superfamily: Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.43  Contact: 397
Modified z-scores:
dali:0.94 daliz:0.90 gdtts:0.92 tmscore:0.95 rmsd:0.36 AHM:0.36 LBcontacta:0.89 LBcontactb:0.81 LHM:0.16
id:0.94 blosum:0.29 compass:0.29 pearson:0.89
Scaled scores:
dali:0.67 daliz:0.42 gdtts:0.48 tmscore:0.50 rmsd:0.76 AHM:0.70 LBcontacta:0.35 LBcontactb:0.33 LHM:0.48
id:0.06 blosum:0.05 compass:0.12 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:302.00)
Query          1 -----FQEYEKLVDYYLD--IPEDrpITLEDMTFYLESVFDGLWSYRFFHrdleyLLDS-     52
d1neka1        1 rngedPVAIRKALQECMQhnFSVF--REGDAMAKGLEQLKVIRERLKNAR----lDDTSs     54

Query         53 -dPRLRQDYREFTNRCLAAINRIFAKLADAG--------------iiqpqpedlRSAMsl     97
d1neka1       55 efNTQRVECLELDNLMETAYATAVSANFRTEsrgahsrfdfpdrddenwlchslYLPE--    112

Query         98 nvwlvitnwmaflktahltelkqgiyqvltlevpYLTPeyrervlalrekyrp    150
d1neka1      113 ---------------------------sesmtrrSVNMepklrpafppkirty    138


hit structure      alignment
FAST alignment (Normalized score: 3.82 Raw score:549.50)
Query          1 -----FQEYEKLVDYYLDIPED-----RPITLEDMTFYLESVFDGLWSYRFFHRDLEYLL     50
d1neka1        1 RNGEDPVAIRKALQECM-----QHNFSVFREGDAMAKGLEQLKVIRERLK----------     45

Query         51 DSD-----------PRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNV     99
d1neka1       46 ---NARLDDTSSEFNTQRVECLELDNLMETAYATAVSANF--------------------     82

Query        100 WLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP---------    150
d1neka1       83 ---------------------------------------------------RTESRGAHS     91

Query        151 -----------------------------------------------    151
d1neka1       92 RFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY    138


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:64.96)
Query          1 -----FQEYEKLVDYYLD--IPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS-     52
d1neka1        1 RNGEDPVAIRKALQECMQHNFSV-F-REGDAMAKGLEQLKVIRERLKNA--R---LDDTS     53

Query         53 ---DPRLRQDYREFTNRCLAAINRIFAK-L-AD--------A--GI--IQPQPEDLRSAM     95
d1neka1       54 SEFNTQRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCH--SL--Y    109

Query         96 SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPY-----------------LTPEYR    138
d1neka1      110 L-PE-S---ES-----------------MT--RR-SVNMEPKLRPAFPPKIRTY------    138

Query        139 ERVLALREKYRP    150
d1neka1      139 ------------    139


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.22)
DALI match                                                  
Query         23 EDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTN     65
d1neka1        4 EDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKN     46



top
15: d1owaa_ Spectrin alpha chain (cs: 2.438)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.38  Contact: 357
Modified z-scores:
dali:0.95 daliz:0.93 gdtts:0.93 tmscore:0.95 rmsd:0.37 AHM:0.38 LBcontacta:0.89 LBcontactb:0.89 LHM:0.52
id:0.62 blosum:0.35 compass:0.45 pearson:0.94
Scaled scores:
dali:0.69 daliz:0.48 gdtts:0.51 tmscore:0.54 rmsd:0.76 AHM:0.70 LBcontacta:0.36 LBcontactb:0.35 LHM:0.04
id:-0.02 blosum:0.06 compass:0.14 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 6.4 Raw score:319.00)
Query          1 ---------------------------------------------------------FQE      3
d1owaa_        1 meqfpketvvessgpkvletaeeiqerrqevltryqsfkervaergqkledsyhlqvFKR     60

Query          4 YEKLVDYYLDI----PEDR-----------piTLEDMTFYLESVFDGLWSYRFFHRDLEY     48
d1owaa_       61 DADDLGKWIMEkvniLTDKsyedptniqgkyqKHQSLEAEVQTKSRLMSELEKTREERFT    120

Query         49 -llDSDPRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlrsamslnvwlvitnwm    107
d1owaa_      121 mghSAHEETKAHIEELRHLWDLLLELTLEKGDQLL-------------------------    155

Query        108 aflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1owaa_      156 ------------------------------------------r    156


hit structure      alignment
FAST alignment (Normalized score: 2.94 Raw score:449.60)
Query          1 FQEYEKLVDYYLDIPEDRPI----------------------------------------     20
d1owaa_        1 --------------------MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKE     40

Query         21 --------------------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPR-----     55
d1owaa_       41 RVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKS---------------YEDPT     85

Query         56 LRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHL    115
d1owaa_       86 NIQGKYQKHQSLEAEVQTKSRLMSE-----------------------------------    110

Query        116 TELKQGIYQVLTLEVPYL---------------TPEYRERVLALREKYRP----------    150
d1owaa_      111 ------------------LEKTREERFTMGHSAHEETKAHIEELRH----LWDLLLELTL    148

Query        151 --------    151
d1owaa_      149 EKGDQLLR    156


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:60.45)
Query          1 ---------------------------------------------------------FQE      3
d1owaa_        1 MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR     60

Query          4 YEKLVDYYLD-I--PE-DR----------P--ITLEDMTFYLESVFDGLWSYRFFHRDL-     46
d1owaa_       61 DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSR-LMSELEKTREERF    119

Query         47 EYLLDSD-PRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITN    105
d1owaa_      120 -TMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLL-----------------------    155

Query        106 WMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1owaa_      156 ------------------------------R--------------    156


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.04)
DALI match                                                           
Query         29 LESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1owaa_       84 PTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEE    135



hit structures. 
top
16: d1s35a2 Spectrin beta chain (cs: 2.430)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.42  Contact: 355
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.96 tmscore:0.97 rmsd:0.31 AHM:0.32 LBcontacta:0.89 LBcontactb:0.82 LHM:0.17
id:0.53 blosum:0.17 compass:0.46 pearson:0.80
Scaled scores:
dali:0.73 daliz:0.52 gdtts:0.63 tmscore:0.64 rmsd:0.82 AHM:0.74 LBcontacta:0.38 LBcontactb:0.32 LHM:0.40
id:-0.03 blosum:0.01 compass:0.06 pearson:0.05

hit structure      alignment
DALI alignment (Z-score: 5.7 Raw score:310.10)
Query          1 -------FQEYEKLVDYYLD--IPEDR------------piTLEDMTFYLEsVFDGlwsy     39
d1s35a2        1 gfqefqkDAKQAEAILSNQEytLAHLEppdsleaaeagirkFEDFLGSMEN-NRDKvlsp     59

Query         40 rFFHRDLEY-llDSDPRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlrsamsln     98
d1s35a2       60 vDSGNKLVAegnLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLR----------------    103

Query         99 vwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1s35a2      104 --------------------------------------------------dn    105


hit structure      alignment
FAST alignment (Normalized score: 3.67 Raw score:460.10)
Query          1 F------------QEYEKLVDYYLDIPEDRPI------------------TLEDMTFYLE     30
d1s35a2        1 -GFQEFQKDAKQAEAILSNQEYTL--------AHLEPPDSLEAAEAGIRKFEDFLGSMEN     51

Query         31 SVFDGLWSYRFFHR--DLEYLLDS--------DPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1s35a2       52 NRDKV---------LSPVDSGNK-LVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVL    101

Query         81 AGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRER    140
d1s35a2      102 ------------------------------------------------------------    102

Query        141 VLALREKYRP----    150
d1s35a2      102 ----------LRDN    105


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:63.34)
Query          1 ----FQEYEKLVDYYL-DI--P--EDR----------PI--TLEDMTFYLESVFDGLWSY     39
d1s35a2        1 GFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRD-KVL-S     58

Query         40 RFFHRDLEYLLD--S--DPRLRQDYREFTNRCLAAINRIFAKLADAGI-IQPQPEDLRSA     94
d1s35a2       59 P-VD-SGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDN-----------    105

Query         95 MSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1s35a2      106 --------------------------------------------------------    106


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.03)
DALI match                                       
Query         43 HRDLEYLLDSDPRLRQDYREFTNRCLAAINRI     74
d1s35a2       71 NLYSDKIKEKVQLIEDRHRKNNEKAQEASVLL    102



top
17: d1j1ja_ Translin (cs: 2.396)

SCOP Superfamily: Translin  |  SCOP Fold: alpha-​alpha superhelix  |  SCOP Class: All alpha proteins

Consensus: 0.26  Contact: 487
Modified z-scores:
dali:0.95 daliz:0.93 gdtts:0.94 tmscore:0.96 rmsd:0.48 AHM:0.51 LBcontacta:0.73 LBcontactb:0.78 LHM:0.25
id:0.59 blosum:0.19 compass:0.21 pearson:0.78
Scaled scores:
dali:0.68 daliz:0.43 gdtts:0.48 tmscore:0.53 rmsd:0.68 AHM:0.58 LBcontacta:0.25 LBcontactb:0.29 LHM:0.26
id:-0.01 blosum:0.04 compass:0.07 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:369.00)
Query          1 --------------------------FQEYEKLVDYYLD--IPEDR-----piTLEDMTF     27
d1j1ja_        1 msvseifvelqgflaaeqdireeirkVVQSLEQTAREILtlLQGVHqgagfqdIPKRCLK     60

Query         28 YLESVFDGLWsyRFFHRDLEYllDSDPrLRQDYREFTNRCLAAINRIFAKLADagiiqpq     87
d1j1ja_       61 AREHFGTVKThlTSLKTKFPA-eQYYR-FHEHWRFVLQRLVFLAAFVVYLETE-------    111

Query         88 pedlRSAMSLNVWLV---------itnwmaflktahltelkqgiyqvltlevpylTPEY-    137
d1j1ja_      112 -tlvTREAVTEILGIepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysRPLHi    170

Query        138 ----------------------------------rervlalrekyrp    150
d1j1ja_      171 stfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgf    217


hit structure      alignment
FAST alignment (Normalized score: 3.62 Raw score:652.50)
Query          1 F------------------------QEYEKLVDYYLDIPEDRPI----------------     20
d1j1ja_        1 -MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTA--------REILTLLQGVHQGAGF     51

Query         21 --TLEDMTFY---LESVFDGLWSYRF--FHRDLEYLLDSDPRLRQDYREFTNRCLAAINR     73
d1j1ja_       52 QDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYR-------FHEHWRFVLQRLVFLAAF    104

Query         74 IFAKLADAGIIQPQPEDL-RSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPY    132
d1j1ja_      105 VVYLE------TETL---VTREAVTEI---------------------------------    122

Query        133 LTPEYRERVLALREKYRP------------------------------------------    150
d1j1ja_      123 ------------------LGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDY    164

Query        151 -----------------------------------------------------    151
d1j1ja_      165 SRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGF    217


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:61.94)
Query          1 ------------------------------FQEYEKLVDYYLDIPEDRPITLEDMTFYLE     30
d1j1ja_        1 MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQ-DIPKRCL     59

Query         31 SVFDGLWSYRF-FH--RD----LEY-LLD-SDPRLRQDYREF-T----------------     64
d1j1ja_       60 KAREHFGTVKTHLTSL-KTKFP--AEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTR    116

Query         65 --------------------------N-RCL-AAINRIFAKLA-DAGIIQPQPEDLRSAM     95
d1j1ja_      117 EAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINE    176

Query         96 S----------------------------------------LNVWLVITNWMAFLKTAHL    115
d1j1ja_      177 LDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGF-------------------    217

Query        116 TELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1j1ja_      218 -----------------------------------    218


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.06)
DALI match                                            
Query         42 FHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKL     78
d1j1ja_        6 IFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLL     42



top
18: d1cuna1 Spectrin alpha chain (cs: 2.391)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.53  Contact: 368
Modified z-scores:
dali:0.96 daliz:0.93 gdtts:0.96 tmscore:0.97 rmsd:0.34 AHM:0.43 LBcontacta:0.89 LBcontactb:0.78 LHM:0.34
id:0.63 blosum:0.06 compass:0.12 pearson:0.74
Scaled scores:
dali:0.69 daliz:0.48 gdtts:0.58 tmscore:0.62 rmsd:0.80 AHM:0.71 LBcontacta:0.33 LBcontactb:0.27 LHM:0.20
id:-0.02 blosum:-0.01 compass:0.02 pearson:0.02

hit structure      alignment
DALI alignment (Z-score: 6.3 Raw score:324.60)
Query          1 ----FQEYEKLVDYYL--DIPE---------------drpiTLEDMTFYLESVFDGLWsY     39
d1cuna1        1 mvhqFFRDMDDEESWIkeKKLLvssedygrdltgvqnlrkkHKRLEAELAAHEPAIQSvL     60

Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlrsamslnv     99
d1cuna1       61 DTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLE-----------------    103

Query        100 wlvitnwmaflktahltelkqgiyqvltlevpyLTPEyrervlalrekyrp    150
d1cuna1      104 --------------------------------eSLEY-------------q    109


hit structure      alignment
FAST alignment (Normalized score: 3.03 Raw score:387.30)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS--------     52
d1cuna1        1 --------------------MVHQFFRDMDDEESWIKEKKLLV---------SSEDYGRD     31

Query         53 ------DPRLRQDYREFTNR---CLAAINRIFAKLADAGIIQPQ---PEDLRSAMSLNVW    100
d1cuna1       32 LTGVQNLRKKHKRLEAELAAHEPAIQSVLDTGKKLSDD------NTIGKEEIQQRLAQFV     85

Query        101 LVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP----------    150
d1cuna1       86 DHWK----------------------------------------------ELKQLAAARG     99

Query        151 ----------    151
d1cuna1      100 QRLEESLEYQ    109


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:65.91)
Query          1 ----FQEYEKLVDYYLD--I-P-ED-R----------P--ITLEDMTFYLESVFDGLWSY     39
d1cuna1        1 MVHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEP-AIQSV     59

Query         40 RFFHRDLEYLLDS--DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQ-PQPEDLRSAMS     96
d1cuna1       60 LDTGKKLSDD-NTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLE--ES-----------    105

Query         97 LNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTP--EYRERVLALREKYRP    150
d1cuna1      106 -------------------------------------LEYQ---------------    109


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.06)
DALI match                                         
Query         45 DLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKL     78
d1cuna1       73 GKEEIQQRLAQFVDHWKELKQLAAARGQRLEESL    106



top
19: d1n5ua1 Serum albumin (cs: 2.389)

SCOP Superfamily: Serum albumin-​like  |  SCOP Fold: Serum albumin-​like  |  SCOP Class: All alpha proteins

Consensus: 0.18  Contact: 420
Modified z-scores:
dali:0.96 daliz:0.92 gdtts:0.94 tmscore:0.96 rmsd:0.42 AHM:0.43 LBcontacta:0.89 LBcontactb:0.83 LHM:0.27
id:0.73 blosum:0.19 compass:0.17 pearson:0.83
Scaled scores:
dali:0.68 daliz:0.41 gdtts:0.50 tmscore:0.51 rmsd:0.73 AHM:0.66 LBcontacta:0.35 LBcontactb:0.29 LHM:0.23
id:-0.00 blosum:0.04 compass:0.09 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:316.30)
Query          1 ---------------------fqeyeklvdyylDIPE-----------------------     16
d1n5ua1        1 ahksevahrfkdlgeenfkalvliafaqylqqcPFEDhvklvnevtefaktcvadesaen     60

Query         17 -----------------------------------------------dRPITleDMTFyl     29
d1n5ua1       61 cdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnPNLP--RLVR--    116

Query         30 eSVFDGLwsyrffhrdleylldsdprlrqdyreFTNRCLAAINRIFAKLADagiiqPQPE     89
d1n5ua1      117 -PEVDVM--------------------ctafhdNEETFLKKYLYEIARRHP-----YFYA    150

Query         90 DLRSAMSLNVWLVITNWMAFLktahltELKQ-GIYQVLTLEVPYL--TPEYrervlalre    146
d1n5ua1      151 PELLFFAKRYKAAFTECCQAA------DKAAcLLPKLDELRDEGKasSAKQ---------    195

Query        147 kyrp    150
d1n5ua1      196 ----    196


hit structure      alignment
FAST alignment (Normalized score: 2.66 Raw score:455.30)
Query          1 FQEYEKLVDYYLDIPE--------------------------------------------     16
d1n5ua1        1 ----------------AHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNE     44

Query         17 ------------------------------------------------------------     17
d1n5ua1       45 VTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQH    104

Query         17 ------DRPITLEDMTF--YLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYRE-FTNRC     67
d1n5ua1      105 KDDNPNLPRLV------RPEVDVMCTAFH-------------------------DNEET-    132

Query         68 LAAINRIFAKLADAGIIQ---PQPEDLRSAMSLNVWLVITNWMAFLKTAH---LTEL-KQ    120
d1n5ua1      133 --FLKKYLYEIAR-----RHPYFYAPELLFFAKRYKAAFTECCQ------AADKAACLLP    179

Query        121 GIYQVLTLEVPYLTPEYRERVLALREKYRP-----    150
d1n5ua1      180 KLDELRDEGKA-------------------SSAKQ    195


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:61.89)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY     60
d1n5ua1        1 -----------------------------AHKSEVAHRF--K-----------------D     12

Query         61 REFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNW---MAFLKTAHLTE    117
d1n5ua1       13 -LGEENFKALVLIAFAQYLQ-----QCPFEDHVKLVNEVTEFAKTCVADESAE--N---C     61

Query        118 LKQGIYQVLTLEV--PYL---TPEYRERVLALREKY------------------------    148
d1n5ua1       62 DKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDV    121

Query        149 ------------------------------------------------------------    149
d1n5ua1      122 MCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKL    181

Query        149 --------------RP    150
d1n5ua1      182 DELRDEGKASSAKQ--    195


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.43)
DALI match                                           
Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIF     75
d1n5ua1      132 TFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTEC    167



top
20: d1n5ua2 Serum albumin (cs: 2.382)

SCOP Superfamily: Serum albumin-​like  |  SCOP Fold: Serum albumin-​like  |  SCOP Class: All alpha proteins

Consensus: 0.25  Contact: 446
Modified z-scores:
dali:0.96 daliz:0.94 gdtts:0.95 tmscore:0.97 rmsd:0.36 AHM:0.37 LBcontacta:0.85 LBcontactb:0.83 LHM:0.20
id:0.96 blosum:0.77 compass:0.26 pearson:0.90
Scaled scores:
dali:0.69 daliz:0.45 gdtts:0.56 tmscore:0.59 rmsd:0.76 AHM:0.69 LBcontacta:0.33 LBcontactb:0.31 LHM:0.32
id:0.07 blosum:0.15 compass:0.13 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:321.80)
Query          1 ------------------------------------------------------------      1
d1n5ua2        1 rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd     60

Query          1 --------------------------fqeyeklvdyyldipeDRPITleDMTF-YLESvf     33
d1n5ua2       61 radlakyicenqdsissklkeccekpllekshciaevendemPADLP--SLAAdFVES--    116

Query         34 DGLWsyrffhrdleylldsdprlrqdyrEFTNRCLAAINRIFAKLADagiiqPQPEDLRS     93
d1n5ua2      117 KDVC--------------------knyaEAKDVFLGMFLYEYARRHP-----DYSVVLLL    151

Query         94 AMSLNVWLVITNWMAFLktahltELKQGIYQVLTLEVP-YLTPeyrervlalrekyrp    150
d1n5ua2      152 RLAKTYETTLEKCCAAA------DPHECYAKVFDEFKPlVEEP-----------qnli    192


hit structure      alignment
FAST alignment (Normalized score: 2.48 Raw score:420.10)
Query          1 FQEYEKLVDYYLDIPEDRPI----------------------------------------     20
d1n5ua2        1 --------------------RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVT     40

Query         21 ------------------------------------------------------------     21
d1n5ua2       41 DLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVEND    100

Query         21 --------TLEDMTFY--LESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTN----R     66
d1n5ua2      101 EMPADLPSLAADF---VESKDVCK-------------------------------NYAEA    126

Query         67 CLAAINRIFAKLADAGIIQ---PQPEDLRSAMSLNVWLVITNWMAFLKTAHLT--ELKQG    121
d1n5ua2      127 KDVFLGMFLYEYAR-----RHPDYSVVLLLRLAKTYETTLEKCCA--------AADPHEC    173

Query        122 IYQVLTLEVPYLTPEYRERVLALREKYRP---------    150
d1n5ua2      174 YAKVFDEFKP-------------------LVEEPQNLI    192


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:60.03)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSY-RFFHRDLEYLLDSDPRLRQD     59
d1n5ua2        1 ---R--LK--------------------------C---AS-------------------L      7

Query         60 YREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELK    119
d1n5ua2        8 QKFGERAFKAWAVARLSQRFP-----KAEFAEVSKLVTDLTKVHTECCH-G----DLLEC     57

Query        120 QG-IYQVLTLEVPYL---TPEYRERVLALREKYR--------------------------    149
d1n5ua2       58 ADDRADLAKYICENQDSISSKLKECCEK-PLLEKSHCIAEVENDEMPADLPSLAADFVES    116

Query        150 ------------------------------------------------------------    150
d1n5ua2      117 KDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAK    176

Query        150 ----------------P    150
d1n5ua2      177 VFDEFKPLVEEPQNLI-    192


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.41)
DALI match                                           
Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIF     75
d1n5ua2      129 VFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKC    164



hit structures. 
top
21: d1jnra1 Adenylylsulfate reductase A subunit (cs: 2.364)

SCOP Superfamily: Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.45  Contact: 361
Modified z-scores:
dali:0.93 daliz:0.90 gdtts:0.91 tmscore:0.94 rmsd:0.31 AHM:0.38 LBcontacta:0.80 LBcontactb:0.53 LHM:0.15
id:0.92 blosum:0.35 compass:0.39 pearson:0.79
Scaled scores:
dali:0.68 daliz:0.44 gdtts:0.51 tmscore:0.53 rmsd:0.78 AHM:0.66 LBcontacta:0.31 LBcontactb:0.18 LHM:0.48
id:0.05 blosum:0.05 compass:0.06 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:269.20)
Query          1 -----------FQEYEKLVDYYLD--IPED---RPITLEDMTFYLESVFDGLWSYRFFhr     44
d1jnra1        1 taddvnpeyilPWQGLVRLQKIMDeyAAGIatiYKTNEKMLQRALELLAFLKEDLEKL--     58

Query         45 dleylldSDPRLRQDYREFTNRCLAAINRIFAKLADAgiiqpqpedlrsamslnvwlvit    104
d1jnra1       59 -----aaRDLHELMRAWELVHRVWTAEAHVRHMLFRK------------------etrwp     95

Query        105 nwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1jnra1       96 gyyyrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf    141


hit structure      alignment
FAST alignment (Normalized score: 4.01 Raw score:583.90)
Query          1 -----------FQEYEKLVDYYLDIP--------EDRPITLEDMTFYLESVFDGLWSYRF     41
d1jnra1        1 TADDVNPEYILPWQGLVRLQKIM---DEYAAGIATIYKTNEKMLQRALELLAFLKEDLE-     56

Query         42 FHRDLEYLL---DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLN     98
d1jnra1       57 ---------KLAARDLHELMRAWELVHRVWTAEAHVRHMLF-------------------     88

Query         99 VWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--------    150
d1jnra1       89 ----------------------------------------------------RKETRWPG     96

Query        151 ---------------------------------------------    151
d1jnra1       97 YYYRTDYPELNDEEWKCFVCSKYDAEKDEWTFEKVPYVQVIEWSF    141


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:65.28)
Query          1 ----------F-QEYEKLVDYYLD--IPE----DRPITLEDMTFYLESVFDGLWSYRFFH     43
d1jnra1        1 TADDVNPEYILPWQGLVRLQKIMDEYAAGIATIYK-TNEKMLQRALELLAFLKE--D-LE     56

Query         44 RDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAG-----------I-------I-     84
d1jnra1       57 K-L--AA-RDLHELMRAWELVHRVWTAEAHVRHMLFRKETRWPGYYYRTDYPELNDEEWK    112

Query         85 QPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLT----------    134
d1jnra1      113 CFVC---S-KY--D--AE---------------------KD--EW-TFEKVPYVQVIEWS    140

Query        135 -PEYRERVLALREKYRP    150
d1jnra1      141 F----------------    141


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.24)
DALI match                                                                   
Query         26 TFYLESVFDGLWSYRFFHR-----DLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1jnra1       13 WQGLVRLQKIMDEYAAGIATIYKTNEKMLQRALELLAFLKEDLEKLAARDLHELMRAWEL     72

DALI match                       
Query         81 AGIIQPQPEDLRSAMS     96
d1jnra1       73 VHRVWTAEAHVRHMLF     88



top
22: d1iq0a1 Arginyl-​tRNA synthetase (ArgRS) (cs: 2.352)

SCOP Superfamily: Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases  |  SCOP Fold: Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases  |  SCOP Class: All alpha proteins

Consensus: 0.48  Contact: 372
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.95 tmscore:0.96 rmsd:0.27 AHM:0.28 LBcontacta:0.90 LBcontactb:0.87 LHM:0.16
id:0.86 blosum:0.23 compass:0.26 pearson:0.86
Scaled scores:
dali:0.70 daliz:0.46 gdtts:0.60 tmscore:0.61 rmsd:0.82 AHM:0.74 LBcontacta:0.36 LBcontactb:0.33 LHM:0.40
id:0.02 blosum:0.04 compass:0.07 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 5.1 Raw score:326.80)
Query          1 -------------------------------FQEYEKLVDYYLDI---PEDRP-------     19
d1iq0a1        1 gdtgpyvqyaharahsilrkagewgapdlsqATPYERALALDLLDfeeAVLEAaeertph     60

Query         20 ITLEDMTFYLESVFDGLWSY----RFFHrdlEYLLdsdPRLRQDYREFTNRCLAAINRIF     75
d1iq0a1       61 VLAQYLLDLAASWNAYYNARengqPATP--vLTAP---EGLRELRLSLVQSLQRTLATGL    115

Query         76 AKLAdagiiqpqpedlRSAMslnvwlvitnwmaflktahltelkqgiyqvltlevpyltp    135
d1iq0a1      116 DLLG-----------iPAPE----------------------------------------    124

Query        136 eyrervlalrekyrp    150
d1iq0a1      125 -------------vm    126


hit structure      alignment
FAST alignment (Normalized score: 2.01 Raw score:276.10)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDM--------------------------------TFY     28
d1iq0a1        1 -------------------------GDTGPYVQYAHARAHSILRKAGEWGAPDLSQATPY     35

Query         29 LESVFDGLWSYRFFHRDLEYLLD--SDPRLRQDYREFTNRCLAAINRIFA---------K     77
d1iq0a1       36 ERALALDL----LDFEEAVLEAAEERTPHVLAQYLLDLAASWNAYYN---ARENGQPATP     88

Query         78 LADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEY    137
d1iq0a1       89 VLTA--------------------------------------------------------     92

Query        138 RERVLALREKYRP----------------------------------    150
d1iq0a1       93 -------------PEGLRELRLSLVQSLQRTLATGLDLLGIPAPEVM    126


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:63.98)
Query          1 -------------------------------FQEYEKLVDYYLD-I-P-EDRP-----IT     21
d1iq0a1        1 GDTGPYVQYAHARAHSILRKAGEWGAPDLSQATPYERALALDLLDFEEAVLEAAEERTPH     60

Query         22 --LEDMTFYLESVFDGLWSYR----FFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIF     75
d1iq0a1       61 VLAQYLLDLAASWNAYYN-ARENGQPAT-PVLT-A--PEGLRELRLSLVQSLQRTLATGL    115

Query         76 AKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTP    135
d1iq0a1      116 DLLG----I--P----A--P-EV---M---------------------------------    126

Query        136 EYRERVLALREKYRP    150
d1iq0a1      127 ---------------    127


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.18)
DALI match                               ....   *************************
Query         29 LESVFDGLWSYRFFHR------DLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKL     78
d1iq0a1       63 AQYLLDLAASWNAYYNARENGQPATPVLTAPEGLRELRLSLVQSLQRTLATGLDLL    118



top
23: d1a5ta1 delta prime subunit (cs: 2.349)

SCOP Superfamily: DNA polymerase III clamp loader subunits,​ C-​terminal domain  |  SCOP Fold: DNA polymerase III clamp loader subunits,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.65  Contact: 474
Modified z-scores:
dali:0.97 daliz:0.88 gdtts:0.95 tmscore:0.97 rmsd:0.41 AHM:0.38 LBcontacta:0.84 LBcontactb:0.83 LHM:0.13
id:0.86 blosum:0.18 compass:0.41 pearson:0.91
Scaled scores:
dali:0.61 daliz:0.33 gdtts:0.45 tmscore:0.50 rmsd:0.76 AHM:0.70 LBcontacta:0.27 LBcontactb:0.27 LHM:0.49
id:0.02 blosum:0.05 compass:0.05 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 4.2 Raw score:298.00)
Query          1 -FQEYEKLVDYYLDIpedrpitleDMTFylESVFDGLWS-YRFFhrdleylldsdprlrQ     58
d1a5ta1        1 dNWQARETLCQALAY------svpSGDW--YSLLAALNHeQAPArlhwlatllmdalkrV     52

Query         59 DYREFtNRCLAAINRIFakladagiiqpqpedlRSAMSLNVWLVITNWMAFLKTAH---L    115
d1a5ta1       53 TNVDV-PGLVAELANHL----------------SPSRLQAILGDVCHIREQLMSVTginR     95

Query        116 TEL-KQGIYQVLTLEVPYLtpeyrervlalrekyrp    150
d1a5ta1       96 ELLiTDLLLRIEHYLQPGV---------------vl    116


hit structure      alignment
FAST alignment (Normalized score: 3.02 Raw score:398.90)
Query          1 F--QEYEKLVDYYLDIPEDRPITLE-------DMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1a5ta1        1 -DNWQARETLCQAL-----------AYSVPSGDWYSLLAAL-------------------     29

Query         52 SDPRLRQDY-----REFTNRCLAAINRIFAKLADAGIIQ-----------------PQPE     89
d1a5ta1       30 ---------NHEQAPARLHWLATLLMDAL----------KRVTNVDVPGLVAELANHLSP     70

Query         90 DLRSAMSLNVWLVITNWMAFLKTAHLT----ELKQGIYQVLTLEVPYLTPEYRERVLALR    145
d1a5ta1       71 SRLQAILGDVCHIREQLMS--------VTGINRELLITDLLLRIEH--------------    108

Query        146 EKYRP--------    150
d1a5ta1      109 -----YLQPGVVL    116


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:63.59)
Query          1 -FQEYEKLVDYYLDI--PEDRPITLEDMTFYLESVFDGLWS-YRFFHRDL----------     46
d1a5ta1        1 DNWQARETLCQALAYSV-----P---SGD--WYSLLAALNHEQAPARL-HWLATLLMDAL     49

Query         47 --EYLLDSDPRLRQDYREF-TNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVI    103
d1a5ta1       50 KR-------------VTNVDVPGLVAELANHL----------------SPSRLQAILGDV     80

Query        104 TNWMAFL--KTAH-LTE-LKQGIYQVLTLEVPYLTPEYR--ERVLALREKYRP    150
d1a5ta1       81 CHIREQLMSVTGINRELLITDLLLRIEHYLQ-PG----VVL------------    116


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.36)
DALI match                                                                   
Query         65 NRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQ    124
d1a5ta1        4 QARETLCQALAYSVPSGDWYSLLAALNHEQAPARLHWLATLLMDALKRVTNVDVPGLVAE     63

DALI match                             
Query        125 VLTLEVPYLTPEYRERVLALRE    146
d1a5ta1       64 LANHLSPSRLQAILGDVCHIRE     85



top
24: d1n1ba2 (+)-​bornyl diphosphate synthase (cs: 2.314)

SCOP Superfamily: Terpenoid synthases  |  SCOP Fold: Terpenoid synthases  |  SCOP Class: All alpha proteins

Consensus: 0.21  Contact: 673
Modified z-scores:
dali:0.98 daliz:0.95 gdtts:0.98 tmscore:0.99 rmsd:0.37 AHM:0.40 LBcontacta:0.83 LBcontactb:0.81 LHM:0.33
id:0.69 blosum:0.04 compass:0.22 pearson:0.97
Scaled scores:
dali:0.66 daliz:0.38 gdtts:0.50 tmscore:0.60 rmsd:0.79 AHM:0.72 LBcontacta:0.23 LBcontactb:0.21 LHM:0.20
id:-0.01 blosum:-0.00 compass:0.11 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:514.80)
Query          1 ---------------------------------------FQEY-----eklvdyyldipe     16
d1n1ba2        1 mnplifelaklnfniiqathqqelkdlsrwwsrlcfpekLPFVrdrlvesffwavgmfep     60

Query         17 drpiTLEDMTFYLESVFDGLWSY-RFFHrdLEYL------------ldsdPRLRQDYREF     63
d1n1ba2       61 hqhgYQRKMAATIIVLATVIDDIyDVYG--TLDElelftdtfkrwdtesiTRLPYYMQLC    118

Query         64 TNRCLAAINRIFAKLADAgiiQPQPedlRSAMSLNVWLVITNWMAFL-------------    110
d1n1ba2      119 YWGVHNYISDAAYDILKE---HGFF---CLQYLRKSVVDLVEAYFHEakwyhsgytpsld    172

Query        111 KTAHltelkQGIYQVLTLEVPYLTPE----------------------------------    136
d1n1ba2      173 EYLNiakisVASPAIISPTYFTFANAshdtavidslyqyhdilclagiilrlpddlgdvp    232

Query        137 -----------------------------------------yRERVLALREKYR------    149
d1n1ba2      233 ktiqcymketnaseeeavehvkflireawkdmntaiaagypfPDGMVAGAANIGrvaqfi    292

Query        150 ----------------------p    150
d1n1ba2      293 ylhgdgfsktyehiagllfepya    315


hit structure      alignment
FAST alignment (Normalized score: 1.71 Raw score:372.40)
Query          1 F-----------------------------------------------------------      1
d1n1ba2        1 -MNPLIFELAKLNFNIIQATHQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGMFE     59

Query          2 --------------QEYEKLVDYYLDIPEDRPIT--------------------------     21
d1n1ba2       60 PHQHGYQRKMAATIIVLATVIDDI----------YDVYGTLDELELFTDTFKRWDTESIT    109

Query         22 --LEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDP------------RLRQDYREFTNRC     67
d1n1ba2      110 RLPYYMQLCYWGVHNYISD----------------AAYDILKEHGFFCLQYLRKSVVDLV    153

Query         68 LAAINRIFAKLADAGI-IQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVL    126
d1n1ba2      154 EAYFHEAKWYH-----SGYTPSLDEYL---------------------------------    175

Query        127 TLEVPYLTPEYRERVLALREKYRP------------------------------------    150
d1n1ba2      176 ------------------------NIAKISVASPAIISPTYFTFANASHDTAVIDSLYQY    211

Query        151 ------------------------------------------------------------    151
d1n1ba2      212 HDILCLAGIILRLPDDLGDVPKTIQCYMKETNASEEEAVEHVKFLIREAWKDMNTAIAAG    271

Query        151 --------------------------------------------    151
d1n1ba2      272 YPFPDGMVAGAANIGRVAQFIYLHGDGFSKTYEHIAGLLFEPYA    315


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:75.75)
Query          1 -----------------------------------FQEYEKLV---DYY-----------     11
d1n1ba2        1 MNPLIFELAKLNFNIIQATHQQELKDLSRWWSRLC--FPEKLPFVR--DRLVESFFWAVG     56

Query         12 -------LDIPEDRP-IT-LEDMTFYLESVFDGLWSYRF--FHRDLE--YLL-------D     51
d1n1ba2       57 MFEPHQH------GYQRKMAATIIVLATVIDDIYDVYGTLDELE-LFTD--TFKRWDTE-    106

Query         52 SDPRLRQDY---REF-TNRCLAAINRIFAKLAD-AGIIQPQPEDLRSAMSLNVWLVITNW    106
d1n1ba2      107 ----SITRLPYYMQLCYWGVHNYISDAAYD-ILK----EHGFF-CL-QYLRKSVVDLVEA    155

Query        107 MAFL--K------T---AH--LTELKQG-IYQVLTLEVPYLT------------------    134
d1n1ba2      156 YFHEAKWYHSGYTPSLDEYLN--IAKISVASPAIISPTYFTFANASHDTAVIDSLYQYHD    213

Query        135 ------------------------------------------------------------    135
d1n1ba2      214 ILCLAGIILRLPDDLGDVPKTIQCYMKETNASEEEAVEHVKFLIREAWKDMNTAIAAGYP    273

Query        135 -PEYRERVLALREK-Y--------------------------RP    150
d1n1ba2      274 FPDGMVAGAANIGRVAQFIYLHGDGFSKTYEHIAGLLFEPYA--    315


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.69)
DALI match                                                         
Query         57 RQDYREFTNRCLAAINRIFAKLADAGI-IQPQPEDLRSAMSLNVWLVITN    105
d1n1ba2       10 KLNFNIIQATHQQELKDLSRWWSRLCFPEKLPFVRDR-LVESFFWAVGMF     58



top
25: d1s35a1 Spectrin beta chain (cs: 2.310)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.42  Contact: 384
Modified z-scores:
dali:0.94 daliz:0.91 gdtts:0.92 tmscore:0.95 rmsd:0.37 AHM:0.35 LBcontacta:0.88 LBcontactb:0.79 LHM:0.18
id:0.64 blosum:0.17 compass:0.35 pearson:0.90
Scaled scores:
dali:0.67 daliz:0.45 gdtts:0.49 tmscore:0.53 rmsd:0.76 AHM:0.72 LBcontacta:0.34 LBcontactb:0.27 LHM:0.42
id:-0.01 blosum:0.03 compass:0.10 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 5.8 Raw score:310.20)
Query          1 -------FQEYEKLVDYYLD-IPEDR------------piTLEDMTFYLEsVFDGLWSYR     40
d1s35a1        1 eqaflqdLDDFQAWLSITQKaVASEDmpeslpeaeqllqqHAGIKDEIDG-HQDSYQRVK     59

Query         41 FFHRDLEY--llDSDPRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlrsamsln     98
d1s35a1       60 ESGEKVIQgqtdPEYLLLGQRLEGLDTGWDALGRMWESRSHTLA----------------    103

Query         99 vwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1s35a1      104 -------------------------------------------------qcl    106


hit structure      alignment
FAST alignment (Normalized score: 3.34 Raw score:420.70)
Query          1 FQEYEKLVDYYLDIPEDRPI---TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS-----     52
d1s35a1        1 --------------------EQAFLQDLDDFQAWLSITQKAV-------------ASEDM     27

Query         53 ---------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLR-----------     92
d1s35a1       28 PESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEK------------VIQGQTDPEYL     75

Query         93 -----SAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREK    147
d1s35a1       76 LLGQRLEGLDTGWDALGR------------------------------------------     93

Query        148 YRP-------------    150
d1s35a1       94 ---MWESRSHTLAQCL    106


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:61.83)
Query          1 ---FQEYEKLVDYYL-DI--P--E-D----------RP-ITLEDMTFYLESVFDGLWSYR     40
d1s35a1        1 EQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQD-SYQ--R     57

Query         41 FFHRDLEYLLDS----DPRLRQDYREFTNRCLAAINRIFAKLADAGI-IQPQPEDLRSAM     95
d1s35a1       58 VKESGEKVIQGQTDPEYLLLGQRLEGLDTGWDALGRMWESRSHTLAQC------------    105

Query         96 SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1s35a1      106 ----------------------------------------L--------------    106


hit structure      alignment
HHsearch alignment (Probability: 0.14 E-value:0.09)
DALI match                                                                   
Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLT    116
d1s35a1        1 EQAFLQDLDDFQAWLSITQKAVASEDMPE-SLPEAEQ-LLQQHAGIKDEIDG--HQDSYQ     56

DALI match                                        
Query        117 ELKQGIYQVLTLEVPYLTPEYRERVLALREKYR    149
d1s35a1       57 RVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWD     89



hit structures. 
top
26: d1hs7a_ Vam3p N-​terminal domain (cs: 2.307)

SCOP Superfamily: t-​snare proteins  |  SCOP Fold: STAT-​like  |  SCOP Class: All alpha proteins

Consensus: 0.63  Contact: 397
Modified z-scores:
dali:0.94 daliz:0.89 gdtts:0.97 tmscore:0.98 rmsd:0.28 AHM:0.29 LBcontacta:0.85 LBcontactb:0.85 LHM:0.16
id:0.88 blosum:0.40 compass:0.62 pearson:0.89
Scaled scores:
dali:0.67 daliz:0.42 gdtts:0.61 tmscore:0.65 rmsd:0.82 AHM:0.74 LBcontacta:0.29 LBcontactb:0.33 LHM:0.45
id:0.03 blosum:0.07 compass:0.03 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 6.0 Raw score:285.00)
Query          1 ----------FQEYEKLVDYYLD---IPEDRP-ITLEDMTFYL-ESVFDGLWsyRFFHRD     45
d1hs7a_        1 tnqktkelsnLIETFAEQSRVLEkecTKIGSKrDSKELRYKIEtELIPNCTSvrDKIESN     60

Query         46 leYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAgiiqpqpedlrsamslnvwlvitn    105
d1hs7a_       61 --ILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLF------------------------     94

Query        106 wmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1hs7a_       95 ------------------------------------------plk     97


hit structure      alignment
FAST alignment (Normalized score: 4.76 Raw score:574.80)
Query          1 F---------------QEYEKLVDYYL-DIPEDRPITLEDMTFYL-ESVFDGLWSYRFFH     43
d1hs7a_        1 -TNQKTKELSNLIETFAEQSRVLEKECTKIGSK-RDSKELRYKIETELIPNCTSVRDKIE     58

Query         44 RDLEYLLDS----DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNV     99
d1hs7a_       59 --SNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSL-----------------------     93

Query        100 WLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP----    150
d1hs7a_       94 ---------------------------------------------------FPLK     97


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:63.85)
Query          1 --------F--QEYEKLVDYYL-D-IPE-DRP-ITLEDMTFYLESV-FDG-LWSYRFFHR     44
d1hs7a_        1 TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTS--VRDKIE     58

Query         45 DLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVIT    104
d1hs7a_       59 SN-ILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPL---------------------     96

Query        105 NWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1hs7a_       97 -------------------------------K--------------     97


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.07)
DALI match                            
Query         42 FHRDLEYLLDSDPRLRQDYRE     62
d1hs7a_       69 LSADFKNLKTKYQSLQQSYNQ     89



top
27: d1fcya_ Retinoic acid receptor gamma (RAR-​gamma) (cs: 2.261)

SCOP Superfamily: Nuclear receptor ligand-​binding domain  |  SCOP Fold: Nuclear receptor ligand-​binding domain  |  SCOP Class: All alpha proteins

Consensus: 0.35  Contact: 604
Modified z-scores:
dali:0.95 daliz:0.91 gdtts:0.95 tmscore:0.98 rmsd:0.44 AHM:0.53 LBcontacta:0.88 LBcontactb:0.76 LHM:0.22
id:0.96 blosum:0.52 compass:0.30 pearson:0.97
Scaled scores:
dali:0.64 daliz:0.34 gdtts:0.44 tmscore:0.52 rmsd:0.73 AHM:0.61 LBcontacta:0.26 LBcontactb:0.18 LHM:0.30
id:0.05 blosum:0.11 compass:0.16 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:450.20)
Query          1 fqeyeklvdyyldipedrpiTLEDMTFYLESvfdGLWSYRFfhrDLEY------lldSDP     54
d1fcya_        1 -------------aspqleeLITKVSKAHQE-tfPSLCQLG---KYTTnssadhrvqLDL     43

Query         55 RLRQDYREFTNRCLAAINRIFAKLadagIIQP-----QPEDLRSAMSLNVWLVITNWMA-    108
d1fcya_       44 GLWDKFSELATKCIIKIVEFAKRL----PGFTglsiaDQITLLKAACLDILMLRICTRYt     99

Query        109 ----------------------------------FLKTAHlTELK-QGIYQVLTLEVPY-    132
d1fcya_      100 peqdtmtfsdgltlnrtqmhnagfgpltdlvfafAGQLLPlEMDDtETGLLSAICLICGd    159

Query        133 --------lTPEYRERVLALREKYR-----------------------------------    149
d1fcya_      160 rmdleepekVDKLQEPLLEALRLYArrrrpsqpymfprmlmkitdlrgistkgaeraitl    219

Query        150 ----------------p    150
d1fcya_      220 kmeipgpmppliremle    236


hit structure      alignment
FAST alignment (Normalized score: 1.77 Raw score:333.00)
Query          1 FQEYEKLVDYYLDIPEDRPIT---------------------------------------     21
d1fcya_        1 ---------------------ASPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRV     39

Query         22 ------------------------------------------------------------     22
d1fcya_       40 QLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT     99

Query         22 -------------------------------------------LEDMTFYLESVFDGLWS     38
d1fcya_      100 PEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICL----    155

Query         39 YRFFHRDLEYLLDSDPR---------LRQDYREFTNRCLAAINRIFAKLADAGIIQPQP-     88
d1fcya_      156 -----------------ICGDRMDLEEPEKVDKLQ---EPLLEALRLYARR--------R    187

Query         89 ---EDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALR    145
d1fcya_      188 RPSQPYMFPRMLMKITDLRGISTKGAE---------------------------------    214

Query        146 EKYRP----------------------    150
d1fcya_      215 -----RAITLKMEIPGPMPPLIREMLE    236


hit structure      alignment
TMalign alignment (TM-score: 0.51 Raw score:76.09)
Query          1 ---------FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFF---HRD-LE     47
d1fcya_        1 ASPQLEELI-------------------TKVSKAHQETFPS-LCQLGKYTTNSS--AD-H     37

Query         48 YL-LDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP---QPEDLRSAMSLNVWLVI    103
d1fcya_       38 RVQLD-LG-LWDKFSELATKCIIKIVEFAKRL--PGFTGLSIADQITLLKAACLDILMLR     93

Query        104 TNW-M--------------------------------A-FLKTAHLTELKQ---GI-YQV    125
d1fcya_       94 ICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAG-QL-LPLEMDDTETGLLS    151

Query        126 LTLEVP------------YLTPEYR-ERVLALRE-KY-----R--P--------------    150
d1fcya_      152 AICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTK    211

Query        151 -------------------------    151
d1fcya_      212 GAERAITLKMEIPGPMPPLIREMLE    236


hit structure      alignment
HHsearch alignment (Probability: 0.16 E-value:0.04)
DALI match                                                                   
Query         13 DIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLL------DSDPRLRQDYREFTNR     66
d1fcya_       66 RLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGP    125

DALI match                                                                   
Query         67 CLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVL    126
d1fcya_      126 LTDLVFAFAGQLLP---LEMDDTET-G----LLSAICLICGDRMDLEEPEKVDKLQEPLL    177

DALI match                           
Query        127 TLEVPYLTPEYRERVLALRE    146
d1fcya_      178 EALRLYARRRRPSQPYMFPR    197



top
28: d1ivsa2 Valyl-​tRNA synthetase (ValRS) (cs: 2.238)

SCOP Superfamily: Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases  |  SCOP Fold: Anticodon-​binding domain of a subclass of class I aminoacyl-​tRNA synthetases  |  SCOP Class: All alpha proteins

Consensus: 0.27  Contact: 392
Modified z-scores:
dali:0.95 daliz:0.89 gdtts:0.84 tmscore:0.91 rmsd:0.67 AHM:0.63 LBcontacta:0.89 LBcontactb:0.84 LHM:0.25
id:0.84 blosum:0.38 compass:0.30 pearson:0.96
Scaled scores:
dali:0.66 daliz:0.40 gdtts:0.36 tmscore:0.39 rmsd:0.59 AHM:0.51 LBcontacta:0.31 LBcontactb:0.33 LHM:0.25
id:0.01 blosum:0.08 compass:0.14 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 4.2 Raw score:309.20)
Query          1 ----------------------------FQEYEKLVDYYL-DIPE--DRPITLEDMTFYL     29
d1ivsa2        1 anklynaarfvllsregfqakedtptlaDRFMRSRLSRGVeEITAlyEALDLAQAAREVY     60

Query         30 ESVFDG-LWSYRFFhrdLEYLlDSDPRLRQDYREFTNRCLAAINRIFAkladagiiqpqp     88
d1ivsa2       61 ELVWSEfCDWYLEA--aKPALkAGNAHTLRTLEEVLAVLLKLLHPMMPfltselyqaltg    118

Query         89 eDLRSAM--------slnvwlvitnwMAFLKTAH--------------------------    114
d1ivsa2      119 kEELALEawpepggrdeeaerafealKQAVTAVRalkaeaglppaqevrvylegetapve    178

Query        115 ----ltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1ivsa2      179 enlevfrflsradllperpakalvkamprvtarmplegll    218


hit structure      alignment
FAST alignment (Normalized score: 2.72 Raw score:491.90)
Query          1 F--------------------------------QEYEKLVDYYLDI---PEDRPI--TLE     23
d1ivsa2        1 -ANKLYNAARFVLLSREGFQAKEDTPTLADRFMRSRLSRGVEE---ITALYEA--LDLAQ     54

Query         24 DMTFYLESVFDGLWSYRFFHRDLEYLLD-SDPRLRQDYREFTNRCLAAINRIFAKLADAG     82
d1ivsa2       55 AAREVYELVWSEF--CDWYLEAAKPALKAGNAHTLRTLEEVLAVLLKLLHPM--------    104

Query         83 IIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVL    142
d1ivsa2      105 ------------------------------------------------------------    105

Query        143 ALREKYRP----------------------------------------------------    150
d1ivsa2      105 --------MPFLTSELYQALTGKEELALEAWPEPGGRDEEAERAFEALKQAVTAVRALKA    156

Query        151 ------------------------------------------------------------    151
d1ivsa2      157 EAGLPPAQEVRVYLEGETAPVEENLEVFRFLSRADLLPERPAKALVKAMPRVTARMPLEG    216

Query        151 --    151
d1ivsa2      217 LL    218


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:62.08)
Query          1 ------------------------FQEYEKLVDYYLD--IP--EDRP----I--TLEDMT     26
d1ivsa2        1 ANKLYNAARFVLLSREGFQAKEDTPTLADRFMRSRLSRGVEEITALYEALDLAQAAREVY     60

Query         27 FY-LESV-FDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGII     84
d1ivsa2       61 ELVWSEFCDWYLE-A--AKPALK-AG-----NA-HTLRTLEEVLAVLLKLLH--P---MM    105

Query         85 QPQPEDLRSAMSL----------------------------------NVWLVITNWMAFL    110
d1ivsa2      106 -PFLTSELYQALTGKEELALEAWPEPGGRDEEAERAFEALKQAVTAV-------------    151

Query        111 KTAHLT--E---------------------------------------------------    117
d1ivsa2      152 ----RALKAEAGLPPAQEVRVYLEGETAPVEENLEVFRFLSRADLLPERPAKALVKAMPR    207

Query        118 -----------LKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1ivsa2      208 VTARMPLEGLL---------------------------------    218


hit structure      alignment
HHsearch alignment (Probability: 0.29 E-value:0.01)
DALI match                                                                   
Query         36 LWS-YRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSA     94
d1ivsa2        4 LYNAARFVLLSREGFQAKEDTPTLADRFMRSRLSRGVEEITALYEA-----LDLAQAARE     58

DALI match                                                                 
Query         95 MSLNVWLVITNW-----------MAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERV    141
d1ivsa2       59 VYELVWSEFCDWYLEAAKPALKAGNAHTLRTLEEVLAVLLKLLHPMMPFLTSELYQAL    116



top
29: d1pbwa_ p85 alpha subunit RhoGAP domain (cs: 2.230)

SCOP Superfamily: GTPase activation domain,​ GAP  |  SCOP Fold: GTPase activation domain,​ GAP  |  SCOP Class: All alpha proteins

Consensus: 0.39  Contact: 408
Modified z-scores:
dali:0.96 daliz:0.89 gdtts:0.92 tmscore:0.95 rmsd:0.49 AHM:0.54 LBcontacta:0.77 LBcontactb:0.69 LHM:0.18
id:0.85 blosum:0.23 compass:0.12 pearson:0.88
Scaled scores:
dali:0.60 daliz:0.33 gdtts:0.40 tmscore:0.42 rmsd:0.66 AHM:0.54 LBcontacta:0.21 LBcontactb:0.18 LHM:0.35
id:0.01 blosum:0.06 compass:0.08 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:304.20)
Query          1 ----------fQEYEKLVDYYL--DIPE----------------------------drpi     20
d1pbwa_        1 lpdlaeqfappDIAPPLLIKLVeaIEKKglecstlyrtqsssnlaelrqlldcdtpsvdl     60

Query         21 tlEDMTFYLESVFDGLWSyRFFH------------------------rdlEYLLDSDPrL     56
d1pbwa_       61 emIDVHVLADAFKRYLLD-LPNPvipaavysemislapevqsseeyiqllKKLIRSPS-I    118

Query         57 RQDYREFTNRCLAAINRIFAKLadagiIQPQpedlRSAMSLNVWLVITNWmAFLKTahlt    116
d1pbwa_      119 PHQYWLTLQYLLKHFFKLSQTS-----SKNL---lNARVLSEIFSPMLFR-FSAAS----    165

Query        117 elkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1pbwa_      166 ---------------sdntenlikvieilistew    184


hit structure      alignment
FAST alignment (Normalized score: 3.21 Raw score:533.20)
Query          1 FQEY--------------EKLVDYYLDIPEDRPI--------------------------     20
d1pbwa_        1 ----LPDLAEQFAPPDIAPPLLIKLV--------EAIEKKGLECSTLYRTQSSSNLAELR     48

Query         21 ----------------TLEDMTFYLESVFDGLWSYRFFHRDLEYL---------------     49
d1pbwa_       49 QLLDCDTPSVDLEMIDVHVLADAFKRYLL----------------DLPNPVIPAAVYSEM     92

Query         50 ----------------------LDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQ     87
d1pbwa_       93 ISLAPEVQSSEEYIQLLKKLIRSPSI---PHQYWLTLQYLLKHFFKLSQTSSKN------    143

Query         88 PEDL--RSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALR    145
d1pbwa_      144 ----LLNARVLSEIFSPMLF----------------------------------------    159

Query        146 EKYRP-------------------------    150
d1pbwa_      160 -----RFSAASSDNTENLIKVIEILISTEW    184


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:67.42)
Query          1 ---F-QEY------EKLVDYYLD--IPEDRPITLEDMT----------------------     26
d1pbwa_        1 LPDLAEQFAPPDIAPPLLIKLVEAIEKK-GLECST-LYRTQSSSNLAELRQLLDCDTPSV     58

Query         27 -------F-YLESVFDGLWSYRFFHRDL-EY------------------------L-LDS     52
d1pbwa_       59 DLEMIDVHVLADAFKRYLLDL-PNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPS    117

Query         53 DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAM-SLNVWLVITNWMAFLK    111
d1pbwa_      118 I--P-HQYWLTLQYLLKHFFKLSQTSS--KNLL-N----A--RVLSEIFSPMLF-RFS--    162

Query        112 TA--------HLTELKQGIYQV-----------LTLEVPYLTPEYRERVLALREKYRP    150
d1pbwa_      163 AASSDNTENL-----------IKVIEILISTEW-------------------------    184


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.12)
DALI match                                   
Query         10 YYLDIPEDRPITLEDMTFYLESVFDGLW     37
d1pbwa_      157 MLFRFSAASSDNTENLIKVIEILISTEW    184



top
30: d1fx8a_ Glycerol uptake facilitator protein GlpF (cs: 2.212)

SCOP Superfamily: Aquaporin-​like  |  SCOP Fold: Aquaporin-​like  |  SCOP Class: Membrane and cell surface proteins and peptides

Consensus: 0.45  Contact: 504
Modified z-scores:
dali:0.96 daliz:0.85 gdtts:0.95 tmscore:0.98 rmsd:0.44 AHM:0.46 LBcontacta:0.79 LBcontactb:0.67 LHM:0.13
id:0.85 blosum:0.09 compass:0.13 pearson:0.55
Scaled scores:
dali:0.64 daliz:0.30 gdtts:0.41 tmscore:0.49 rmsd:0.75 AHM:0.65 LBcontacta:0.22 LBcontactb:0.17 LHM:0.46
id:0.01 blosum:0.02 compass:0.01 pearson:-0.00

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:378.00)
Query          1 -----FQEYEKLVDYYLD----iPEDRP------iTLEDMTFYLESVFDGLWSYRF----     41
d1fx8a_        1 tlkgqCIAEFLGTGLLIFfgvgcVAALKvagasfgQWEISVIWGLGVAMAIYLTAGvsga     60

Query         42 -----fhrDLEY--lLDSDpRLRQDYREFT------------------------------     64
d1fx8a_       61 hlnpavtiALWLfacFDKR-KVIPFIVSQVagafcaaalvyglyynlffdfeqthhivrg    119

Query         65 --nrclaainRIFAkladagiIQPQPEDLRSAMSLNVWLVITNWMAFLKTAH------LT    116
d1fx8a_      120 svesvdlagtFSTY------pNPHINFVQAFAVEMVITAILMGLILALTDDGngvprgPL    173

Query        117 ELKQ---GIYQVL-TLEV------------------------------------------    130
d1fx8a_      174 APLLiglLIAVIGaSMGPltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplf    233

Query        131 -pyltpeyrervlalrekyrp    150
d1fx8a_      234 gpivgaivgafayrkligrhl    254


hit structure      alignment
FAST alignment (Normalized score: 3.12 Raw score:609.90)
Query          1 F---------QEYEKLVDYYLDIP---------EDRPI-TLEDMTFYLESVFDGLWSYRF     41
d1fx8a_        1 -TLKGQCIAEFLGTGLLIFFG---VGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAG     56

Query         42 FHRDLEYLLD-----------------------SDPRLRQDYREFTNRCLAAINRIFAKL     78
d1fx8a_       57 ----------VSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAF-------------     93

Query         79 ADAGIIQ-------------------------------------------PQPEDLR---     92
d1fx8a_       94 -------CAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAV    146

Query         93 -SAMSLNVWLVITNWMA-FLKTAHLT------ELKQGIYQVLTLEVPYLTPEYRERVLAL    144
d1fx8a_      147 EMVITAILMGLILAL--TDDGNG---VPRGPLAPLLIGLLIAVIGASM------------    189

Query        145 REKYRP------------------------------------------------------    150
d1fx8a_      190 ------GPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGA    243

Query        151 -----------    151
d1fx8a_      244 FAYRKLIGRHL    254


hit structure      alignment
TMalign alignment (TM-score: 0.50 Raw score:74.86)
Query          1 ----F-QEYEKLVDYYLD--IP-ED-RPI----TL--EDMTFYLESVFDGLWS-YR-FF-     42
d1fx8a_        1 TLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGA     60

Query         43 H----RD--LE---YLLDSDPRLRQDYRE-FT--NRC-----------------------     67
d1fx8a_       61 HLNPAVTIALWLFACFDK-R--KVIPFIVSQVAG-AFCAAALVYGLYYNLFFDFEQTHHI    116

Query         68 -----------LAA-INRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-K--T    112
d1fx8a_      117 VRGSVESVDLA--GT-FST-YP-N-----PHINFVQAFAVEMVITAILMGLILALTDDGN    166

Query        113 AH----LT-EL-KQGIYQVLTLEVPY----------------------------------    132
d1fx8a_      167 GVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIP    226

Query        133 ----------------------------LTPEYRERVLALREKYRP    150
d1fx8a_      227 YFLVPLFGPIVGAIVGAFAYRKLIGRHL------------------    254


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.45)
DALI match                
Query        101 LVITNWMAF    109
d1fx8a_       10 FLGTGLLIF     18



hit structures. 
top
31: d1ls1a1 Signal sequence recognition protein Ffh (cs: 2.202)

SCOP Superfamily: Domain of the SRP/​SRP receptor G-​proteins  |  SCOP Fold: Four-​helical up-​and-​down bundle  |  SCOP Class: All alpha proteins

Consensus: 0.38  Contact: 424
Modified z-scores:
dali:0.92 daliz:0.85 gdtts:0.92 tmscore:0.94 rmsd:0.49 AHM:0.48 LBcontacta:0.82 LBcontactb:0.80 LHM:0.20
id:0.86 blosum:0.20 compass:0.17 pearson:0.88
Scaled scores:
dali:0.58 daliz:0.33 gdtts:0.48 tmscore:0.48 rmsd:0.67 AHM:0.58 LBcontacta:0.29 LBcontactb:0.28 LHM:0.26
id:0.02 blosum:0.04 compass:0.09 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:277.30)
Query          1 fqeyeklvdyyldipedRPIT-LEDMTFYLESVfDGLWsyrffhrdleylldsdprlrqd     59
d1ls1a1        1 -----------------MFQQlSARLQEAIGRL-RGRG--------------------ri     22

Query         60 YREFTNRCLAAINRIFAKLAdagiiqpQPEDLRSAMSLNVWLVIT--NWMAFlktahlte    117
d1ls1a1       23 TEEDLKATLREIRRALMDAD-------VNLEVARDFVERVREEALgkQVLES------lt     69

Query        118 LKQG-IYQVLTLEVPYLTpeyrervlalrekyrp    150
d1ls1a1       70 PAEViLATVYEALKEALG---------------g     88


hit structure      alignment
FAST alignment (Normalized score: 3.44 Raw score:395.40)
Query          1 -FQEYEKLVDYYLD-IPED-RPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLR     57
d1ls1a1        1 MFQQLSARLQEAI-GRLRGRGRITEEDLKATLREIRRALMD-------------------     40

Query         58 QDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTE    117
d1ls1a1       41 ------------------------------------------------------------     41

Query        118 -------LKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--------------------    150
d1ls1a1       41 ADVNLEVARDFVERVREEALG-------------------KQVLESLTPAEVILATVYEA     81

Query        151 -------    151
d1ls1a1       82 LKEALGG     88


hit structure      alignment
TMalign alignment (TM-score: 0.31 Raw score:46.16)
Query          1 -FQEYEKLVDYYLD-IPEDRPITLEDMTFYLESVFDGLWSYRFFHR----------DLEY     48
d1ls1a1        1 MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDAD--VNLEVARDFVER----     54

Query         49 LLDSDPRLRQDYREFTNRCL--AAIN--RIFAKLADA----GIIQPQPEDLR---SAMSL     97
d1ls1a1       55 -------------------VRE--EALG--KQVLESLTPAE----------VILA---TV     78

Query         98 -NVWL--VITN--WMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1ls1a1       79 Y-EALKE--ALGG---------------------------------------------     88


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.09)
DALI match                                         
Query         65 NRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLN     98
d1ls1a1        3 QQLSARLQEAIGRLRGRGRI--TEEDLKATLREI     34



top
32: d1fioa_ Sso1 (cs: 2.171)

SCOP Superfamily: t-​snare proteins  |  SCOP Fold: STAT-​like  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 335
Modified z-scores:
dali:0.93 daliz:0.91 gdtts:0.94 tmscore:0.95 rmsd:0.37 AHM:0.43 LBcontacta:0.85 LBcontactb:0.88 LHM:0.42
id:0.86 blosum:0.28 compass:0.45 pearson:0.96
Scaled scores:
dali:0.73 daliz:0.51 gdtts:0.55 tmscore:0.59 rmsd:0.78 AHM:0.66 LBcontacta:0.36 LBcontactb:0.38 LHM:0.21
id:0.03 blosum:0.04 compass:0.17 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:343.40)
Query          1 --------------------FQEYEKLVDYYLD--IPEDrpitledmTFYLESVFDGLWS     38
d1fioa_        1 mhdfvgfmnkisqinrdldkYDHTINQVDSLHKrlLTEV---neeqaSHLRHSLDNFVAQ     57

Query         39 YRFFHRDLEY------------------lldSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1fioa_       58 ATDLQFKLKNeiksaqrdgihdtnkqaqaenSRQRFLKLIQDYRIVDSNYKEENKEQAKR    117

Query         81 AG------------iiQPQPedlrsamslnvwlvitnwmaflktahltelkqgiyqvltl    128
d1fioa_      118 QYmiiqpeatedeveaAISD--------------------------------vggqqifs    145

Query        129 evpyltPEYRE-----------------------rvlalrekyrp    150
d1fioa_      146 qalleaKTALAevqarhqellkleksmaeltqlfndmeelvieqq    190


hit structure      alignment
FAST alignment (Normalized score: 3.42 Raw score:577.40)
Query          1 -----------------FQEYEKLVDYYLDIPEDRPI--------------TLEDMTFYL     29
d1fioa_        1 MHDFVGFMNKISQINRDLDKYDHTINQVD--------SLHKRLLTEVNEEQASHLRHSLD     52

Query         30 ESVFDGLWSYRFFHRDLEYLLDS-----------DPRLRQDYREFTNRCLAAINRIFAKL     78
d1fioa_       53 NFVAQATDLQFKLKNEIKSAQR-DGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEEN    111

Query         79 ADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYR    138
d1fioa_      112 KE----------------------------------------------------------    113

Query        139 ERVLALREKYRP------------------------------------------------    150
d1fioa_      114 ------------QAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLEAKTALAEVQAR    161

Query        151 -----------------------------    151
d1fioa_      162 HQELLKLEKSMAELTQLFNDMEELVIEQQ    190


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:66.60)
Query          1 ------------------------FQEYEKLVDYYLDIPEDRPITLEDMTF-YLESVFDG     35
d1fioa_        1 MHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTE--------VN-EEQ-ASHLRHS     50

Query         36 LWSY-RFFHRDLEYLL--D--------------------S--DPRLRQDYREFTNRCLAA     70
d1fioa_       51 LDNFVAQATDLQFKLKNEIKSAQRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEE    110

Query         71 INRIFAKLADAGI--IQ---PQPEDLRSAM-SLNVWLVITNWMAFLKTAHLTELKQGIYQ    124
d1fioa_      111 NKEQAKRQYMIIQPE-ATEDEVEA-AI-SDV-----------------------------    138

Query        125 VLTLEVPYL-TPE-YRERVLAL-R-------------------------------EKYRP    150
d1fioa_      139 ---GGQQIFSQALLEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQ-----    190


hit structure      alignment
HHsearch alignment (Probability: 0.32 E-value:0.02)
DALI match          .  ...............................                       
Query         46 LEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSL--------     97
d1fioa_       86 AENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFS    145

DALI match                                          
Query         98 NVWLVITNWMAFLKTAHLT--ELKQGIYQVLTLEV    130
d1fioa_      146 QALLEAKTALAEVQARHQELLKLEKSMAELTQLFN    180



top
33: d1hf8a1 Clathrin assembly lymphoid myeloid leukaemia protein,​ Calm (cs: 2.161)

SCOP Superfamily: GAT-​like domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.57  Contact: 385
Modified z-scores:
dali:0.94 daliz:0.91 gdtts:0.91 tmscore:0.93 rmsd:0.37 AHM:0.42 LBcontacta:0.87 LBcontactb:0.91 LHM:0.18
id:0.41 blosum:0.08 compass:0.22 pearson:0.84
Scaled scores:
dali:0.68 daliz:0.45 gdtts:0.48 tmscore:0.50 rmsd:0.77 AHM:0.70 LBcontacta:0.31 LBcontactb:0.38 LHM:0.47
id:-0.04 blosum:-0.01 compass:0.06 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 5.5 Raw score:308.50)
Query          1 ---------------FQEYEKLVDYYLD--IPEDRP----------iTLEDMTFYLESVF     33
d1hf8a1        1 rgadgvmrtmnteklLKTVPIIQNQMDAllDFNVNSneltngvinaaFMLLFKDAIRLFA     60

Query         34 DGLWSYRFFHRDLEYLlDSDP-RLRQDYREFTNRCLAAINRIFAKLADAgiiqpqpedlr     92
d1hf8a1       61 AYNEGIINLLEKYFDM-KKNQcKEGLDIYKKFLTRMTRISEFLKVAEQV-----------    108

Query         93 samslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1hf8a1      109 ----------------------------------gidrgdipdlsqapsslldaleqh    132


hit structure      alignment
FAST alignment (Normalized score: 3.17 Raw score:446.70)
Query          1 FQEYEKLVDYYLDIPEDR--------PITLEDMTFYLESVFDGLWSYRFFHRD---LEYL     49
d1hf8a1        1 ------------------RGADGVMRTMNTEKLLKTVPIIQNQMDALLD----FNVNSNE     38

Query         50 LDS---DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNW    106
d1hf8a1       39 LT-NGVINAAFMLLFKDAIRLFAAYNEGIINLLE--------------------------     71

Query        107 MAFLKTAHLTELKQGIYQVLTLEVPYL-TPEYRERVLALREKYRP---------------    150
d1hf8a1       72 ---------------------------KYFDMKKNQCKEGLD---IYKKFLTRMTRISEF    101

Query        151 -------------------------------    151
d1hf8a1      102 LKVAEQVGIDRGDIPDLSQAPSSLLDALEQH    132


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:60.65)
Query          1 ---------------FQEYEKLVDYYLD-I-PED---RP-----I--TLEDMTFYLESVF     33
d1hf8a1        1 RGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFA     60

Query         34 DGLWSYRFFHRDLEYLLDSD-PRLRQDYREFTNRCLAAINRIFAKLADAGIIQ----PQP     88
d1hf8a1       61 AYNEGIINLLEKYFDM-KKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIP---    116

Query         89 EDLRSAMSLNVWL-----------VITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEY    137
d1hf8a1      117 ------DL-S-QAPSSLLDALEQH------------------------------------    132

Query        138 RERVLALREKYRP    150
d1hf8a1      133 -------------    133


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.77)
DALI match                                                               
Query         25 MTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1hf8a1       45 NAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISE    100



top
34: d1quua2 alpha-​actinin (cs: 2.127)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 355
Modified z-scores:
dali:0.95 daliz:0.93 gdtts:0.93 tmscore:0.94 rmsd:0.37 AHM:0.42 LBcontacta:0.83 LBcontactb:0.78 LHM:0.40
id:0.41 blosum:0.19 compass:0.42 pearson:0.91
Scaled scores:
dali:0.69 daliz:0.48 gdtts:0.51 tmscore:0.51 rmsd:0.77 AHM:0.70 LBcontacta:0.32 LBcontactb:0.29 LHM:0.20
id:-0.03 blosum:0.03 compass:0.09 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 5.1 Raw score:306.10)
Query          1 -------------FQEYEKLVDYYLD--IPEDR-------piTLEDMTFYLESVFDGLWS     38
d1quua2        1 etidqlhlefakrAAPFNNWMEGAMEdlQDMFIvhsieeiqsLITAHEQFKATLPEADGE     60

Query         39 YRFFHRDLEY--------------lldsdprLRQDYREFTNRCLAAINRIFAKLADAGii     84
d1quua2       61 RQSIMAIQNEvekviqsynirisssnpystvTMDELRTKWDKVKQLVPIRDQSLQEEL--    118

Query         85 qpqpedlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyLTPEyrervlal    144
d1quua2      119 -----------------------------------------------aRQHA--------    123

Query        145 rekyrp    150
d1quua2      124 -----n    124


hit structure      alignment
FAST alignment (Normalized score: 2.39 Raw score:325.50)
Query          1 FQEYEKLVDYYLDIPEDRPI-----TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS---     52
d1quua2        1 --------------------ETIDQLHLEFAKRAAPFNNWMEGAMEDL---------QDM     31

Query         53 ---------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSL     97
d1quua2       32 FIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKV-----------------     74

Query         98 NVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP-------    150
d1quua2       75 -----------------------------------------------------IQSYNIR     81

Query        151 -------------------------------------------    151
d1quua2       82 ISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHAN    124


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:49.61)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLE--YL---------     49
d1quua2        1 ------------------ETI-DQLHLEFAKRA-APF-NN-WMEGAMEDLQDMFIVHSIE     38

Query         50 -------LDS--DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP--------QPEDLR     92
d1quua2       39 EIQSLIT-AHEQFKATLPEADGERQSIMAIQNEVEKVIQS-YNIRISSSNPYST------     90

Query         93 SAMSLNVWLVITN--------------------------WMAFLKTAHLTELKQGIYQVL    126
d1quua2       91 -----VTMDELRTKWDKVKQLVPIRDQSLQEELARQHAN---------------------    124

Query        127 TLEVPYLTPEYRERVLALREKYRP    150
d1quua2      125 ------------------------    125


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.06)
DALI match            .   ..........................
Query         47 EYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADA     81
d1quua2       87 PYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQ    121



top
35: d1pq1a_ Apoptosis regulator Bcl-​xL (cs: 2.121)

SCOP Superfamily: Bcl-​2 inhibitors of programmed cell death  |  SCOP Fold: Toxins'​ membrane translocation domains  |  SCOP Class: Membrane and cell surface proteins and peptides

Consensus: 0.44  Contact: 325
Modified z-scores:
dali:0.92 daliz:0.91 gdtts:0.95 tmscore:0.95 rmsd:0.33 AHM:0.36 LBcontacta:0.81 LBcontactb:0.77 LHM:0.26
id:0.53 blosum:0.36 compass:0.42 pearson:0.93
Scaled scores:
dali:0.70 daliz:0.47 gdtts:0.62 tmscore:0.61 rmsd:0.79 AHM:0.71 LBcontacta:0.32 LBcontactb:0.30 LHM:0.20
id:-0.01 blosum:0.07 compass:0.14 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:301.10)
Query          1 ------------------------------------------------------------      1
d1pq1a_        1 msqsnrelvvdflsyklsqkgyswsqfsrevipmaavkqalreagdefelryrrafsdlt     60

Query          1 ------FQEYEKLVDYYLD-IPEDRpITLEDMTFYLESVFDGLWSYR--FFHRdleylld     51
d1pq1a_       61 sqlhitPGTAYQSFEQVVNeLFRDG-VNWGRIVAFFSFGGALCVESVdkEMQV-------    112

Query         52 sdprlrqdyrEFTNRCLAAIN-RIFAKLADAGIIqpqpedlrsamslnvwlvitnwmafl    110
d1pq1a_      113 -------lvsRIASWMATYLNdHLEPWIQENGGW--------------------------    139

Query        111 ktahltelkqgiyqvltlevpyltpeYRERVLalrekyrp    150
d1pq1a_      140 ------------------------dtFVDLYG--------    147


hit structure      alignment
FAST alignment (Normalized score: 2.53 Raw score:375.00)
Query          1 FQEYEKLVDYYLDIPEDRPI----------------------------------------     20
d1pq1a_        1 --------------------MSQSNRELVVDFLSYKLSQKGYSWSQFSREVIPMAAVKQA     40

Query         21 -----------------------------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1pq1a_       41 LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNEL-------------------     81

Query         52 SDPRLRQD-----YREFTNRCLAAINRIFAKLADAGIIQPQ---PEDLRSAMSLNVWLVI    103
d1pq1a_       82 --------FRDGVNWGRIVAFFSFGGALCVESVDKE-----MQVLVSRIASWMATYLNDH    128

Query        104 TNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP------------    150
d1pq1a_      129 LEPWIQE----------------------------------------NGGWDTFVDLYG    147


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:59.33)
Query          1 ------------------------------------------------------------      1
d1pq1a_        1 MSQSNRELVVDFLSYKLSQKGYSWSQFSREVIPMAAVKQALREAGDEFELRYRRAFSDLT     60

Query          1 ------FQEYEKLVDYYLDI-PEDRPITLEDMTFYLESVFDGLWSYR--FFHRDLEYL--     49
d1pq1a_       61 SQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQ--V--LVS    115

Query         50 LDSDPRLRQDYREFTNRCLAAIN-RIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMA    108
d1pq1a_      116 ----------R--IASWMATYLNDHLEPWIQE-NGG------------------------    138

Query        109 FLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1pq1a_      139 --------------------W---DT--FVDLYG--------    147


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.11)
DALI match                                                     
Query         49 LLDSDPRLRQDYREFTNRCLAA-----------INRIFAKLADAGI     83
d1pq1a_       41 LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV     86



hit structures. 
top
36: d1mija_ Homeo-​prospero domain of Prospero protein (cs: 2.110)

SCOP Superfamily: Homeodomain-​like  |  SCOP Fold: DNA/​RNA-​binding 3-​helical bundle  |  SCOP Class: All alpha proteins

Consensus: 0.49  Contact: 349
Modified z-scores:
dali:0.95 daliz:0.87 gdtts:0.93 tmscore:0.96 rmsd:0.45 AHM:0.51 LBcontacta:0.75 LBcontactb:0.75 LHM:0.26
id:0.76 blosum:0.13 compass:0.47 pearson:0.74
Scaled scores:
dali:0.63 daliz:0.35 gdtts:0.44 tmscore:0.49 rmsd:0.70 AHM:0.58 LBcontacta:0.23 LBcontactb:0.23 LHM:0.22
id:0.00 blosum:0.02 compass:0.02 pearson:0.04

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:282.60)
Query          1 fqeyeklvdyyldipEDRPI----------------------------------TLEDMT     26
d1mija_        1 -----------sstlTPMHLrkaklmffwvrypssavlkmyfpdikfnknntaqLVKWFS     49

Query         27 FYLESVFDGLWSYRFFHRDLeylldsdprlrqdyREFTNRCLAAinrifakladagiiqp     86
d1mija_       50 NFREFYYIQMEKYARQAVTE--------------SELYRVLNLH-------------ynr     82

Query         87 qpedlRSAMSLNVWLVITNWMAFL-KTAH---lTELKQGIYQVLTLEVpYLTPEYrervl    142
d1mija_       83 nnhieVPQNFRFVVESTLREFFRAiQGGKdteqSWKKSIYKIISRMDD-PVPEYF-----    136

Query        143 alrekyrp    150
d1mija_      137 -----ksp    139


hit structure      alignment
FAST alignment (Normalized score: 2.26 Raw score:326.00)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS--------     52
d1mija_        1 ----------------------------------------------------SSTLTPMH      8

Query         53 -------------------------------DPRLRQDYREFTNRCLAAINRIFAKLADA     81
d1mija_        9 LRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVT     68

Query         82 GIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERV    141
d1mija_       69 -----------ESELYRVLNLHYNRN----------------------------------     83

Query        142 LALREKYRP---------------------------------------------------    150
d1mija_       84 ---------NHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPE    134

Query        151 -----    151
d1mija_      135 YFKSP    139


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:60.41)
Query          1 ----FQEYEKLVDYYLDIPEDRP---I-------------------------------TL     22
d1mija_        1 SSTL---------------TPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLV     45

Query         23 EDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRI---FAKLA     79
d1mija_       46 KWFSNFREFYYIQMEKYARQAVTE--------------S-ELYRVLNLHYNRNNH-----     85

Query         80 DAGIIQPQPEDLRSAMSLNVWLVITNWMAFL--KTA--HLTELKQGIYQVLTLEVPYLT-    134
d1mija_       86 --------IE--VPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDD-PVPE    134

Query        135 -----PEYRERVLALREKYRP    150
d1mija_      135 YFKSP----------------    139


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.44)
DALI match                                      
Query         54 PRLRQDYREFTNRCLAAINRIFAKLADAGII     84
d1mija_       42 AQLVKWFSNFREFYYIQMEKYARQAVTESEL     72



top
37: d1sxja1 Replication factor C1 (cs: 2.099)

SCOP Superfamily: DNA polymerase III clamp loader subunits,​ C-​terminal domain  |  SCOP Fold: DNA polymerase III clamp loader subunits,​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.34  Contact: 330
Modified z-scores:
dali:0.93 daliz:0.84 gdtts:0.92 tmscore:0.95 rmsd:0.39 AHM:0.38 LBcontacta:0.82 LBcontactb:0.79 LHM:0.18
id:0.89 blosum:0.23 compass:0.18 pearson:0.82
Scaled scores:
dali:0.64 daliz:0.33 gdtts:0.43 tmscore:0.44 rmsd:0.73 AHM:0.67 LBcontacta:0.30 LBcontactb:0.28 LHM:0.38
id:0.03 blosum:0.05 compass:0.04 pearson:0.07

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:272.40)
Query          1 fQEYEKLVDYYLDIP-edRPIT-lEDMTFYLESVfDGLWSYrffhrdleylldsdprlrq     58
d1sxja1        1 aLKPFDIAHKMLDGQiysDIGSrnFTLNDKIALY-FDDFDF-------------------     40

Query         59 dyrefTNRCLAainrifakladagiIQPQPEDLRSAMSLNVWLVITNWMAFLKTAH--LT    116
d1sxja1       41 tplmiQENYLS--------trpsvlKPGQSHLEAVAEAANCISLGDIVEKKIRSSEqlWS     92

Query        117 ELKQGIYQ--------------------vltlevpyltpeyrervlalrekyrp    150
d1sxja1       93 LLPLHAVLssvypaskvaghmagrinftawlgqnsksakyyrllqeihyhtrlg    146


hit structure      alignment
FAST alignment (Normalized score: 2.20 Raw score:325.10)
Query          1 FQEYEKLVDYYLDIPEDRPITL------------------------------------ED     24
d1sxja1        1 ----------------------ALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDF     38

Query         25 MTFYLESVFDGLWSYRFFHRDLEYLLDSDP-----------RLRQDYREFTNRCLAAINR     73
d1sxja1       39 DFTPLMIQENYL------------------STRPSVLKPGQSHLEAVAEAANCISLGDIV     80

Query         74 IFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGI-----------    122
d1sxja1       81 EKKIRS-------------------------------------------SEQLWSLLPLH     97

Query        123 ----------------------YQVLTLEVPYLTPEYRERVLALREKYRP----------    150
d1sxja1       98 AVLSSVYPASKVAGHMAGRINFTAWLGQNSK-------------------SAKYYRLLQE    138

Query        151 --------    151
d1sxja1      139 IHYHTRLG    146


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:59.58)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDM-TFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQD     59
d1sxja1        1 ALKPFDIAHKMLDGQI--YSDIGSRNFTLNDK-IALYFDDFDFTP-L-------------     43

Query         60 YREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITN-WMAFLKTA--HLT    116
d1sxja1       44 MI-QEN-YLST-RPSVL--KP-----GQSHLEAVAEAANCISLG-DIVEKKIRSSEQLWS     92

Query        117 ELKQG-IYQ--VL--TLE--------------------------------------VPYL    133
d1sxja1       93 LLPLHAVLSSVYPAS--KVAGHMAGRINFTAWLGQNSKSAKYYRLLQEIHYHTRLG----    146

Query        134 TPEYRERVLALREKYRP    150
d1sxja1      147 -----------------    147


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.41)
DALI match        ........         .... .......... ......
Query          1 FQEYEKLVD-YYLDIPEDRPITLEDMTFYLESVFDGLWSY     39
d1sxja1        5 FDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLM     44



top
38: d1hx1b_ BAG-​family molecular chaperon regulator-​1,​ BAG1 (cs: 2.092)

SCOP Superfamily: BAG domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 400
Modified z-scores:
dali:0.95 daliz:0.92 gdtts:0.95 tmscore:0.96 rmsd:0.31 AHM:0.37 LBcontacta:0.91 LBcontactb:0.91 LHM:0.18
id:0.90 blosum:0.36 compass:0.58 pearson:0.90
Scaled scores:
dali:0.70 daliz:0.49 gdtts:0.57 tmscore:0.61 rmsd:0.82 AHM:0.72 LBcontacta:0.38 LBcontactb:0.38 LHM:0.43
id:0.04 blosum:0.07 compass:0.05 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 6.2 Raw score:320.70)
Query          1 ------------FQEYEKLVDYYLDI---PEDRP------------------iTLEDMTF     27
d1hx1b_        1 gnspqeevelkkLKHLEKSVEKIADQleeLNKELtgiqqgflpkdlqaealckLDRRVKA     60

Query         28 YLESVFDGLWSYRFFhrdLEYLldSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIqpq     87
d1hx1b_       61 TIEQFMKILEEIDTL---ILPE--NFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE---    112

Query         88 pedlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrek    147
d1hx1b_      113 ------------------------------------------------------------    113

Query        148 yrp    150
d1hx1b_      113 ---    113


hit structure      alignment
FAST alignment (Normalized score: 2.75 Raw score:356.30)
Query          1 FQEYEKLVDYYLDIPEDRPI----TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS----     52
d1hx1b_        1 --------------------GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELT-GIQQ     39

Query         53 --------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDL-------     91
d1hx1b_       40 GFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDT------------------LILPENF     81

Query         92 --RSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYR    149
d1hx1b_       82 KDSRLKRKGLVK------------------------------------------------     93

Query        150 P-------------------    150
d1hx1b_       94 -KVQAFLAECDTVEQNICQE    112


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:58.60)
Query          1 ---------------FQEYEKLVDYYLD--IP--EDRP-----------ITLEDMTFYLE     30
d1hx1b_        1 GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA     60

Query         31 SVFDG--LWSYRFFHRDLEYL-LD----SDPRLRQDYREFTNRCLAAINRIFAKLADAGI     83
d1hx1b_       61 TIE-QFMK--ILEEIDTL-ILP-ENFKDSRLKRKGLVKKVQAFLAECDTVEQ-NI----C    110

Query         84 IQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLA    143
d1hx1b_      111 QE----------------------------------------------------------    112

Query        144 LREKYRP    150
d1hx1b_      113 -------    113


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.16)
DALI match                                       
Query         45 DLEYLLDSDPRLRQDYREFTNRCLAAINRIFA     76
d1hx1b_       80 NFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ    111



top
39: d1m62a_ Silencer of death domains,​ Sodd (Bag4) (svm: 0.664)

SCOP Superfamily: BAG domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.64  Contact: 358
Modified z-scores:
dali:0.92 daliz:0.89 gdtts:0.92 tmscore:0.94 rmsd:0.32 AHM:0.36 LBcontacta:0.92 LBcontactb:0.89 LHM:0.19
id:0.98 blosum:0.79 compass:0.57 pearson:0.96
Scaled scores:
dali:0.69 daliz:0.45 gdtts:0.55 tmscore:0.55 rmsd:0.79 AHM:0.69 LBcontacta:0.41 LBcontactb:0.38 LHM:0.37
id:0.10 blosum:0.15 compass:0.14 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 5.5 Raw score:256.50)
Query          1 ------------FQEYEKLVDYYL-DIPEdRPIT--LEDMTFYLESVFDGLWSyrffhrd     45
d1m62a_        1 gspeftppsikkIIHVLEKVQYLEqEVEE-FVGKktDKAYWLLEEMLTKELLE----lds     55

Query         46 LEYLldSDPRLRQDYREFTNRCLAAINRIFAKLAdagiiqpqpedlrsamslnvwlvitn    105
d1m62a_       56 VETG--GQDSVRQARKEAVCKIQAILEKLEKKGL--------------------------     87

Query        106 wmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1m62a_       88 ---------------------------------------------     88


hit structure      alignment
FAST alignment (Normalized score: 3.16 Raw score:360.90)
Query          1 FQEYEKLVDYYLDIPEDRPI--------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS     52
d1m62a_        1 --------------------GSPEFTPPSIKKIIHVLEKVQYLEQ----EVEE-------     29

Query         53 D------PRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQ--------PEDLRSAMSLN     98
d1m62a_       30 -FVGKKTDKAYWLLEEMLTKELLELD---------------SVETGGQDSVRQARKEAVC     73

Query         99 VWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--------    150
d1m62a_       74 KIQAIL----------------------------------------------EKLEKKGL     87


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:54.61)
Query          1 ------------FQEYEKLVDYYLD-IPEDRPIT---LEDMTFYLESV-FDGLWSYRFFH     43
d1m62a_        1 GSPEFTPPSIKKIIHVLEKVQYLEQEVE--EFVGKKTDKAYWLLEEMLTK-ELL-EL-DS     55

Query         44 RDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVI    103
d1m62a_       56 --V-ET-GGQDSVRQARKEAVCKIQAILEKLEKKG----L--------------------     87

Query        104 TNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1m62a_       88 -----------------------------------------------     88


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.43)
DALI match                 ............................    
Query         42 FHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGI     83
d1m62a_       46 LTKELLELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL     87



top
40: d1nq7a_ Orphan nuclear receptor ROR-​beta (cs: 2.083)

SCOP Superfamily: Nuclear receptor ligand-​binding domain  |  SCOP Fold: Nuclear receptor ligand-​binding domain  |  SCOP Class: All alpha proteins

Consensus: 0.38  Contact: 605
Modified z-scores:
dali:0.94 daliz:0.88 gdtts:0.92 tmscore:0.96 rmsd:0.48 AHM:0.47 LBcontacta:0.87 LBcontactb:0.83 LHM:0.18
id:0.86 blosum:0.10 compass:0.20 pearson:0.94
Scaled scores:
dali:0.63 daliz:0.32 gdtts:0.39 tmscore:0.45 rmsd:0.70 AHM:0.63 LBcontacta:0.26 LBcontactb:0.23 LHM:0.36
id:0.02 blosum:0.02 compass:0.10 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:379.00)
Query          1 fqeyeklvdyyldipedrpitLEDMTFYL---esVFDGLWSYRF---fhrdleylLDSD-     53
d1nq7a_        1 -------------tmseidriAQNIIKSHletcqYTMEELHQLAwqthtyeeikaYQSKs     47

Query         54 -PRLRQDYREFTNRCLAAINRIFAKL--ADAG-iiQPQPedlRSAMSLNVWLVITNWMA-    108
d1nq7a_       48 rEALWQQCAIQITHAIQYVVEFAKRItgFMELcqnDQIL--lLKSGCLEVVLVRMCRAFn    105

Query        109 ------------------------------------FLKTAhltELKQ-GIYQVLTL-EV    130
d1nq7a_      106 plnntvlfegkyggmqmfkalgsddlvneafdfaknLCSLQ---LTEEeIALFSSAVlIS    162

Query        131 PY-----lTPEYRERVLALREKYR------------------------------------    149
d1nq7a_      163 PDrawllePRKVQKLQEKIYFALQhviqknhlddetlakliakiptitavcnlhgeklqv    222

Query        150 ---------------------p    150
d1nq7a_      223 fkqshpdivntlfpplykelfn    244


hit structure      alignment
FAST alignment (Normalized score: 4.11 Raw score:786.90)
Query          1 FQEYEKLVDYYLDIPEDRPI-------TLEDMTFYLES----VFDGLWSYRFFHRD----     45
d1nq7a_        1 --------------------TMSEIDRIAQNIIKSHLETCQYTMEELHQ-------LAWQ     33

Query         46 -----LEYLLDS--DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQ-----PQPEDLR-     92
d1nq7a_       34 THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKR--------ITGFMELCQNDQI     85

Query         93 ---SAMSLNVWLVITNWMAFLKTAHLT---------------------------------    116
d1nq7a_       86 LLLKSGCLEVVLVRMCR----------AFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEA    135

Query        117 ------------ELKQGIYQVLTLEVPYL-------------TPEYRERVLALREKYRP-    150
d1nq7a_      136 FDFAKNLCSLQLTEEEIALFSSAVL----ISPDRAWLLEPRKVQKLQEKIYFALQH---V    188

Query        151 --------------------------------------------------------    151
d1nq7a_      189 IQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFN    244


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:72.76)
Query          1 ---------FQEYEKLVDYYLDIPEDRPITLEDMTF-YL-ESVFDGL-WSYRFF----HR     44
d1nq7a_        1 TMSEIDRIA-------------------QNIIKSHLETCQYTMEELHQLAWQTHTYEE--     39

Query         45 DLEYLLDSDP--RLR-QDYREFTNRCLAAINRIFAKLADAGIIQP---QPEDLRSAMSLN     98
d1nq7a_       40 --IKAYQSKSRE-ALWQQCAIQITHAIQYVVEFAKRI--TGFMELCQNDQILLLKSGCLE     94

Query         99 VWLVITN--W-M-----------------------------AFLKTAHLTELKQ--GI-Y    123
d1nq7a_       95 VVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIAL    154

Query        124 QVLTL-EVP----------Y-LTPEYR-ERVLALREKYR----P----------------    150
d1nq7a_      155 FSSAVLISPDRAWLLEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCN    214

Query        151 ------------------------------    151
d1nq7a_      215 LHGEKLQVFKQSHPDIVNTLFPPLYKELFN    244


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.16)
DALI match                                                                   
Query          1 FQEYEKLVDYYL--------DIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDL--EYLL     50
d1nq7a_       52 WQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTV    111

DALI match                                                                   
Query         51 DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL    110
d1nq7a_      112 LFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEI-A----LFSSAVLISPDRA    166

DALI match                               
Query        111 KTAHLTELKQGIYQVLTLEVPYLT    134
d1nq7a_      167 WLLEPRKVQKLQEKIYFALQHVIQ    190



hit structures. 
top
41: d1quua1 alpha-​actinin (cs: 2.081)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.31  Contact: 373
Modified z-scores:
dali:0.93 daliz:0.88 gdtts:0.93 tmscore:0.96 rmsd:0.36 AHM:0.39 LBcontacta:0.81 LBcontactb:0.79 LHM:0.31
id:0.63 blosum:0.16 compass:0.32 pearson:0.92
Scaled scores:
dali:0.66 daliz:0.41 gdtts:0.49 tmscore:0.54 rmsd:0.78 AHM:0.72 LBcontacta:0.28 LBcontactb:0.25 LHM:0.25
id:-0.02 blosum:0.03 compass:0.10 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:301.20)
Query          1 ----------------------FQEYEKLvDYYLD--IPEDRP---------iTLEDMTF     27
d1quua1        1 gssneirrlerlehlaekfrqkASTHETW-AYGKEqiLLQKDYesasltevraLLRKHEA     59

Query         28 YLESVFDGLWSYRFFHRDLEYLL----dSDPRLRQDYREFTNRCLAAINRIFAKLADAGI     83
d1quua1       60 FESDLAAHQDRVEQIAAIAQELNeldyhDAVNVNDRCQKICDQWDRLGTLTQKRREALER    119

Query         84 iqpqpedlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyLTPEyrervla    143
d1quua1      120 ------------------------------------------------mEKLL-------    124

Query        144 lrekyrp    150
d1quua1      125 -------    125


hit structure      alignment
FAST alignment (Normalized score: 2.51 Raw score:342.40)
Query          1 FQEYEKLVDYYLDIPEDRPI-----------TLEDMTFYLESVFDGLWSYRF---FHRDL     46
d1quua1        1 --------------------GSSNEIRRLERLEHLAEK-FRQKAST------HETWAYGK     33

Query         47 EYLLDS------------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQP     88
d1quua1       34 EQIL--LQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNEL-------     84

Query         89 ----EDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLAL    144
d1quua1       85 DYHDAVNVNDRCQKIC--------------------------------------------    100

Query        145 REKYRP------------------------    150
d1quua1      101 ------DQWDRLGTLTQKRREALERMEKLL    124


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:62.31)
Query          1 ------------------FQEYEKLVDYYLD-I--PE-D-R-----------PI--TLED     24
d1quua1        1 GSSNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAF     60

Query         25 MTFYLESVFDGLWSYRFFHRDLEYLLD--S--DPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1quua1       61 ESDLAA-HQDRV--EQIAA-IAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREA    116

Query         81 AGI--IQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTP--E    136
d1quua1      117 LERME---------------------------------------------------KLL-    124

Query        137 YRERVLALREKYRP    150
d1quua1      125 --------------    125


hit structure      alignment
HHsearch alignment (Probability: 0.21 E-value:0.08)
DALI match                                                                   
Query         50 LDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAF    109
d1quua1        9 LERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRA----LLRKHEAFESDL     64

DALI match                                               
Query        110 LKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYR    149
d1quua1       65 AAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWD    104



top
42: d1hcia1 alpha-​actinin (cs: 2.076)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.00  Contact: 365
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.93 tmscore:0.95 rmsd:0.36 AHM:0.36 LBcontacta:0.84 LBcontactb:0.85 LHM:0.25
id:0.94 blosum:0.42 compass:0.28 pearson:0.81
Scaled scores:
dali:0.67 daliz:0.44 gdtts:0.50 tmscore:0.52 rmsd:0.77 AHM:0.71 LBcontacta:0.31 LBcontactb:0.34 LHM:0.33
id:0.06 blosum:0.08 compass:0.06 pearson:0.07

hit structure      alignment
DALI alignment (Z-score: 4.9 Raw score:280.60)
Query          1 ------------------FQEYEKLVDYYLDI--PEDR-------piTLEDMTFYL-ESV     32
d1hcia1        1 ssavnqenerlmeeyerlASELLEWIRRTIPWleNRTPektmqamqkKLEDFRDYRrKHK     60

Query         33 FDGLWSYRFFHRDLE-----------yllDSDP-rLRQDYREFTNRCLAAINRIFAKLAD     80
d1hcia1       61 PPKVQEKCQLEINFNtlqtklrisnrpafMPSEgkMVSDIAGAWQRLEQAEKGYEEWLLN    120

Query         81 AGiiqpqpedlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrer    140
d1hcia1      121 EI----------------------------------------------------------    122

Query        141 vlalrekyrp    150
d1hcia1      123 -------rrl    125


hit structure      alignment
FAST alignment (Normalized score: 2.96 Raw score:405.60)
Query          1 FQEYEKLVDYYLDIPEDRPI---TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS-----     52
d1hcia1        1 --------------------SSAVNQENERLMEEYERLASELLEWIRRTIPWL--ENRTP     38

Query         53 -----------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAM     95
d1hcia1       39 EKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISN-------------     85

Query         96 SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP-----    150
d1hcia1       86 -------------------------------------------------------RPAFM     90

Query        151 -----------------------------------    151
d1hcia1       91 PSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRL    125


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:51.27)
Query          1 ---------FQEYEKLVDYYLDIPEDRPIT-LEDMTFYLESVFDGLWSYRFFHRDLEYL-     49
d1hcia1        1 SSAVNQENE-----------------RLMEEYERLASELLEWIRRTI--P-WLENRTPEK     40

Query         50 ----LDSD-PRLRQDYRE-FTNRCLAAINRIFAKLADAG---------II---------Q     85
d1hcia1       41 TMQA-MQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVS-     98

Query         86 PQPEDLRSAMSLNVWLVIT-NW---------------MAFLKTAHLTELKQGIYQVLTLE    129
d1hcia1       99 ---------DIAGAWQR-LEQAEKGYEEWLLNEIRRL-----------------------    125

Query        130 VPYLTPEYRERVLALREKYRP    150
d1hcia1      126 ---------------------    126


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.15)
DALI match                                                      
Query         51 DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSL     97
d1hcia1        6 QENERLMEEYERLASELLEWIRRTIPWLENR-TPEKTMQAMQKKLED     51



top
43: d1kxpd2 Vitamin D binding protein (cs: 2.074)

SCOP Superfamily: Serum albumin-​like  |  SCOP Fold: Serum albumin-​like  |  SCOP Class: All alpha proteins

Consensus: 0.39  Contact: 356
Modified z-scores:
dali:0.93 daliz:0.89 gdtts:0.93 tmscore:0.94 rmsd:0.40 AHM:0.42 LBcontacta:0.86 LBcontactb:0.94 LHM:0.27
id:0.30 blosum:0.19 compass:0.27 pearson:0.82
Scaled scores:
dali:0.67 daliz:0.41 gdtts:0.51 tmscore:0.51 rmsd:0.73 AHM:0.65 LBcontacta:0.34 LBcontactb:0.45 LHM:0.24
id:-0.05 blosum:0.02 compass:0.08 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:283.90)
Query          1 fqeyeklvdyyldipedrpitledmtfylesvfdglwsyrffhrdleylldsdprlrqdY     60
d1kxpd2        1 --------------------------------------------------lsnrvcsqyA     10

Query         61 REFTNRCLAAINRIFAKLADagiiqPQPEDLRSAMSLNVWLVITNWMAFLKTahltelKQ    120
d1kxpd2       11 AYGEKKSRLSNLIKLAQKVP-----TADLEDVLPLAEDITNILSKCCESASE---dcmAK     62

Query        121 GIYQVLTLEV-PYLT--PEYRERVLA-LREK-----------------------------    147
d1kxpd2       63 ELPEHTVKLCdNLSTknSKFEDCCQEkTAMDvfvctyfmpaaqlpelpdvelptnkdvcd    122

Query        148 ------------------------------------------------------------    148
d1kxpd2      123 pgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkkel    182

Query        148 -----yrp    150
d1kxpd2      183 ssfidkgq    190


hit structure      alignment
FAST alignment (Normalized score: 2.11 Raw score:355.90)
Query          1 FQEYEKLVDYYLDIPE--------------------------------------------     16
d1kxpd2        1 ----------------LSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDI     44

Query         17 ------------------------------------------------------------     17
d1kxpd2       45 TNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAA    104

Query         17 ----DRPITLED---MTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTN----     65
d1kxpd2      105 QLPELPDV----ELPTNKD-------------------------------------VCDP    123

Query         66 RCLAAINRIFAKLADAGIIQ--PQPEDLRSAMSLNVWLVITNWMAFLKTAH--------L    115
d1kxpd2      124 GNTKVMDKYTFELSR-----RTHLPEVFLSKVLEPTLKSLGECC-------DVEDSTTCF    171

Query        116 TEL-KQGIYQVLTLEVPYLTPEYRERVLALREKYRP--    150
d1kxpd2      172 NAKGPLLKKELSSFIDK-------------------GQ    190


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:62.69)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGL-WSYRFFHRDLEYLLDSDPRLRQD     59
d1kxpd2        1 -------------------------L--SNRVC-SQY--A--------------------     10

Query         60 YREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWM-AFLKTAHLTEL    118
d1kxpd2       11 A-YGEKKSRLSNLIKLAQKVP----TADL-EDVLPLAEDITNILSKCCESASE-DC---M     60

Query        119 KQGIYQVLTLEVP-YLT-PEY-RERVLALREKYR--------------------------    149
d1kxpd2       61 AKELPEHTVKLCDNLSTKNSKFEDCCQE-KTAMDVFVCTYFMPAAQLPELPDVELPTNKD    119

Query        150 ------------------------------------------------------------    150
d1kxpd2      120 VCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLK    179

Query        150 -----------P    150
d1kxpd2      180 KELSSFIDKGQ-    190


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.51)
DALI match                                                                   
Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNV     99
d1kxpd2      127 KVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFI    186



top
44: d1gnwa1 Class phi GST (cs: 2.058)

SCOP Superfamily: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Fold: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.21  Contact: 349
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.94 tmscore:0.95 rmsd:0.35 AHM:0.39 LBcontacta:0.84 LBcontactb:0.73 LHM:0.19
id:0.62 blosum:0.17 compass:0.16 pearson:0.73
Scaled scores:
dali:0.68 daliz:0.45 gdtts:0.54 tmscore:0.54 rmsd:0.78 AHM:0.68 LBcontacta:0.30 LBcontactb:0.24 LHM:0.42
id:-0.01 blosum:0.02 compass:0.06 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 4.4 Raw score:311.30)
Query          1 ----------------FQEYEK-LVDYYLDI-----PEDR----PITLEDMTFYLESVFD     34
d1gnwa1        1 lqtdsknisqyaimaiGMQVEDhQFDPVASKlafeqIFKSiyglTTDEAVVAEEEAKLAK     60

Query         35 GLWSYRFFHRDLEylLDSDprLRQDYREFTNRCLAAINRifakladagiiqpqpedlrsa     94
d1gnwa1       61 VLDVYEARLKEFKylAGET--FTLTDLHHIPAIQYLLGT---------------------     97

Query         95 mslnvwlvITNWMAflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1gnwa1       98 ----ptkkLFTERP-----------------------rvnewvaeitkrpasekvq    126


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:367.50)
Query          1 FQEYEKLVDYYLDIPEDRPIT------LEDMTFYLESVFDGLWS-YRFFHRDLEYLLD--     51
d1gnwa1        1 ---------------------LQTDSKNISQYAIMAIGMQVEDHQFDPVAS-------KL     32

Query         52 -------------SDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLR------     92
d1gnwa1       33 AFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKE---------------FKYLAG     77

Query         93 ----------------------------SAMSLNVWLVITNWMAFLKTAHLTELKQGIYQ    124
d1gnwa1       78 ETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAE----------------------    115

Query        125 VLTLEVPYLTPEYRERVLALREKYRP-----------    150
d1gnwa1      116 --------------------------ITKRPASEKVQ    126


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:49.25)
Query          1 --------FQEYEKLVDYYLDIPEDRPITL-EDMTFYLESVFDG-LWSYRFFHRDLE--Y     48
d1gnwa1        1 LQTDSKNI--------------------SQYAIMAIGMQVEDHQFD-PVASKLAFEQIFK     39

Query         49 L---LDSDPRLRQDYREFTNRCLAAINRIFAKLA---DAGII------------------     84
d1gnwa1       40 SIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLA---GETFTLTDLHHIPAIQYLLG     96

Query         85 ---------QPQPEDLRSAMSLNVWLV---ITNW--MAFLKTAHLTELKQGIYQVLTLEV    130
d1gnwa1       97 TPTKKLFTE----RP-RVNEWVAEITKRPA---SEK--V--Q------------------    126

Query        131 PYLTPEYRERVLALREKYRP    150
d1gnwa1      127 --------------------    127


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.01)
DALI match                                          
Query         32 VFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNR     66
d1gnwa1       85 LHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKR    119



top
45: d1us7b_ Hsp90 co-​chaperone CDC37 (cs: 2.048)

SCOP Superfamily: Hsp90 co-​chaperone CDC37  |  SCOP Fold: Hsp90 co-​chaperone CDC37  |  SCOP Class: All alpha proteins

Consensus: 0.41  Contact: 379
Modified z-scores:
dali:0.92 daliz:0.88 gdtts:0.89 tmscore:0.93 rmsd:0.41 AHM:0.42 LBcontacta:0.73 LBcontactb:0.63 LHM:0.26
id:0.74 blosum:0.20 compass:0.41 pearson:0.74
Scaled scores:
dali:0.67 daliz:0.41 gdtts:0.45 tmscore:0.48 rmsd:0.73 AHM:0.63 LBcontacta:0.30 LBcontactb:0.24 LHM:0.27
id:0.01 blosum:0.03 compass:0.06 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:241.90)
Query          1 ----fqeyeklvDYYLD-----iPEDR------pITLEDMTFYLESVFDglwsyrffhrd     45
d1us7b_        1 hktfvekyekqiKHFGMlrrwddSQKYlsdnvhlVCEETANYLVIWCID-----------     49

Query         46 leylldsdprlrqdYREFTNRCLAAINRIFAKLADAG------------------iiqpq     87
d1us7b_       50 ---------leveeKCALMEQVAHQTIVMQFILELAKslkvdpracfrqfftkiktadrq    100

Query         88 PEDLRSAMSLNVWLVITNW-MAFLKTAH-----------------------------lte    117
d1us7b_      101 YMEGFNDELEAFKERVRGRaKLRIEKAMkeyeeeerkkrlgpggldpvevyeslpeelqk    160

Query        118 lkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1us7b_      161 cmlqdaiskmdptdakyhmqrcidsglwvpnsk    193


hit structure      alignment
FAST alignment (Normalized score: 3.55 Raw score:604.40)
Query          1 FQEYEKLVDYY----------------LDIPEDRP------------ITLEDMTFYLESV     32
d1us7b_        1 -----------HKTFVEKYEKQIKHFGMLRRWD--DSQKYLSDNVHLVCEETANYLVIWC     47

Query         33 FDGLWSYRFFHRDLEYLLDSDPRLRQD--YREFTNRCLAAINRIFAKLADAGIIQPQ---     87
d1us7b_       48 IDLEV----------------------EEKCALMEQVAHQTIVMQFILEL-------AKS     78

Query         88 ----------------------PEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQV    125
d1us7b_       79 LKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIE-------------    125

Query        126 LTLEVPYLTPEYRERVLALREKYRP-----------------------------------    150
d1us7b_      126 -------------------------KAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQK    160

Query        151 ---------------------------------    151
d1us7b_      161 CMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK    193


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:59.88)
Query          1 -----------FQEYEKLVDYYLD------I--PED--R-PITLEDMTFYLESVFDGLWS     38
d1us7b_        1 HKTFVEKYEKQ-------IKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEV-     52

Query         39 YRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGII----------QP--     86
d1us7b_       53 E--EK--C-------------A--LMEQVAHQTIVMQFILELAKSLKVDPRACFRQ-FFT     92

Query         87 -------QPEDLRSAMSLNVWLVITNWMAFL-KT-AH-----------------------    114
d1us7b_       93 KIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYE    152

Query        115 -----------------------------------------LTELKQGIYQVLTLEVPYL    133
d1us7b_      153 SLPEELQKCMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK-------------------    193

Query        134 TPEYRERVLALREKYRP    150
d1us7b_      194 -----------------    194


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.22)
DALI match                                                      
Query         49 LLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAM     95
d1us7b_       94 IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRL    140



hit structures. 
top
46: d1j4na_ Aquaporin-​1 (cs: 2.044)

SCOP Superfamily: Aquaporin-​like  |  SCOP Fold: Aquaporin-​like  |  SCOP Class: Membrane and cell surface proteins and peptides

Consensus: 0.45  Contact: 554
Modified z-scores:
dali:0.95 daliz:0.82 gdtts:0.95 tmscore:0.98 rmsd:0.47 AHM:0.52 LBcontacta:0.77 LBcontactb:0.78 LHM:0.17
id:0.85 blosum:0.08 compass:0.15 pearson:0.62
Scaled scores:
dali:0.61 daliz:0.26 gdtts:0.40 tmscore:0.46 rmsd:0.72 AHM:0.60 LBcontacta:0.19 LBcontactb:0.19 LHM:0.43
id:-0.00 blosum:0.02 compass:0.02 pearson:-0.00

hit structure      alignment
DALI alignment (Z-score: 2.7 Raw score:357.40)
Query          1 -------------FQEYEKLVDYYLD----ipEDRP-------------itLEDMTFYLE     30
d1j4na_        1 masefkkklfwraVVAEFLAMILFIFisigsaLGFHypiksnqttgavqdnVKVSLAFGL     60

Query         31 SVFDGLWSYRF-----------fHRDL--EYLLdsdpRLRQDYREFTNR----------c     67
d1j4na_       61 SIATLAQSVGHisgahlnpavtlGLLLscQISV----LRAIMYIIAQCVgaivatailsg    116

Query         68 laainrifAKLAdagiIQPQ----PEDLRsAMSLNVWLVITNWMAFLKT-----AHLTE-    117
d1j4na_      117 itsslpdnSLGL----NALApgvnSGQGL-GIEIIGTLQLVLCVLATTDrrrrdLGGSGp    171

Query        118 --LKQGIYQVLTLEVPY-------------------------------------------    132
d1j4na_      172 laIGFSVALGHLLAIDYtgcginparsfgssvithnfqdhwifwvgpfigaalavliydf    231

Query        133 ltpeyrervlalrekyrp    150
d1j4na_      232 ilaprssdltdrvkvwts    249


hit structure      alignment
FAST alignment (Normalized score: 3.02 Raw score:583.80)
Query          1 ---------FQEYEKLVDYYLDIPEDRPI-----------------------------TL     22
d1j4na_        1 MASEFKKKLFWRAVVAEFLAM--------ILFIFISIGSALGFHYPIKSNQTTGAVQDNV     52

Query         23 EDMTFYLESVFDGLWSYRFFHRDLEYLLD-------------------SDPRLRQDYREF     63
d1j4na_       53 KVSLAFGLSIATLAQSVGH----------ISGAHLNPAVTLGLLLSCQISVLRAIMYIIA    102

Query         64 TNRCLAAINRIFAKLADAGIIQPQ--------------------------------PEDL     91
d1j4na_      103 QCVGA-------------------IVATAILSGITSSLPDNSLGLNALAPGVNSGQGLGI    143

Query         92 RSAMSLNVWLVITNWMAF-LKTAHLTE-------LKQGIYQVLTLEVPYLTPEYRERVLA    143
d1j4na_      144 EIIGTLQLVLCVLAT---TDRRR----RDLGGSGPLAIGFSVALGHLLA-----------    185

Query        144 LREKYRP-----------------------------------------------------    150
d1j4na_      186 -------IDYTGCGINPARSFGSSVITHNFQDHWIFWVGPFIGAALAVLIYDFILAPRSS    238

Query        151 -----------    151
d1j4na_      239 DLTDRVKVWTS    249


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:72.61)
Query          1 -------------FQEYEKLVDYYLD--IP--ED-R-----------PITL-EDMTFYLE     30
d1j4na_        1 MASEFKKKLFWRAVVAEFLAMILFIFISIGSALGFHYPIKSNQTTGAVQDNVKVSLAFGL     60

Query         31 SVFDGLW-SYR-FF-H----RD--LE---YLLDSDPRLRQDYRE-FTN-RC---------     67
d1j4na_       61 SIATLAQSVGHISGAHLNPAVTLGLLLSCQISV-L--RAIMYIIAQCVGAIVATAILSGI    117

Query         68 --------LAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-K--T-AH-    114
d1j4na_      118 TSSLPDNS--LGLN--AL-A-----PGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLG    167

Query        115 -L-TEL-KQGIYQVLTLEVPY---------------------------------------    132
d1j4na_      168 GSGPLAIGFSVALGHLLAIDYTGCGINPARSFGSSVITHNFQDHWIFWVGPFIGAALAVL    227

Query        133 ----------------------LTPEYRERVLALREKYRP    150
d1j4na_      228 IYDFILAPRSSDLTDRVKVWTS------------------    249


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.21)
DALI match                                  
Query         21 TLEDMTFYLESVFD----GLWSYRFFH     43
d1j4na_      207 NFQDHWIFWVGPFIGAALAVLIYDFIL    233



top
47: d1oedc_ Acetylcholine receptor protein,​ delta chain (cs: 2.020)

SCOP Superfamily: Neurotransmitter-​gated ion-​channel transmembrane pore  |  SCOP Fold: Neurotransmitter-​gated ion-​channel transmembrane pore  |  SCOP Class: Membrane and cell surface proteins and peptides

Consensus: 0.15  Contact: 341
Modified z-scores:
dali:0.93 daliz:0.90 gdtts:0.93 tmscore:0.94 rmsd:0.36 AHM:0.37 LBcontacta:0.84 LBcontactb:0.83 LHM:0.22
id:0.88 blosum:0.26 compass:0.28 pearson:0.58
Scaled scores:
dali:0.64 daliz:0.42 gdtts:0.52 tmscore:0.52 rmsd:0.77 AHM:0.72 LBcontacta:0.29 LBcontactb:0.30 LHM:0.42
id:0.04 blosum:0.06 compass:0.04 pearson:0.03

hit structure      alignment
DALI alignment (Z-score: 5.0 Raw score:284.40)
Query          1 -------FQEYEKLVDYYLDI----PEDRPiTLEDMTFYLESVFDGLWSYRFFHRDLEY-     48
d1oedc_        1 plfyvinFITPCVLISFLASLafylPAESGeKMSTAISVLLAQAVFLLLTSQRLPETALa     60

Query         49 llDSDPRLRQDYREFTNRCLAAINRIFAKLADagiiqpqpedlrsamslnvwlvitnwma    108
d1oedc_       61 vpLIGKYLMFIMSLVTGVIVNCGIVLNFHFRT----------------------------     92

Query        109 flktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1oedc_       93 -------gqtidrlsmfiitpvmvlgtififvmgnfnhppak    127


hit structure      alignment
FAST alignment (Normalized score: 4.36 Raw score:601.50)
Query          1 FQEYEKLVDYYLDIPEDRPI---TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPR--     55
d1oedc_        1 --------------------PLFYVINFITPCVLISFLASLAFYLPA-----------ES     29

Query         56 --LRQDYREFTNRCLAAINRIFAKLADAGIIQPQP-------EDLRSAMSLNVWLVITNW    106
d1oedc_       30 GEKMSTAISVLLAQAVFLLLTSQRLPE--------TALAVPLIGKYLMFIMSLVTGVI--     79

Query        107 MAFLKTA-------------------HLTEL----KQGIYQVLTLEVPYLTPEYRERVLA    143
d1oedc_       80 -------VNCGIVLNFHFRTGQTIDRLSMFIITPVMVLGTIFIFVMGN------------    120

Query        144 LREKYRP-------    150
d1oedc_      121 -------FNHPPAK    127


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:55.54)
Query          1 --FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSY-RFFH-RDLEYLLDSDPRL     56
d1oedc_        1 PL-------------------FYVINFITPCVLISFLASLAFYLPAESGE-KMS-----T     35

Query         57 RQDYREFTNRCLAAINRIFAKLA-DAGIIQP--QPEDL--RSAM-SLNVWLVIT-NW---    106
d1oedc_       36 AISVLLAQAVFLLLTSQRLPETALAVPLIGKYL----MFI--MSLVTGVIVN-CGIVLNF     88

Query        107 --------MAFLKTAHLTELKQGIYQVLT-LEVPYLTPEYRERVLALRE-----KYRP    150
d1oedc_       89 HFRTGQTIDRLSMFII--TPVMVLGTIFIF--V-----------MGNFNHPPAK----    127


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.06)
DALI match                                       
Query         98 NVWLVITNWMAFLKTAH-LTELKQGIYQVLTL    128
d1oedc_       12 CVLISFLASLAFYLPAESGEKMSTAISVLLAQ     43



top
48: d1n5ua3 Serum albumin (cs: 2.009)

SCOP Superfamily: Serum albumin-​like  |  SCOP Fold: Serum albumin-​like  |  SCOP Class: All alpha proteins

Consensus: 0.25  Contact: 418
Modified z-scores:
dali:0.94 daliz:0.89 gdtts:0.94 tmscore:0.96 rmsd:0.35 AHM:0.33 LBcontacta:0.74 LBcontactb:0.78 LHM:0.17
id:0.40 blosum:0.14 compass:0.27 pearson:0.85
Scaled scores:
dali:0.62 daliz:0.38 gdtts:0.52 tmscore:0.53 rmsd:0.76 AHM:0.71 LBcontacta:0.25 LBcontactb:0.26 LHM:0.40
id:-0.04 blosum:0.02 compass:0.11 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:295.50)
Query          1 ------------------------------------------------------------      1
d1n5ua3        1 kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc     60

Query          1 --------------------------------fqeyeklvdyyldipedrpITLEdMTFY     28
d1n5ua3       61 aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpKEFN-AETF    119

Query         29 LesVFDGLwsyrffhrdleylldsdprlrqdYREFTNRCLAAINRIFAKLADagiiqPQP     88
d1n5ua3      120 T--FHADI--------------------ctlSEKERQIKKQTALVELVKHKP-----KAT    152

Query         89 EDLRSAMSLNVWLVITNWMAFLKtahLTEL-KQGIYQVLTLE-VPYLtpeyrervlalre    146
d1n5ua3      153 KEQLKAVMDDFAAFVEKCCKADD---KETCfAEEGKKLVAASqAALG-------------    196

Query        147 kyrp    150
d1n5ua3      197 ----    197


hit structure      alignment
FAST alignment (Normalized score: 2.74 Raw score:469.50)
Query          1 FQEYEKLVDYYLDIPEDR------------------------------------------     18
d1n5ua3        1 ------------------KQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNL     42

Query         19 ------------------------------------------------------------     19
d1n5ua3       43 GKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSA    102

Query         19 ----------PITLEDMTFY--LESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYRE--FT     64
d1n5ua3      103 LEVDETYVPKEFNAETF---TFHADIC-----------------------------TLSE    130

Query         65 NRCLAAINRIFAKLADAGIIQ---PQPEDLRSAMSLNVWLVITNWMAFLKTAH---LTEL    118
d1n5ua3      131 KERQIKKQTALVELVK-----HKPKATKEQLKAVMDDFAAFVEKCCK------ADDKETC    179

Query        119 -KQGIYQVLTLEVPYLTPEYRERVLALREKYRP---    150
d1n5ua3      180 FAEEGKKLVAASQA-------------------ALG    196


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:58.53)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY     60
d1n5ua3        1 ---KQNCEL----------------------F--------------------------EQ      9

Query         61 REFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMA----FLKTAHL-    115
d1n5ua3       10 -LGEYKFQNALLVRYTKKVP----QVST-PTLVEVSRNLGKVGSKCCKHPEA------KR     57

Query        116 TELKQG-IYQVLTLEV-PY---LTPEY-RERVLALREKYR--------------------    149
d1n5ua3       58 MPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTES-LVNRRPCFSALEVDETYVPKEFNA    116

Query        150 ------------------------------------------------------------    150
d1n5ua3      117 ETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDK    176

Query        150 --------------------P    150
d1n5ua3      177 ETCFAEEGKKLVAASQAALG-    196


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.45)
DALI match                                           
Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIF     75
d1n5ua3      135 IKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKC    170



top
49: d1okta1 Pf GST (cs: 2.004)

SCOP Superfamily: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Fold: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.15  Contact: 364
Modified z-scores:
dali:0.93 daliz:0.91 gdtts:0.91 tmscore:0.93 rmsd:0.34 AHM:0.39 LBcontacta:0.81 LBcontactb:0.77 LHM:0.19
id:0.74 blosum:0.31 compass:0.32 pearson:0.72
Scaled scores:
dali:0.67 daliz:0.44 gdtts:0.50 tmscore:0.52 rmsd:0.77 AHM:0.65 LBcontacta:0.29 LBcontactb:0.28 LHM:0.39
id:0.01 blosum:0.05 compass:0.08 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 4.1 Raw score:297.00)
Query          1 -------------FQEYEKLVDYYLDIpedrpITLEDMTFYL-ESVFDGLWSYRFFHRDL     46
d1okta1        1 cgeselnefyadmIFCGVQDIHYKFNN---tnLFKQNETTFLnEDLPKWSGYFEKLLKKN     57

Query         47 EY--------lLDSDPrlRQDYREFTNRCLAAINRIfakladagiiqpqpedlrsamsln     98
d1okta1       58 HTnnnndkyyfVGNNL--TYADLAVFNLYDDIETKY------------------------     91

Query         99 vwlVITNWMAflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1okta1       92 --pSSLKNFP---------------llkahnefisnlpniknyitnrkesvy    126


hit structure      alignment
FAST alignment (Normalized score: 2.52 Raw score:346.50)
Query          1 FQEYEKLVDYYLDIPEDRPIT---LEDMTFYLESVFDGLWSYRFFHRDLEYLLDS-----     52
d1okta1        1 ---------------------CGESELNEFYADMIFCGVQDIHYKFNN-------TNLFK     32

Query         53 --DPRLR-QDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLR-----------------     92
d1okta1       33 QNETTFLNEDLPKWSGYFEKLLKK-------------------NHTNNNNDKYYFVGNNL     73

Query         93 ------------------------SAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTL    128
d1okta1       74 TYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEF--------------------------    107

Query        129 EVPYLTPEYRERVLALREKYRP-------------------    150
d1okta1      108 ----------------------ISNLPNIKNYITNRKESVY    126


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:58.84)
Query          1 ----------FQEYEKLVDYYLD-I-PED--RPITLEDMT-FYLESVFDGLWSY-RFFHR     44
d1okta1        1 CGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEK-LLKKN-H     58

Query         45 -DL---EYL-LDSDPRLRQD-YREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLN     98
d1okta1       59 TNNNNDKYYFVGNNL-T--YADLAVFNLYDDIETK-Y--------------------P-S     93

Query         99 VWLVITNW-MA-----------------------FLKTAHLTELKQGIYQVLTLEVPYLT    134
d1okta1       94 SLKNFPLLK-AHNEFISNLPNIKNYITNRKESVY--------------------------    126

Query        135 PEYRERVLALREKYRP    150
d1okta1      127 ----------------    127


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.11)
DALI match                                         
Query         33 FDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNR     66
d1okta1       78 LAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNL    111



top
50: d1aw9a1 Class phi GST (cs: 2.001)

SCOP Superfamily: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Fold: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.46  Contact: 364
Modified z-scores:
dali:0.95 daliz:0.94 gdtts:0.93 tmscore:0.94 rmsd:0.35 AHM:0.38 LBcontacta:0.84 LBcontactb:0.75 LHM:0.17
id:0.78 blosum:0.23 compass:0.18 pearson:0.74
Scaled scores:
dali:0.69 daliz:0.47 gdtts:0.53 tmscore:0.53 rmsd:0.77 AHM:0.68 LBcontacta:0.30 LBcontactb:0.25 LHM:0.44
id:0.02 blosum:0.04 compass:0.08 pearson:0.09

hit structure      alignment
DALI alignment (Z-score: 4.5 Raw score:293.10)
Query          1 ----------------FQEYEK-LVDYYLDI-----PEDR----PITLEDMTFYLESVFD     34
d1aw9a1        1 gtdllpatasaaklevWLEVEShHFYPNASPlvfqlLVRPllggAPDAAVVDKHAEQLAK     60

Query         35 GLWSYRFFHRDLEylLDSDprLRQDYREFTNRCLAAINRifakladagiiqpqpedlrsa     94
d1aw9a1       61 VLDVYEAHLARNKylAGDE--FTLADANHASYLLYLSKT---------------------     97

Query         95 mslnvwlvITNWMAflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1aw9a1       98 ----pkagLVAARP--------------hvkawweaivarpafqktvaaiplpppp    135


hit structure      alignment
FAST alignment (Normalized score: 2.31 Raw score:329.40)
Query          1 FQEYEKLVDYYLDIPEDRPIT---------LEDMTFYLESVFDGLWSYRFFHRDLE----     47
d1aw9a1        1 ---------------------GTDLLPATASAAKLEVWLEVES-------------HHFY     26

Query         48 ---YLLD------------SDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLR     92
d1aw9a1       27 PNASPLVFQLLVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLAR---------------     71

Query         93 ----------------------------------SAMSLNVWLVITNWMAFLKTAHLTEL    118
d1aw9a1       72 NKYLAGDEFTLADANHASYLLYLSKTPKAGLVAARPHVKAWWEAIVA-------------    118

Query        119 KQGIYQVLTLEVPYLTPEYRERVLALREKYRP-----------------    150
d1aw9a1      119 --------------------------------RPAFQKTVAAIPLPPPP    135


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:58.86)
Query          1 ----------------FQEYEK-LVDYYLDI--P----E----DRPITLEDMTFYLESVF     33
d1aw9a1        1 GTDLLPATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLG-GAPDAAVVDKHAEQLA     59

Query         34 DGLWSYRFFHRDLEYLL-DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLR     92
d1aw9a1       60 KVLDVYEAHLARN-KYLAGDEFTL--ADANHASYLLY-L---------------------     94

Query         93 SAMSLNVWLVITNWMAF---------------------------LKTAHLTELKQGIYQV    125
d1aw9a1       95 --SKTPKA-GLVAARPHVKAWWEAIVARPAFQKTVAAIPLPPPP----------------    135

Query        126 LTLEVPYLTPEYRERVLALREKYRP    150
d1aw9a1      136 -------------------------    136


hit structure      alignment
HHsearch alignment (Probability: 0.07 E-value:0.10)
DALI match                                                                   
Query         12 LDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAI     71
d1aw9a1        4 LLPATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAPDAAVV-DKHAEQLAKVL     62

DALI match                                            
Query         72 NRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMA    108
d1aw9a1       63 DVYEAHLARNKYLAG--DEF-T-LADANHASYLLYLS     95



hit structures. 
top
51: d1cuna2 Spectrin alpha chain (svm: 0.671)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.53  Contact: 353
Modified z-scores:
dali:0.94 daliz:0.92 gdtts:0.95 tmscore:0.96 rmsd:0.31 AHM:0.32 LBcontacta:0.91 LBcontactb:0.85 LHM:0.19
id:0.74 blosum:0.20 compass:0.25 pearson:0.80
Scaled scores:
dali:0.71 daliz:0.50 gdtts:0.60 tmscore:0.63 rmsd:0.81 AHM:0.75 LBcontacta:0.41 LBcontactb:0.33 LHM:0.40
id:0.01 blosum:0.03 compass:0.08 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 5.8 Raw score:295.50)
Query          1 -FQEYEKLVDYYL--DIPE---------------drpiTLEDMTFYLESVFDGLWsyrFF     42
d1cuna2        1 qFVANVEEEEAWIneKMTLvasedygdtlaaiqgllkkHEAFETDFTVHKDRVND-vcAN     59

Query         43 HRDLEY-llDSDPRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlrsamslnvwl    101
d1cuna2       60 GEDLIKknnHHVENITAKMKGLKGKVSDLEKAAAQRKAKLD-------------------    100

Query        102 vitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1cuna2      101 ---------------------------------------------ensa    104


hit structure      alignment
FAST alignment (Normalized score: 2.32 Raw score:289.80)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS--------     52
d1cuna2        1 ----------------------------------------------------QFVANVEE      8

Query         53 -----------------------------DPRLRQDYREFTNRCLAAINRIFAKLADAGI     83
d1cuna2        9 EEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKK--     66

Query         84 IQPQ---PEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRER    140
d1cuna2       67 ----NNHHVENITAKMKGLKGKVS------------------------------------     86

Query        141 VLALREKYRP------------------    150
d1cuna2       87 ----------DLEKAAAQRKAKLDENSA    104


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:63.49)
Query          1 -FQEYEKLVDYYLD-I--P-ED-R----------P--ITLEDMTFYLESVFDGLWSYRFF     42
d1cuna2        1 QFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKD-RVN--DVC     57

Query         43 HRDLEYLL-DS--DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQ--PQPEDLRSAMSL     97
d1cuna2       58 ANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLD--ENS------------    103

Query         98 NVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1cuna2      104 --------------------------------------A--------------    104


hit structure      alignment
HHsearch alignment (Probability: 0.06 E-value:0.03)
DALI match                                         
Query         45 DLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKL     78
d1cuna2       70 HVENITAKMKGLKGKVSDLEKAAAQRKAKLDENS    103



top
52: d1ugoa_ BAG-​family molecular chaperone regulator-​5,​ BAG-​5 (svm: 0.671)

SCOP Superfamily: BAG domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.59  Contact: 352
Modified z-scores:
dali:0.89 daliz:0.85 gdtts:0.94 tmscore:0.95 rmsd:0.31 AHM:0.42 LBcontacta:0.87 LBcontactb:0.80 LHM:0.24
id:0.63 blosum:0.39 compass:0.56 pearson:0.93
Scaled scores:
dali:0.69 daliz:0.40 gdtts:0.59 tmscore:0.58 rmsd:0.80 AHM:0.67 LBcontacta:0.35 LBcontactb:0.30 LHM:0.31
id:-0.01 blosum:0.07 compass:0.10 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 4.3 Raw score:233.00)
Query          1 -------------------FQEYEKLVDYYLD--IPEDrPITLEDMTFYLESVFDGlwsy     39
d1ugoa_        1 gssgssgmdmgnqhpsisrLQEIQREVKAIEPqvVGFSgLSDDKNYKRLERILTKQ----     56

Query         40 rffhrdleyLLDSDPRLRQDYREFTNRCLAAINRIFAKLADagiiQPQPedlrsamslnv     99
d1ugoa_       57 --lfeidsvDTEGKGDIQQARKRAAQETERLLKELEQNASG----PSSG-----------     99

Query        100 wlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1ugoa_      100 ---------------------------------------------------    100


hit structure      alignment
FAST alignment (Normalized score: 2.51 Raw score:305.80)
Query          1 FQEYEKLVDYYLDIPEDRPI----------------------TLEDMTFYLESVFDGLWS     38
d1ugoa_        1 --------------------GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVV-----     35

Query         39 YRFFHRDLEYLLDSDPRLRQDY-------REFTNRCLAAINRIFAKLADAGIIQPQ----     87
d1ugoa_       36 ----------------------GFSGLSDDKNYKRLERILTKQLFEID--------SVDT     65

Query         88 --------PEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRE    139
d1ugoa_       66 EGKGDIQQARKRAAQETERLLKELEQ----------------------------------     91

Query        140 RVLALREKYRP--------    150
d1ugoa_       92 -----------NASGPSSG     99


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:58.48)
Query          1 ------------------F-QEYEKLVDYYLD-IPEDRPIT--LEDMTFYLESVFDGLWS     38
d1ugoa_        1 GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVG-FSGLSDDKNYKRLERILTKQLF-     58

Query         39 YRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP-QPEDLRSAMSL     97
d1ugoa_       59 EI-DS--V--DTEGKGDIQQARKRAAQETERLLKELEQNA--S--G-PSSG---------     99

Query         98 NVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1ugoa_      100 -----------------------------------------------------    100


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.22)
DALI match       ************************
Query         51 DSDPRLRQDYREFTNRCLAAINRI     74
d1ugoa_       66 EGKGDIQQARKRAAQETERLLKEL     89



top
53: d1lkia_ Leukemia inhibitory factor (LIF) (svm: 0.672)

SCOP Superfamily: 4-​helical cytokines  |  SCOP Fold: 4-​helical cytokines  |  SCOP Class: All alpha proteins

Consensus: 0.19  Contact: 258
Modified z-scores:
dali:0.79 daliz:0.76 gdtts:0.84 tmscore:0.85 rmsd:0.39 AHM:0.49 LBcontacta:0.63 LBcontactb:0.46 LHM:0.63
id:0.62 blosum:0.34 compass:0.64 pearson:0.92
Scaled scores:
dali:0.62 daliz:0.36 gdtts:0.45 tmscore:0.44 rmsd:0.67 AHM:0.55 LBcontacta:0.23 LBcontactb:0.16 LHM:-0.05
id:0.00 blosum:0.05 compass:0.07 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:203.30)
Query          1 --------------------------------------------------fqeyEKLVDy     10
d1lkia_        1 natcairhpchgnlmnqiknqlaqlngsanalfisyytaqgepfpnnveklcapNMTDF-     59

Query         11 yLDIPEDRP--ITLEDMTFYLESVFDGLWSYRFFHRDLE---------------------     47
d1lkia_       60 -PSFHGNGTekTKLVELYRMVAYLSASLTNITRDQKVLNptavslqvklnatidvmrgll    118

Query         48 -----------------------ylldSDPRLRQDYREFTNRCLAAINRIFAKLadagii     84
d1lkia_      119 snvlcrlcnkyrvghvdvppvpdhsdkEAFQRKKLGCQLLGTYKQVISVVVQAF------    172

Query         85 qpqpedlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlal    144
d1lkia_      173 ------------------------------------------------------------    173

Query        145 rekyrp    150
d1lkia_      173 ------    173


hit structure      alignment
FAST alignment (Normalized score: 2.35 Raw score:377.20)
Query          1 FQEYEKLVDYYLDIPEDRPI----------------------------------------     20
d1lkia_        1 --------------------NATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQ     40

Query         21 ---------------------------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLDS-     52
d1lkia_       41 GEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSA---SLTNITRDQKVLN     97

Query         53 --DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL    110
d1lkia_       98 PTAVSLQVKLNATIDVMRGLLSNVLCRLC-------------------------------    126

Query        111 KTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--------------------    150
d1lkia_      127 ----------------------------------------NKYRVGHVDVPPVPDHSDKE    146

Query        151 --------------------------    151
d1lkia_      147 AFQRKKLGCQLLGTYKQVISVVVQAF    172


hit structure      alignment
TMalign alignment (TM-score: 0.36 Raw score:53.70)
Query          1 ------------------------------FQEYE-------------------------      5
d1lkia_        1 NATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFP     60

Query          6 ------KLVDYYLDIPEDRPITLEDMTFYLESVFDGL-WSYR-FFH-RDLEYLLDSDPRL     56
d1lkia_       61 SFHGNG-------------TEKTKLVELYRMVAY-LSA--SLT-NITRDQKVLNPTAVSL    103

Query         57 RQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAM-SLNVWLVITNWMAFLKT---    112
d1lkia_      104 QVKLNATIDVMRGLLSNVLCRLCNKYRVG---------HV---D--VP-PVPDHSDKEAF    148

Query        113 ------------------------AHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKY    148
d1lkia_      149 QRKKLGCQLLGTYKQVISVVVQAF------------------------------------    172

Query        149 RP    150
d1lkia_      173 --    173


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.75)
DALI match                                                        
Query         32 VFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD     80
d1lkia_       72 LVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATID-VMRGLLS    119



top
54: d1vhma_ Hypothetical protein YebR (svm: -0.478)

SCOP Superfamily: GAF domain-​like  |  SCOP Fold: Profilin-​like  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.31  Contact: 282
Modified z-scores:
dali:0.91 daliz:0.92 gdtts:0.79 tmscore:0.82 rmsd:0.40 AHM:0.38 LBcontacta:0.81 LBcontactb:0.60 LHM:0.26
id:0.60 blosum:0.44 compass:0.68 pearson:0.92
Scaled scores:
dali:0.72 daliz:0.50 gdtts:0.44 tmscore:0.42 rmsd:0.72 AHM:0.66 LBcontacta:0.39 LBcontactb:0.31 LHM:0.33
id:-0.01 blosum:0.05 compass:0.23 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:261.40)
Query          1 -----FQEYEKLVDYYLDIpedrpitleDMTFYLESVFDGLWSYRF--------------     41
d1vhma_        1 nktefYADLNRDFNALMAG-------etSFLATLANTSALLYERLTdinwagfylleddt     53

Query         42 ------------------------------------------------------------     42
d1vhma_       54 lvlgpfqgkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvv    113

Query         42 ----------fhrdlEYLLdsdPRLRQDYREFTNRCLAAINRIFaKLADAgiiqpqpedl     91
d1vhma_      114 knqiigvldidstvfGRFT---DEDEQGLRQLVAQLEKVLATTD-YKKFF----------    159

Query         92 rsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1vhma_      160 -----------------------------------------------------------    160


hit structure      alignment
FAST alignment (Normalized score: 2.94 Raw score:453.80)
Query          1 F------QEYEKLVDYYLDIPEDRPITLE----DMTFYLESVFDGLWSYRFFHRDLEYLL     50
d1vhma_        1 -NKTEFYADLNRDFNALM-----------AGETSFLATLANTSALLYER-----------     37

Query         51 D-----------------------------------------------------------     51
d1vhma_       38 -LTDINWAGFYLLEDDTLVLGPFQGKIACVRIPVGRGVCGTAVARNQVQRIEDVHVFDGH     96

Query         52 ----------------------------------SDPRLRQDYREFTNRCLAAINRIFAK     77
d1vhma_       97 IACDAASNSEIVLPLVVKNQIIGVLDIDSTVFGRFTDEDEQGLRQLVAQLEKVLAT----    152

Query         78 LADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEY    137
d1vhma_      153 ------------------------------------------------------------    153

Query        138 RERVLALREKYRP-------    150
d1vhma_      153 -------------TDYKKFF    159


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:53.07)
Query          1 -FQEYEKLVDYYLD--IPEDRPITL-EDM-TFYLESVFDGLWSYRF--------------     41
d1vhma_        1 NKTEFYADLNRDFNALMA---GETSFLATLANTSALLYERL--TDINWAGFYLLEDDTLV     55

Query         42 ------------------------------------------------------------     42
d1vhma_       56 LGPFQGKIACVRIPVGRGVCGTAVARNQVQRIEDVHVFDGHIACDAASNSEIVLPLVVKN    115

Query         42 --------FHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRS     93
d1vhma_      116 QIIGVLDIDSTVFGRFT------D-EDEQGLRQLVAQLEKVLATT----DYK--------    156

Query         94 AMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1vhma_      157 -------------------------------------KFF-----------------    159


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.14)
DALI match                                        
Query         39 YRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAI     71
d1vhma_        6 YADLNRDFNALMAGETSFLATLANTSALLYERL     38



top
55: d1v4aa2 Glutamine synthase adenylyltransferase GlnE,​ N-​terminal domain (svm: -0.925)

SCOP Superfamily: Nucleotidyltransferase  |  SCOP Fold: Nucleotidyltransferase  |  SCOP Class: Alpha and beta proteins (a+b)

Consensus: 0.45  Contact: 436
Modified z-scores:
dali:0.94 daliz:0.87 gdtts:0.93 tmscore:0.94 rmsd:0.45 AHM:0.55 LBcontacta:0.71 LBcontactb:0.57 LHM:0.58
id:0.68 blosum:0.07 compass:0.21 pearson:0.84
Scaled scores:
dali:0.62 daliz:0.35 gdtts:0.46 tmscore:0.49 rmsd:0.67 AHM:0.57 LBcontacta:0.20 LBcontactb:0.15 LHM:0.10
id:-0.01 blosum:0.00 compass:0.08 pearson:0.07

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:316.40)
Query          1 ------------------------------------------------------------      1
d1v4aa2        1 kplssplqqywqtvverlpeplaeeslsaqaksvltfsdfvqdsviahpewltelesqpp     60

Query          1 --------FQEYEKLVDYYldipedrpitledmtFYLESVFDGLWSYRFFHRDLEY----     48
d1v4aa2       61 qadewqhyAAWLQEALCNV---------------SDEAGLMRELRLFRRRIMVRIAwaqt    105

Query         49 -----llDSDPRLRQDYREFTNRCLAAINRIFAKLAdagiIQPQ----------------     87
d1v4aa2      106 lalvteeSILQQLSYLAETLIVAARDWLYDACCREW----GTPCnaqgeaqpllilgmgk    161

Query         88 -----------------------PEDLRSAMSLNVWLVITNWMaflktahlTELK-----    119
d1v4aa2      162 lgggelnfssdidlifawperelDNAQFFTRMGQRLIKVLDQP--------TQDGfvyrv    213

Query        120 ---------------------------------qgiyqvltlevpyltpeyrervlalre    146
d1v4aa2      214 dmrlrpfgesgplvlsfaaledyyqeqgrdweryamvkarimgdsegvyanelramlrpf    273

Query        147 kyrp    150
d1v4aa2      274 vfrr    277


hit structure      alignment
FAST alignment (Normalized score: 3.38 Raw score:688.30)
Query          1 F-----------------------------------------------------------      1
d1v4aa2        1 -KPLSSPLQQYWQTVVERLPEPLAEESLSAQAKSVLTFSDFVQDSVIAHPEWLTELESQP     59

Query          2 ------QEYEKLVDYYLDIPEDRPITLE----DMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1v4aa2       60 PQADEWQHYAAWLQEAL-----------CNVSDEAGLMRELRLFRRRIM-----------     97

Query         52 S-------------DPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP------------     86
d1v4aa2       98 -VRIAWAQTLALVTEESILQQLSYLAETLIVAARDWLYDACC-REWGTPCNAQGEAQPLL    155

Query         87 ----------------------------QPEDLRSAMSLNVWLVITNWMAFLKTAHLTEL    118
d1v4aa2      156 ILGMGKLGGGELNFSSDIDLIFAWPERELDNAQFFTRMGQRLIKVLD-------------    202

Query        119 KQGIYQVLTLEVPYLTPEYRERVLALREKYRP----------------------------    150
d1v4aa2      203 --------------------------------QPTQDGFVYRVDMRLRPFGESGPLVLSF    230

Query        151 -----------------------------------------------    151
d1v4aa2      231 AALEDYYQEQGRDWERYAMVKARIMGDSEGVYANELRAMLRPFVFRR    277


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:60.31)
Query          1 ------------------------------------------------------------      1
d1v4aa2        1 KPLSSPLQQYWQTVVERLPEPLAEESLSAQAKSVLTFSDFVQDSVIAHPEWLTELESQPP     60

Query          1 ---FQ-EYEKLVDY-YLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRD--LEY--L--     49
d1v4aa2       61 QADEWQHYAAWLQEALCN----------V--SDEAGLMRELRLFRRRIMVRI--AWAQTL    106

Query         50 -----LD-SDPRLRQDYREFTNRCLAAINRIFAKLADA----------------------     81
d1v4aa2      107 ALVTE-ESILQQLSYLAETLIVAARDWLYDACCREWGTPCNAQGEAQPLLILGMGKLGGG    165

Query         82 -----------------GIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELK-QG--    121
d1v4aa2      166 ELNFSSDIDLIFAWPER----ELDNAQFFTRMGQRLIKVLDQP--T-------QDG-FVY    211

Query        122 ------------------------------------------------------------    122
d1v4aa2      212 RVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMGDSEGVYANELRAMLR    271

Query        122 ------IYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1v4aa2      272 PFVFRR-----------------------------    277


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.53)
DALI match       ...........                                       ..........
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDY     60
d1v4aa2       65 WQHYAAWLQEALCNVSDEAGLMRELRL-----FRRRIMVRIAWAQTLALVTEESILQQLS    119

DALI match       ...................   
Query         61 REFTNRCLAAINRIFAKLADAG     82
d1v4aa2      120 YLAETLIVAARDWLYDACCREW    141



hit structures. 
top
56: d1chua1 L-​aspartate oxidase (svm: -1.275)

SCOP Superfamily: Succinate dehydrogenase/​fumarate reductase flavoprotein C-​terminal domain  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.31  Contact: 391
Modified z-scores:
dali:0.93 daliz:0.88 gdtts:0.91 tmscore:0.95 rmsd:0.36 AHM:0.35 LBcontacta:0.78 LBcontactb:0.64 LHM:0.16
id:0.74 blosum:0.30 compass:0.28 pearson:0.94
Scaled scores:
dali:0.65 daliz:0.40 gdtts:0.47 tmscore:0.51 rmsd:0.75 AHM:0.70 LBcontacta:0.25 LBcontactb:0.20 LHM:0.44
id:0.00 blosum:0.06 compass:0.12 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 4.7 Raw score:280.90)
Query          1 -------------FQEYEKLVDYYLD--IPEDrpITLEDMTFYLESVFDGLWSYRFFHRD     45
d1chua1        1 desrvenpdervvIQHNWHELRLFMWdyVGIV--RTTKRLERALRRITMLQQEIDEYYAH     58

Query         46 LEylldsdprLRQDYREFTNRCLAAINRIFAKLADAG----------------iiQPQPE     89
d1chua1       59 FR--------VSNNLLELRNLVQVAELIVRCAMMRKEsrglhftldypellthsgPSILS    110

Query         90 Dlrsamslnvwlvitnwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyr    149
d1chua1      111 P-----------------------------------------------------------    111

Query        150 p    150
d1chua1      112 -    112


hit structure      alignment
FAST alignment (Normalized score: 2.18 Raw score:281.30)
Query          1 FQEYEKLVDYYLDIPEDRPI---------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1chua1        1 --------------------DESRVENPDERVVIQHNWHELRLFMWD-------------     27

Query         52 SDPRL------RQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAM----------     95
d1chua1       28 -----YVGIVRTTKRLERALRRITMLQQEID-------------------EYYAHFRVSN     63

Query         96 ----SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP-    150
d1chua1       64 NLLELRNLVQVAEL---------------------------------------------I     78

Query        151 ---------------------------------    151
d1chua1       79 VRCAMMRKESRGLHFTLDYPELLTHSGPSILSP    111


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:59.64)
Query          1 -------------FQEYEKLVDYYLD--IPEDRPITLEDMTFYLESVFDGLWSYRFFHRD     45
d1chua1        1 DESRVENPDERVVIQHNWHELRLFMWDYVGI-V-RTTKRLERALRRITMLQQ--E-IDEY     55

Query         46 LEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLAD--------A-GII-QPQPEDLRSAM     95
d1chua1       56 YAHF--RVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPELLTHSGPS--I-LS    110

Query         96 SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1chua1      111 --P----------------------------------------------------    111


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.51)
DALI match                                                         
Query         16 EDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTN     65
d1chua1        8 PDERVVIQHN---WHELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDE     54



top
57: d1oe8a1 Class alpha GST (svm: -1.172)

SCOP Superfamily: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Fold: Glutathione S-​transferase (GST),​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.51  Contact: 391
Modified z-scores:
dali:0.92 daliz:0.89 gdtts:0.94 tmscore:0.96 rmsd:0.31 AHM:0.29 LBcontacta:0.70 LBcontactb:0.73 LHM:0.14
id:0.61 blosum:0.03 compass:0.35 pearson:0.52
Scaled scores:
dali:0.64 daliz:0.39 gdtts:0.55 tmscore:0.58 rmsd:0.79 AHM:0.73 LBcontacta:0.23 LBcontactb:0.26 LHM:0.46
id:-0.01 blosum:-0.05 compass:0.01 pearson:0.01

hit structure      alignment
DALI alignment (Z-score: 4.8 Raw score:305.10)
Query          1 -------------FQEYEKLVDYYLD-IPEDRP-ITLEDMTFYL-ESVFDGLWSYRFFHR     44
d1oe8a1        1 mggteeeyynvekLIGQAEDLEHEYYkTLMKPEeEKQKIIKEILnGKVPVLLDIICESLK     60

Query         45 DLEYLL--DSDPRlrQDYREFTNRCLAAINRIfakladagiiqpqpedlrsamslNVWLV    102
d1oe8a1       61 ASTGKLavGDKVT--LADLVLIAVIDHVTDLD----------------------kEFLTG     96

Query        103 ITNwmaflktahltelkqgiyqvltlevpyltpeyrervlalrekyrp    150
d1oe8a1       97 KYP---------------------eihkhrenllassprlakylsdra    123


hit structure      alignment
FAST alignment (Normalized score: 1.72 Raw score:233.30)
Query          1 FQEYEKLVDYYLDIPEDRPI---------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1oe8a1        1 --------------------MGGTEEEYYNVEKLIGQAEDLEHEY---------------     25

Query         52 S------DPRLRQDYREFTN-RCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVIT    104
d1oe8a1       26 -YKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLK------------------------     60

Query        105 NWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP--------------    150
d1oe8a1       61 ----------------------------------------------ASTGKLAVGDKVTL     74

Query        151 -------------------------------------------------    151
d1oe8a1       75 ADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRA    123


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:60.82)
Query          1 -------------FQEYEKLVDYYLD-IPEDRP--ITLEDMTFYLESVFDGLWSYRFFHR     44
d1oe8a1        1 MGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLK     60

Query         45 DLEYLL-DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVI    103
d1oe8a1       61 ASTGKLAVGDKVT-LADLVLIAVIDHVTD-LD--------------------K-EFLTGK     97

Query        104 TNW-----------------------MAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRER    140
d1oe8a1       98 YPEIHKHRENLLASSPRLAKYLSDRA----------------------------------    123

Query        141 VLALREKYRP    150
d1oe8a1      124 ----------    124


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.07)
DALI match                                          
Query         35 GLWSYRFFHRDL--EYLLDSDPRLRQDYREFTNRC     67
d1oe8a1       78 VLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASS    112



top
58: d1m5ya1 Porin chaperone SurA,​ peptide-​binding domain (svm: -0.621)

SCOP Superfamily: Porin chaperone SurA,​ peptide-​binding domain  |  SCOP Fold: Porin chaperone SurA,​ peptide-​binding domain  |  SCOP Class: All alpha proteins

Consensus: 0.31  Contact: 191
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.81 tmscore:0.86 rmsd:0.48 AHM:0.55 LBcontacta:0.90 LBcontactb:0.84 LHM:0.59
id:0.65 blosum:0.38 compass:0.51 pearson:0.95
Scaled scores:
dali:0.78 daliz:0.58 gdtts:0.43 tmscore:0.42 rmsd:0.67 AHM:0.55 LBcontacta:0.46 LBcontactb:0.39 LHM:-0.05
id:0.00 blosum:0.04 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:246.90)
Query          1 fqeyeklvdyyldipedrpitledmtfylesvfdglwsyrffhrdleylldsdprlrqDY     60
d1m5ya1        1 ----------------------------------------------------------VD      2

Query         61 RE--------fTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKT    112
d1m5ya1        3 KVaavvnngvvLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQK     62

Query        113 AH-------------------------------------------------ltELKQ---    120
d1m5ya1       63 MGvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisEVRNnev    122

Query        121 -------giyqvltlevpyltpeyrervlaLREKYR--------------p    150
d1m5ya1      123 rrritilpqeveslaqqvdrayrmlmnrkfSEEAASwmqeqrasayvkils    173


hit structure      alignment
FAST alignment (Normalized score: 2.06 Raw score:331.30)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLL----------     50
d1m5ya1        1 --------------------------------------------------VDKVAAVVNN     10

Query         51 -------------------------DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQ     85
d1m5ya1       11 GVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQK--------     62

Query         86 PQ---------------------------------------PEDLRSAMSLNVWLVITNW    106
d1m5ya1       63 --MGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNN    120

Query        107 MAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP----------------    150
d1m5ya1      121 EVRR----------------------------------------RITILPQEVESLAQQV    140

Query        151 ---------------------------------    151
d1m5ya1      141 DRAYRMLMNRKFSEEAASWMQEQRASAYVKILS    173


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:49.77)
Query          1 -FQEYE-----KLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDP     54
d1m5ya1        1 V----DKVAAV-------------------------------------VNNG--------     11

Query         55 RLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-KT-    112
d1m5ya1       12 -----VV--LESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMG     64

Query        113 -AHLT--------------------------------------------ELKQGIYQ---    124
d1m5ya1       65 V--KISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEV    122

Query        125 --------------------------VLTLEVPYLTPEYRERVLALRE---KYR--P---    150
d1m5ya1      123 RRRITILPQEVESLAQQVDRAYRMLM---------------------NRKF--SEEAASW    159

Query        151 --------------    151
d1m5ya1      160 MQEQRASAYVKILS    173


hit structure      alignment
HHsearch alignment (Probability: 0.15 E-value:0.04)
DALI match                                                                   
Query          2 QEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEY--LLDSDPRLRQD     59
d1m5ya1       16 SDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQA     75

DALI match                                                 
Query         60 YREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWL    101
d1m5ya1       76 IANIAKQNNMTLDQMRSRLAYD---GLNYNTYRNQIRKEMII    114



top
59: d1kxpd1 Vitamin D binding protein (svm: -1.364)

SCOP Superfamily: Serum albumin-​like  |  SCOP Fold: Serum albumin-​like  |  SCOP Class: All alpha proteins

Consensus: 0.31  Contact: 354
Modified z-scores:
dali:0.93 daliz:0.91 gdtts:0.93 tmscore:0.95 rmsd:0.35 AHM:0.40 LBcontacta:0.87 LBcontactb:0.89 LHM:0.35
id:0.75 blosum:0.26 compass:0.22 pearson:0.66
Scaled scores:
dali:0.68 daliz:0.44 gdtts:0.54 tmscore:0.55 rmsd:0.75 AHM:0.64 LBcontacta:0.38 LBcontactb:0.40 LHM:0.16
id:0.01 blosum:0.04 compass:0.06 pearson:0.06

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:263.70)
Query          1 fqeyeklvdyyldipedrpitledmTFYLESVFDglwsyrffhrdleylldsdprlrqdy     60
d1kxpd1        1 --------------------lergrDYEKNKVCK-----------------------efs     17

Query         61 reFTNRCLAAINRIFAKLADagiiqPQPEDLRSAMSLNVWLVITNW-MAFLktahlteLK    119
d1kxpd1       18 hlGKEDFTSLSLVLYSRKFP-----SGTFEQVSQLVKEVVSLTEACcAEGA------dPD     66

Query        120 QGIYQVLTLEVPY--------lTPEY----------------------------------    137
d1kxpd1       67 CYDTRTSALSAKScesnspfpvHPLKhqpqefptyveptndeiceafrkdpkeyanqfmw    126

Query        138 ----------------------------------------rervlalrekyrp    150
d1kxpd1      127 eystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkhlslltt    179


hit structure      alignment
FAST alignment (Normalized score: 2.93 Raw score:480.40)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTF---------------------------------     27
d1kxpd1        1 ---------------------------LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYS     33

Query         28 ------------------------------------------------------------     28
d1kxpd1       34 RKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPLKH     93

Query         28 -----------YLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYRE-FTNRCLAAINRIF     75
d1kxpd1       94 QPQEFPTYVEPTNDEICEAFR-------------------------KDPKEYANQFMWEY    128

Query         76 AKLADAGIIQ--PQPEDLRSAMSLNVWLVITNWMAFLKTAHL-TELKQGIYQVLT-----    127
d1kxpd1      129 STN-------YGQAPLSLLVSYTKSYLSMVGSCCT-------SASPTVCFLKER-LQLKH    173

Query        128 LEVPYLTPEYRERVLALREKYRP-    150
d1kxpd1      174 LSLLT------------------T    179


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:55.06)
Query          1 --------------------------------------FQEYEKLVDYYLDIPE------     16
d1kxpd1        1 LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPS--------------GTFEQVSQ     46

Query         17 -------------------------------------------------DR-PITLEDMT     26
d1kxpd1       47 LVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPLKHQP-QEFPT--YVE    103

Query         27 FYLESVFDGLWSYRFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQP     86
d1kxpd1      104 PTNDEICEAF--R--K-----------------D--PK-EYANQFMWEYSTNYG----QA    135

Query         87 QPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGI-YQV-LT-LEVPYLTPEYRERVLA    143
d1kxpd1      136 PL-SLLVSYTKSYLSMVGSCCTS-A--S--PTVCFLKERLQLKHLSLLTT----------    179

Query        144 LREKYRP    150
d1kxpd1      180 -------    180


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.42)
DALI match                                           
Query         40 RFFHRDLEYLLDSDPRLRQDYREFTNRCLAAINRIF     75
d1kxpd1      119 EYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSC    154



top
60: d1hcia4 alpha-​actinin (svm: -0.607)

SCOP Superfamily: Spectrin repeat  |  SCOP Fold: Spectrin repeat-​like  |  SCOP Class: All alpha proteins

Consensus: 0.18  Contact: 375
Modified z-scores:
dali:0.93 daliz:0.89 gdtts:0.93 tmscore:0.95 rmsd:0.36 AHM:0.41 LBcontacta:0.74 LBcontactb:0.62 LHM:0.38
id:0.83 blosum:0.63 compass:0.50 pearson:0.95
Scaled scores:
dali:0.67 daliz:0.44 gdtts:0.53 tmscore:0.54 rmsd:0.78 AHM:0.72 LBcontacta:0.24 LBcontactb:0.16 LHM:0.21
id:0.03 blosum:0.12 compass:0.11 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 5.1 Raw score:298.90)
Query          1 -------------FQEYEKLVDYYLD--IPEDR------piTLEDMTFYLESVFDGLWSY     39
d1hcia4        1 hanerlrrqfaaqANAIGPWIQNKMEeiARSSIqitgaledQMNQLKQYEHNIINYKNNI     60

Query         40 RFFHRDLEYL-------ldsdprLRQDYREFTNRCLAAINRIFAKLADAGiiqpqpedlr     92
d1hcia4       61 DKLEGDHQLIqealvfdnkhtnyTMEHIRVGWELLLTTIARTINEVETQI----------    110

Query         93 samslnvwlvitnwmaflktahltelkqgiyqvltlevpyLTPEyrervlalrekyrp    150
d1hcia4      111 ----------------------------------------LTRD--------------    114


hit structure      alignment
FAST alignment (Normalized score: 2.56 Raw score:334.10)
Query          1 FQEYEKLVDYYLDIPEDRPI---------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD     51
d1hcia4        1 --------------------HANERLRRQFAAQANAIGPWIQNKMEEIA-----------     29

Query         52 --------SDPRLRQDYREFTNR---CLAAINRIFAKLADAGIIQPQPEDLRSAM-----     95
d1hcia4       30 RSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQL---------------IQEAL     74

Query         96 -------------SLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVL    142
d1hcia4       75 VFDNKHTNYTMEHIRVGWELLL--------------------------------------     96

Query        143 ALREKYRP------------------    150
d1hcia4       97 --------TTIARTINEVETQILTRD    114


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:59.58)
Query          1 ----------F---QEYEKLVDYYLDIPED-R---------PI--TLEDMTFYLESVFDG     35
d1hcia4        1 HANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIIN-YKNN     59

Query         36 LWSYRFFHRDLEYLL--DSDPR--LRQDYREFTNRCLAAINRIFAKLADAGI------IQ     85
d1hcia4       60 ID--K-LEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRD--    114

Query         86 PQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEYRERVLALR    145
d1hcia4      115 ------------------------------------------------------------    115

Query        146 EKYRP    150
d1hcia4      115 -----    115


hit structure      alignment
HHsearch alignment (Probability: 0.10 E-value:0.12)
DALI match                                                                   
Query         51 DSDPRLRQDYREFTNRCLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL    110
d1hcia4        1 HANERLRRQFAAQANAIGPWIQNKMEEIARS--SIQITGALEDQMNQLKQYEHNIINYKN     58

DALI match                                              
Query        111 KTAHLTELKQGIYQVLTLEVP---YLTPEYRERVLALRE    146
d1hcia4       59 NIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLT     97



hit structures. 
top
61: d1f5na1 Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain (svm: -0.700)

SCOP Superfamily: Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain  |  SCOP Fold: Interferon-​induced guanylate-​binding protein 1 (GBP1),​ C-​terminal domain  |  SCOP Class: All alpha proteins

Consensus: 0.21  Contact: 440
Modified z-scores:
dali:0.90 daliz:0.75 gdtts:0.86 tmscore:0.94 rmsd:0.57 AHM:0.58 LBcontacta:0.78 LBcontactb:0.71 LHM:0.57
id:0.72 blosum:0.05 compass:0.11 pearson:0.83
Scaled scores:
dali:0.55 daliz:0.26 gdtts:0.33 tmscore:0.38 rmsd:0.49 AHM:0.41 LBcontacta:0.24 LBcontactb:0.21 LHM:-0.04
id:-0.01 blosum:-0.01 compass:0.01 pearson:0.02

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:285.90)
Query          1 ------------------------------------------------------------      1
d1f5na1        1 ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv     60

Query          1 ------------------------------------------------------------      1
d1f5na1       61 qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas    120

Query          1 ---FQEYEKLVDYYLD--IPEDRP----ITLEDMTFYLESVFDGLWSyrffhrdleylld     51
d1f5na1      121 sdrCSGLLQVIFSPLEeeVKAGIYskpgGYRLFVQKLQDLKKKYYEE-------------    167

Query         52 sdpRLRQDYREFTNRCLAAINRIFAKLADAGiiqpqPEDLRSAMSLNVWLVITNWMAFLK    111
d1f5na1      168 -prKGIQAEEILQTYLKSKESMTDAILQTDQtltekEKEIEVERVKAESAQASAKMLHEM    226

Query        112 TA-----------------------------------hltelkqgiyqvltlevpyltpe    136
d1f5na1      227 QRkneqmmeqkersyqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkes    286

Query        137 yrervlalrekyrp    150
d1f5na1      287 rimkneiqdlqtkm    300


hit structure      alignment
FAST alignment (Normalized score: 2.80 Raw score:594.20)
Query          1 F---------------------------------------------QEYEKLVDYYLDIP     15
d1f5na1        1 -GGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQ----     55

Query         16 EDRPI-----------TLEDMTFYLESVFDGLWSYRFFHRDLEYLLD---------SDPR     55
d1f5na1       56 -----MGQKVQLPTESLQELLDLHRDSEREAIEV-------------FIRSSFKDVDHLF     97

Query         56 LRQDYREFTNRCLAAINRIFAKLADAGIIQPQ----------------------------     87
d1f5na1       98 QKELAAQLEKKRDDFCKQNQEASSD-------RCSGLLQVIFSPLEEEVKAGIYSKPGGY    150

Query         88 ------------------------------------------------------------     88
d1f5na1      151 RLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVER    210

Query         88 ----------PEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVLTLEVPYLTPEY    137
d1f5na1      211 VKAESAQASAKMLHEMQRKNEQMMEQKE--------------------------------    238

Query        138 RERVLALREKYRP-----------------------------------------------    150
d1f5na1      239 -------------RSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKE    285

Query        151 ---------------    151
d1f5na1      286 SRIMKNEIQDLQTKM    300


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:61.66)
Query          1 --------------------------------------------FQEYEKLVDYYLD--I     14
d1f5na1        1 GGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKV     60

Query         15 PEDRPI-TL-EDMTFYLESVFDGLWSYR--FFHRD-LEYLLDSDPRLRQDYREFTNRCLA     69
d1f5na1       61 QLPTESLQEL-LDLHRD-SEREAIEVFIRSSFKDVDHL-FQ-----KE-LAAQLEKKRDD    111

Query         70 AIN-R---IFA------------------------------------------------K     77
d1f5na1      112 FCKQNQEA--SSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPR    169

Query         78 -LAD---------------------------------------------------AGIIQ     85
d1f5na1      170 K-GIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKML----H    224

Query         86 PQP-EDLRSAMSLNVWLVITNWMAFLKTAH------------------------------    114
d1f5na1      225 EMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQK    284

Query        115 ----------------LTELKQGIYQVLTLEVPYLTPEYRERVLALREKYRP    150
d1f5na1      285 ESRIMKNEIQDLQTKM------------------------------------    300


hit structure      alignment
HHsearch alignment (Probability: 0.38 E-value:0.00)
DALI match                                                                   
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLES----VFDGLWSYRFFHRDLEYLLDSDPRL     56
d1f5na1       49 IAHYEQQMGQKVQLPTE---SLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQL    105

DALI match                               
Query         57 RQDYREFTNRCLAAINRIFAKLAD     80
d1f5na1      106 EKKRDDFCKQNQEASSDRCSGLLQ    129



top
62: d1n46a_ Thyroid hormone receptor beta (TR-​beta) (svm: -0.368)

SCOP Superfamily: Nuclear receptor ligand-​binding domain  |  SCOP Fold: Nuclear receptor ligand-​binding domain  |  SCOP Class: All alpha proteins

Consensus: 0.44  Contact: 614
Modified z-scores:
dali:0.94 daliz:0.87 gdtts:0.95 tmscore:0.97 rmsd:0.44 AHM:0.41 LBcontacta:0.80 LBcontactb:0.84 LHM:0.21
id:0.95 blosum:0.59 compass:0.35 pearson:0.98
Scaled scores:
dali:0.62 daliz:0.30 gdtts:0.43 tmscore:0.50 rmsd:0.72 AHM:0.68 LBcontacta:0.19 LBcontactb:0.19 LHM:0.33
id:0.05 blosum:0.11 compass:0.17 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:398.00)
Query          1 fqeyeklvdyyldipedrpitLEDMTFYLESVFDglwSYRFfhRDLEYllDSDP------     54
d1n46a_        1 ----------kpeptdeewelIKTVTEAHVATNA---QWKQ-kRKFLP--EDIGqapivn     44

Query         55 ---------RLRQDYREFTNRCLAAINRIFAKL--ADAGiiqPQPEdLRSAMSLNVWLVI    103
d1n46a_       45 apeggkvdlEAFSHFTKIITPAITRVVDFAKKLpmFCELpceDQII-LLKGCCMEIMSLR    103

Query        104 TNWMA-----------------------------------FLKTAHltELKQ--GIYQVL    126
d1n46a_      104 AAVRYdpesetltlngemavtrgqlkngglgvvsdaifdlGMSLSS-fNLDDteVALLQA    162

Query        127 TLEVPY---------lTPEYRERVLALREKYR----------------------------    149
d1n46a_      163 VLLMSSdrpglacverIEKYQDSFLLAFEHYInyrkhhvthfwpkllmkvtdlrmigach    222

Query        150 ------------------------p    150
d1n46a_      223 asrflhmkvecptelfpplflevfe    247


hit structure      alignment
FAST alignment (Normalized score: 1.62 Raw score:311.10)
Query          1 FQEYEKLVDYYLDIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEYLLDSDPRL----     56
d1n46a_        1 --------------------------------------------------------KPEP      4

Query         57 ------------------------------------------------------------     57
d1n46a_        5 TDEEWELIKTVTEAHVATNAQWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIIT     64

Query         57 ------------------RQDYREFTNRCLAAINRIFAKLADAGIIQPQ-----------     87
d1n46a_       65 PAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAV-------RYDPESETLTL    117

Query         88 ------------------------------------------------------------     88
d1n46a_      118 NGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVE    177

Query         88 -----------------------------PEDLRSAMSLNVWLVITNWMAFLKT-AHLTE    117
d1n46a_      178 RIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTEL    237

Query        118 LKQGIYQVLTLEVPYLTPEYRERVLALREKYRP----------    150
d1n46a_      238 ---------------------------------FPPLFLEVFE    247


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:73.36)
Query          1 ----------FQEYEKLVDYYLDIPEDRPITLEDMTFYLES-VFDGLWSY-RFFHRDLEY     48
d1n46a_        1 KPEPTDEEWE--------------------LIKTVTEAHVATNAQW--KQK-RK--FLPE     35

Query         49 LLDS--------------DPR-LRQDYREFTNRCLAAINRIFAKLADAGII-QP---QPE     89
d1n46a_       36 DIGQAPIVNAPEGGKVDL-EAF-SH-FTKIITPAITRVVDFAKKL--P-MFCELPCEDQI     89

Query         90 DLRSAMSLNVWLVITNW-M--------------------------------A-FLKTA-H    114
d1n46a_       90 ILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSS    149

Query        115 LTELK--QGIYQVLTLEVP-----------YLTPEYRERVLALRE-KY--R------P--    150
d1n46a_      150 -FNLDDTEVALLQAVLLMSSDRPGLACVERIEKY-QDS-FLLAFEHYINYRKHHVTHFWP    206

Query        151 -----------------------------------------    151
d1n46a_      207 KLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFE    247


hit structure      alignment
HHsearch alignment (Probability: 0.12 E-value:0.09)
DALI match                                                                   
Query         13 DIPEDRPITLEDMTFYLESVFDGLWSYRFFHRDLEY----LLDSDPR--LRQDYREFTNR     66
d1n46a_       76 KLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGV    135

DALI match                                                                   
Query         67 CLAAINRIFAKLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFLKTAHLTELKQGIYQVL    126
d1n46a_      136 VSDAIFDLGMSLSS---FNLDDTEV--ALLQAVLLMSSDRPGLACVERIEKYQDSFLLAF    190

DALI match                         
Query        127 TLEVPYLTPEYRERVLAL    144
d1n46a_      191 EHYINYRKHHVTHFWPKL    208



top
63: d1rc2a_ Aquaporin Z (svm: -0.987)

SCOP Superfamily: Aquaporin-​like  |  SCOP Fold: Aquaporin-​like  |  SCOP Class: Membrane and cell surface proteins and peptides

Consensus: 0.49  Contact: 510
Modified z-scores:
dali:0.96 daliz:0.85 gdtts:0.95 tmscore:0.98 rmsd:0.43 AHM:0.44 LBcontacta:0.75 LBcontactb:0.70 LHM:0.14
id:0.62 blosum:0.03 compass:0.17 pearson:0.64
Scaled scores:
dali:0.63 daliz:0.29 gdtts:0.41 tmscore:0.49 rmsd:0.74 AHM:0.67 LBcontacta:0.19 LBcontactb:0.17 LHM:0.47
id:-0.02 blosum:-0.03 compass:0.02 pearson:-0.00

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:342.60)
Query          1 ----FQEYEKLVDYYLD----ipEDRP-------iTLEDMTFYLESVFDGLWSYRFF---     42
d1rc2a_        1 mfrkLAAECFGTFWLVFggcgsaVLAAgfpelgigFAGVALAFGLTVLTMAFAVGHIsgg     60

Query         43 -----------hrdlEYLLdsdprLRQDYREFTN--------------------rclaai     71
d1rc2a_       61 hfnpavtiglwaggrFPAK-----EVVGYVIAQVvggivaaallyliasgktgfdaaasg    115

Query         72 nRIFAkladagiIQPQPEDLRSAMSLNVWLVITNWMAFL-KTAH--LTELKQ---GIYQV    125
d1rc2a_      116 fASNG--ygehsPGGYSMLSALVVELVLSAGFLLVIHGAtDKFApaGFAPIAiglALTLI    173

Query        126 LTLEVPY---------------------------------ltpeyrervlalrekyrp    150
d1rc2a_      174 HLISIPVtntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd    231


hit structure      alignment
FAST alignment (Normalized score: 2.63 Raw score:490.40)
Query          1 F----QEYEKLVDYYLDIPEDRPI---------------------TLEDMTFYLESVFDG     35
d1rc2a_        1 -MFRKLAAECFGTFW---------LVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTM     50

Query         36 LWSYRFFHRDLEYLLD-------------------SDPRLRQDYREFTNRCLAAINRIFA     76
d1rc2a_       51 AFAVGH----------ISGGHFNPAVTIGLWAGGRFPAKEVVGYVIAQ------------     88

Query         77 KLADAGI-------------------------------------IQPQPEDLRSAM----     95
d1rc2a_       89 -------VVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYSMLSALVVELVL    141

Query         96 SLNVWLVITNWMAFLKTAHLT------------ELKQGIYQVLTLEVPYLTPEYRERVLA    143
d1rc2a_      142 SAGFLLVIHGA----------TDKFAPAGFAPIAIGLALTLIHLISIP------------    179

Query        144 LREKYRP----------------------------------------------------    150
d1rc2a_      180 -------VTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEKRD    231


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:72.13)
Query          1 ---FQ-EYEKLVDYYLD--IP-EDRPI-------T-LEDMTFYLESVFDGLW-SYR-FF-     42
d1rc2a_        1 MFRKLAAECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGG     60

Query         43 H-----RD--LE---YLLDSDPRLRQDYRE-FT-NRC---LAA-----------------     70
d1rc2a_       61 HFNPAV-TIGLWAGGRFPA-K--EVVGYVIAQVV-GGIVA--AALLYLIASGKTGFDAAA    113

Query         71 ---INRIFA--KLADAGIIQPQPEDLRSAMSLNVWLVITNWMAFL-K-TAH--L-TEL-K    119
d1rc2a_      114 SGF-ASNGYGEHSP-----GGYSMLSALVVELVLSAGFLLVIHGATDKFAPAGFAPIAIG    167

Query        120 QGIYQVLTLEVPY-----------------------------------------------    132
d1rc2a_      168 LALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLL    227

Query        133 ----LTPEYRERVLALREKYRP    150
d1rc2a_      228 EKRD------------------    231


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.09)
DALI match                                    
Query         21 TLEDMTFYL----ESVFDGLWSYRFFHRD     45
d1rc2a_      201 ALEQLWFFWVVPIVGGIIGGLIYRTLLEK    229