HorA Server Result

References:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278 link
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8 link
Comments and suggestions to: grishin@chop.swmed.edu


Title:
T592B
Query:
T592_B.pdb B
Mode:
Database search, accurate
Database:
SCOP1.69 less than 40% identity from ASTRAL
 
Scores:
dali   daliZ   gdtts   tmscore   rmsd   AHM   LBcontactA   LBcontactB   LHM   identity   blosum   compass   pearson  
Searches:
DALI   FAST   TMalign   HHsearch
Multiple sequence alignment
HHsearch hidden markov model

Mouse: rotate:Left; translate:Ctrl+Right; zoom:Middle

Downloads: 
PDB file 
PyMOL


Summary of Hits

Hits are found by three methods: Combined Score, SVM model and HHsearch. Hits are ordered by the combined score (Comb score). The combined scores is a similarity measure from sequence and structural similarities. A higher combined score (Comb score) indicates a higher probablity that the hit is homologous to the query.

top hits.
  
SVM score above .


Click the hit # to scroll down to alignments.   Download tab-delimited summary table.
Hit
#
SCOP Id Pro​tein Name SCOP​ Superfamily SCOP​ Fold SCOP
Class
Comb score SVM score HH prob DALI Z FAST SN TM​score
Domains with score better than the threshold ( Comb score > 2.0 OR SVM score > 0.6 OR HH prob > 0.9 )
1 d1rhsa2 Rhodanese Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.80 2.232 1.00 13.2 11.2 0.72
2 d1rhsa1 Rhodanese Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.58 1.954 1.00 12.9 11.3 0.70
3 d1e0ca2 Sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.52 1.850 1.00 13.8 11.2 0.70
4 d1uara1 Sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.48 2.019 1.00 12.6 10.9 0.70
5 d1urha1 3-​mercaptopyruvate sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.47 1.652 1.00 12.9 11.4 0.70
6 d1e0ca1 Sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.42 1.836 1.00 12.9 11.2 0.67
7 d1gmxa_ Sulfurtransferase GlpE Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.39 1.662 1.00 13.4 11.4 0.65
8 d1uara2 Sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 10.05 1.602 1.00 12.9 10.8 0.68
9 d1okga1 3-​mercaptopyruvate sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 9.81 2.114 1.00 10.8 9.7 0.66
10 d1qb0a_ CDC25b Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 9.47 2.077 1.00 11.9 8.1 0.73
11 d1qxna_ Polysulfide-​sulfur transferase (sulfide dehydrogenase,​ Sud) Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 9.27 1.002 1.00 10.4 8.7 0.61
12 d1urha2 3-​mercaptopyruvate sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 8.03 2.148 1.00 9.7 9.1 0.59
13 d1okga2 3-​mercaptopyruvate sulfurtransferase Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 7.94 2.367 1.00 9.0 7.5 0.60
14 d1t3ka_ Dual specificity phosphatase Cdc25 Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 5.95 1.593 1.00 4.6 3.6 0.52
15 d1tq1a_ Thiosulfate sulfurtransferase/​Senescence-​associated protein Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 5.66 1.577 1.00 3.7 4.0 0.46
16 d1hzma_ Erk2 binding domain of Mapk phosphatase mkp-​3 Rhodanese/​Cell cycle control phosphatase Rhodanese/​Cell cycle control phosphatase α/β 4.04 0.429 1.00 2.8 2.3 0.48
17 d1t6t1_ Hypothetical protein aq 2086 Toprim domain (Pfam 01751) Toprim domain (Pfam 01751) α/β 2.85 0.808 0.05 4.8 4.6 0.48
18 d1j7ja_ Hypoxanthine PRTase PRTase-​like PRTase-​like α/β 1.92 0.773 0.01 3.7 3.2 0.48
19 d1a3ca_ Pyrimidine operon regulator PyrR PRTase-​like PRTase-​like α/β 1.90 0.879 0.01 3.8 3.1 0.49
20 d1l1qa_ Adenine PRTase PRTase-​like PRTase-​like α/β 1.85 0.885 0.04 3.5 3.1 0.46
21 d1hgxa_ Hypoxanthine-​guanine-​xanthine PRTase PRTase-​like PRTase-​like α/β 1.78 0.872 0.01 3.7 2.9 0.47
22 d1vdda_ Recombination protein RecR Recombination protein RecR Recombination protein RecR multi 1.76 0.625 0.01 3.9 3.0 0.30
23 d1d5ra2 Phoshphoinositide phosphatase Pten (Pten tumor suppressor),​ N-​terminal domain (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.75 0.716 0.42 2.6 2.4 0.43
24 d1o5oa_ Uracil PRTase,​ Upp PRTase-​like PRTase-​like α/β 1.74 0.913 0.01 3.4 2.8 0.48
25 d1jlra_ Uracil PRTase,​ Upp PRTase-​like PRTase-​like α/β 1.63 1.093 0.01 3.0 2.2 0.49
26 d1nuia1 Primase fragment of primase-​helicase protein DNA primase core DNA primase core multi 1.57 0.627 0.01 3.5 2.8 0.42
27 d1d3ya_ DNA topoisomerase IV,​ alpha subunit DNA topoisomerase IV,​ alpha subunit DNA topoisomerase IV,​ alpha subunit multi 1.47 0.619 0.01 2.9 2.3 0.44
28 d1mwma2 Plasmid segregation protein ParM Actin-​like ATPase domain Ribonuclease H-​like motif α/β 1.32 1.578 0.01 2.3 2.5 0.26
29 d1mkpa_ Mapk phosphatase (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.24 1.120 0.29 2.0 2.2 0.40
30 d1uwca_ Feruloyl esterase A alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 1.24 0.837 0.03 2.1 2.1 0.43
31 d1i9sa_ mRNA capping enzyme,​ triphosphatase domain (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.20 0.653 0.22 1.8 2.0 0.41
32 d1yaca_ YcaC Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.18 1.012 0.09 2.6 2.4 0.43
33 d1ecfa1 Glutamine PRPP amidotransferase,​ C-​terminal domain PRTase-​like PRTase-​like α/β 1.18 0.985 0.01 2.5 2.5 0.46
34 d1fpza_ Kinase associated phosphatase (kap) (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.17 -1.353 0.96 1.9 1.3 0.37
35 d1hf2a2 Cell-​division inhibitor MinC,​ N-​terminal domain Cell-​division inhibitor MinC,​ N-​terminal domain Cell-​division inhibitor MinC,​ N-​terminal domain α/β 1.17 0.617 0.01 2.3 3.3 0.35
36 d1im5a_ Pyrazinamidase/​nicotinamidase Isochorismatase-​like hydrolases Isochorismatase-​like hydrolases α/β 1.05 0.715 0.05 2.8 3.0 0.24
37 d1g4us2 SptP tyrosine phosphatase,​ catalytic domain (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.03 0.619 0.16 1.7 2.2 0.41
38 d1lw3a2 Myotubularin-​related protein 2,​ C-​terminal domain (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 1.02 1.395 0.02 1.6 1.9 0.46
39 d1dd9a_ DNA primase DnaG catalytic core DNA primase core DNA primase core multi 1.01 0.621 0.03 3.1 2.3 0.30
40 d1t6ca2 Exopolyphosphatase Ppx Actin-​like ATPase domain Ribonuclease H-​like motif α/β 1.00 0.711 0.01 1.3 2.6 0.38
41 d1mnaa_ Picromycin polyketide synthase alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.97 0.995 0.08 2.4 2.4 0.46
42 d1gkub3 Topoisomerase ​(​domain​(​ of reverse gyrase Prokaryotic type I DNA topoisomerase Prokaryotic type I DNA topoisomerase multi 0.96 0.622 0.01 3.5 1.6 0.48
43 d8abpa_ L-​arabinose-​binding protein Periplasmic binding protein-​like I Periplasmic binding protein-​like I α/β 0.95 0.730 0.04 3.5 2.8 0.44
44 d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC MurD-​like peptide ligases,​ peptide-​binding domain MurD-​like peptide ligases,​ peptide-​binding domain α/β 0.95 0.989 0.02 2.2 2.1 0.40
45 d1lyva_ Protein-​tyrosine phosphatase YopH,​ catalytic domain (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 0.92 0.618 0.11 1.4 2.1 0.43
46 d2shpa1 Tyrosine phosphatase (Phosphotyrosine protein) phosphatases II (Phosphotyrosine protein) phosphatases II α/β 0.86 0.903 0.13 1.6 1.9 0.29
47 d1vdra_ Dihydrofolate reductase,​ prokaryotic type Dihydrofolate reductases Dihydrofolate reductases α/β 0.81 0.622 0.01 0.8 1.8 0.37
48 d1t64a_ Histone deacetylase 8,​ HDAC8 Arginase/​deacetylase Arginase/​deacetylase α/β 0.80 0.622 0.01 1.3 1.8 0.49
49 d1rjda_ Leucine carboxy methyltransferase Ppm1 S-​adenosyl-​L-​methionine-​dependent methyltransferases S-​adenosyl-​L-​methionine-​dependent methyltransferases α/β 0.78 0.618 0.01 1.3 2.1 0.44
50 d1d4oa_ Transhydrogenase domain III (dIII) DHS-​like NAD/​FAD-​binding domain DHS-​like NAD/​FAD-​binding domain α/β 0.72 0.640 0.05 2.0 1.2 0.45
51 d1qj4a_ Hydroxynitrile lyase alpha/​beta-​Hydrolases alpha/​beta-​Hydrolases α/β 0.69 0.620 0.04 2.0 1.4 0.39
52 d1qx4a2 cytochrome b5 reductase Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 0.69 0.666 0.02 1.2 2.2 0.32
53 d1mw9x_ DNA topoisomerase I,​ 67K N-​terminal domain Prokaryotic type I DNA topoisomerase Prokaryotic type I DNA topoisomerase multi 0.63 0.621 0.01 3.1 1.3 0.27
54 d4cd2a_ Dihydrofolate reductases,​ eukaryotic type Dihydrofolate reductases Dihydrofolate reductases α/β 0.58 0.618 0.01 0.8 1.7 0.34
55 d1t5ba_ ACP phosphodiesterase AcpD Flavoproteins Flavodoxin-​like α/β 0.44 0.735 0.01 1.6 2.3 0.38
56 d1i7da_ DNA topoisomerase III Prokaryotic type I DNA topoisomerase Prokaryotic type I DNA topoisomerase multi 0.33 0.620 0.01 2.8 0.5 0.26
57 d1ne7a_ Glucosamine 6-​phosphate deaminase/​isomerase NagB NagB/​RpiA/​CoA transferase-​like NagB/​RpiA/​CoA transferase-​like α/β 0.29 0.865 0.01 0.8 1.0 0.33
SCOP domains with score worse than the threshold
58 d1puja_ Probable GTPase YlqF P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.71 -1.039 0.04 3.5 2.6 0.33
59 d1g2qa_ Adenine PRTase PRTase-​like PRTase-​like α/β 1.67 0.457 0.01 3.2 3.1 0.46
60 d1bzya_ Hypoxanthine-​guanine PRTase (HGPRTase) PRTase-​like PRTase-​like α/β 1.63 0.516 0.01 3.6 3.2 0.49
61 d1qz5a1 Actin Actin-​like ATPase domain Ribonuclease H-​like motif α/β 1.60 -1.424 0.01 2.6 3.3 0.28
62 d1fsga_ Hypoxanthine-​guanine-​xanthine PRTase PRTase-​like PRTase-​like α/β 1.60 0.448 0.01 3.2 3.0 0.52
63 d1lu9a2 Methylene-​tetrahydromethanopterin dehydrogenase Aminoacid dehydrogenase-​like,​ N-​terminal domain Aminoacid dehydrogenase-​like,​ N-​terminal domain α/β 1.56 -1.692 0.01 3.8 3.7 0.39
64 d1cqxa3 Flavohemoglobin,​ C-​terminal domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain α/β 1.55 0.571 0.04 3.2 2.7 0.42
65 d1qb7a_ Adenine PRTase PRTase-​like PRTase-​like α/β 1.54 -1.150 0.01 2.8 2.8 0.47
66 d1a1va1 HCV helicase domain P-​loop containing nucleoside triphosphate hydrolases P-​loop containing nucleoside triphosphate hydrolases α/β 1.53 -1.478 0.03 2.5 3.2 0.43
67 d1tc1a_ Hypoxanthine PRTase PRTase-​like PRTase-​like α/β 1.49 0.564 0.01 3.7 2.7 0.48


Alignments and Scores

hit structures.    
residues per line.
   
all residues in one line.


hit structures. 
top
1: d1rhsa2 Rhodanese (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.77  Contact: 1083
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.24 AHM:0.26 LBcontacta:1.00 LBcontactb:0.99 LHM:0.08
id:1.00 blosum:0.62 compass:0.81 pearson:1.00
Scaled scores:
dali:0.83 daliz:0.65 gdtts:0.73 tmscore:0.81 rmsd:0.86 AHM:0.79 LBcontacta:0.56 LBcontactb:0.76 LHM:0.59
id:0.10 blosum:0.13 compass:0.26 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 13.2 Raw score:817.50)
Query          1 npneAYRHymKKLSYETDIADLSIDIKkgYEGIIVVDVRDAEAYKE------------CH     48
d1rhsa2        1 --aiFKAT--LNRSLLKTYEQVLENLE--SKRFQLVDSRAQGRYLGtqpepdavgldsGH     54

Query         49 IPTAISIPGNKI------------NEDTTK--RLSKEKVIITYCWGpaCNGATKAAAKFA     94
d1rhsa2       55 IRGSVNMPFMNFltedgfekspeeLRAMFEakKVDLTKPLIATCRK--GVTACHIALAAY    112

Query         95 QLGF-RVKELIGGIEYWRKENG--EVEGTLGAkadlfwnmkkesle    137
d1rhsa2      113 LCGKpDVAIYDGSWFEWFHRAPpeTWVSQGKG--------------    144


hit structure      alignment
FAST alignment (Normalized score: 11.17 Raw score:1568.00)
Query          1 NPNEAYRHYMK-------KLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYK--------     45
d1rhsa2        1 -----------AIFKATLNRSLLKTYEQVLENLES--KRFQLVDSRAQGRY-LGTQPEPD     46

Query         46 -----ECHIPTAISIPGNKI--------------NEDTT--KRLSKEKVIITYCWGP-AC     83
d1rhsa2       47 AVGLDSGHIRGSVNMPFM--NFLTEDGFEKSPEELRAMFEAKKVDLTKPLIATC---RKG    101

Query         84 NGATKAAAKFAQLG-FRVKELIGGIEYWRKENG-----EVEGTLGAKADLFWNMKKESLE    137
d1rhsa2      102 VTACHIALAAYLCGKPDVAIYDGSWFEWFH---RAPPETWVSQGK---------------    143

Query        138 -    138
d1rhsa2      144 G    144


hit structure      alignment
TMalign alignment (TM-score: 0.72 Raw score:98.61)
Query          1 ---NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKE-----------     46
d1rhsa2        1 AIF---KA--TL-N-RSLLKTYEQVLENLE-SK-RFQLVDSRAQGRYLGTQPEPDAVGLD     51

Query         47 -CHIPTAISIPGNKI------------NEDTTK--RLSKEKVIITYCWGPACNGATKAAA     91
d1rhsa2       52 SGHIRGSVNMPFMNFLTEDGFEKSPEELRAMFEAKKVDLTKPLIATCRK--GVTACHIAL    109

Query         92 KFAQLGF-RVKELIGGIEYWRKENG--EVEGTLGAKADLFWNMKKESLE    137
d1rhsa2      110 AAYLCGKPDVAIYDGSWFEWFHRAPPETWVSQGK-G-------------    144


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ***********.  **************              **************    
Query         17 TDIADLSIDIKKGYEGIIVVDVRDAEAY------------KECHIPTAISIPGNKINEDT     64
d1rhsa2       13 KTYEQVLENLES--KRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNMPFMNFLTED     70

DALI match                      .**************.   ************** ***********
Query         65 T--------------KRLSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGIEY    109
d1rhsa2       71 GFEKSPEELRAMFEAKKVDLTKPLIATCRKGV--TACHIALAAYLCGKPDVAIYDGSWFE    128

DALI match       *****   ........
Query        110 WRKEN---GEVEGTLG    122
d1rhsa2      129 WFHRAPPETWVSQGKG    144



top
2: d1rhsa1 Rhodanese (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.77  Contact: 1052
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.27 AHM:0.33 LBcontacta:1.00 LBcontactb:0.99 LHM:0.12
id:1.00 blosum:0.99 compass:0.87 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.63 gdtts:0.72 tmscore:0.80 rmsd:0.83 AHM:0.72 LBcontacta:0.58 LBcontactb:0.76 LHM:0.51
id:0.17 blosum:0.24 compass:0.29 pearson:0.38

hit structure      alignment
DALI alignment (Z-score: 12.9 Raw score:817.80)
Query          1 npneayrhYMKKlSYETDIADLSIDIKKGYE--GIIVVDVR--------DAEAYKECHIP     50
d1rhsa1        1 ------vhQVLY-RALVSTKWLAESVRAGKVgpGLRVLDASwyspgtreARKEYLERHVP     53

Query         51 TAISIPGNKI----------------NEDTTKR--LSKEKVIITYCWGPA-CNGATKAAA     91
d1rhsa1       54 GASFFDIEECrdkaspyevmlpseagFADYVGSlgISNDTHVVVYDGDDLgSFYAPRVWW    113

Query         92 KFAQLGF-RVKELIGGIEYWRKENGEVEGTlgakadlfwnmkkesle    137
d1rhsa1      114 MFRVFGHrTVSVLNGGFRNWLKEGHPVTSE-----------psrpep    149


hit structure      alignment
FAST alignment (Normalized score: 11.35 Raw score:1621.00)
Query          1 NPNEAYRHYMKKL------SYETDIADLSIDIKKG--YEGIIVVDVR---------DAEA     43
d1rhsa1        1 -------------VHQVLYRALVSTKWLAESVRAGKVGPGLRVLDA-SWYSPGTREARKE     46

Query         44 YKECHIPTAISIPGNKI-----------------NEDTTKR--LSKEKVIITYCWGP---     81
d1rhsa1       47 YLERHVPGASFFDIEE-CRDKASPYEVMLPSEAGFADYVGSLGISNDTHVVVYDG--DDL    103

Query         82 ACNGATKAAAKFAQLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE---    137
d1rhsa1      104 GSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPV--------------------TSE    143

Query        138 ------    138
d1rhsa1      144 PSRPEP    149


hit structure      alignment
TMalign alignment (TM-score: 0.70 Raw score:95.73)
Query          1 ---NPNEAYRHYMKKLSYETDIADLSIDIKKGY-E-GIIVVDVR--------DAEAYKEC     47
d1rhsa1        1 VHQ---------VL-YRALVSTKWLAESVRAGKVGPGLRVLDASWYSPGTREARKEYLER     50

Query         48 HIPTAISIPGNKI----------------NEDTTKR--LSKEKVIITYCWG-PACNGATK     88
d1rhsa1       51 HVPGASFFDIEECRDKASPYEVMLPSEAGFADYVGSLGISNDTHVVVYDGDDLGSFYAPR    110

Query         89 AAAKFAQLGF-RVKELIGGIEYWRKENGEVEGT------LGAKADLFWNMKKESLE    137
d1rhsa1      111 VWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP-----------------    149


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       *************  ..********        *********************      
Query         17 TDIADLSIDIKKG--YEGIIVVDVR--------DAEAYKECHIPTAISIPGNKI------     60
d1rhsa1       10 VSTKWLAESVRAGKVGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDKASP     69

DALI match                   .......***************. *************** ********
Query         61 ------------NEDTTKRLSKEKVIITYCWGPAC-NGATKAAAKFAQLGF-RVKELIGG    106
d1rhsa1       70 YEVMLPSEAGFADYVGSLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGG    129

DALI match       **************    
Query        107 IEYWRKENGEVEGTLGAK    124
d1rhsa1      130 FRNWLKEGHPVTSEPSRP    147



top
3: d1e0ca2 Sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.77  Contact: 1127
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.33 LBcontacta:1.00 LBcontactb:0.99 LHM:0.10
id:1.00 blosum:0.99 compass:0.87 pearson:1.00
Scaled scores:
dali:0.84 daliz:0.68 gdtts:0.64 tmscore:0.75 rmsd:0.83 AHM:0.75 LBcontacta:0.61 LBcontactb:0.79 LHM:0.56
id:0.16 blosum:0.24 compass:0.31 pearson:0.35

hit structure      alignment
DALI alignment (Z-score: 13.8 Raw score:824.20)
Query          1 -NPNEayRHYMkkLSYETDIADLSIDIkkGYEGIIVVDVRDAEAYKE--------CHIPT     51
d1e0ca2        1 gGPVA--LSLH--DEPTASRDYLLGRL--GAADLAIWDARSPQEYRGekvlaakgGHIPG     54

Query         52 AISIPGNKI------------NEDTTKR--LSKEKVIITYCWGpaCNGATKAAAKFAQLG     97
d1e0ca2       55 AVNFEWTAAmdpsralrirtdIAGRLEElgITPDKEIVTHCQT--HHRSGLTYLIAKALG    112

Query         98 F-RVKELIGGIEYWRKE-NGEVEGtlgakadlfwnmkkesle    137
d1e0ca2      113 YpRVKGYAGSWGEWGNHpDTPVEL------------------    136


hit structure      alignment
FAST alignment (Normalized score: 11.22 Raw score:1531.00)
Query          1 NPNEAYRHYMK--------KLSYETDIADLSIDIK-KGYEGIIVVDVRDAEAYK------     45
d1e0ca2        1 -----------GGPVALSLHDEPTASRDYLLG---RLGAADLAIWDARSPQEY-RGEKVL     45

Query         46 ---ECHIPTAISIPGNKI-------------NEDTTK--RLSKEKVIITYCWGPA--CNG     85
d1e0ca2       46 AAKGGHIPGAVNFEWTA-AMDPSRALRIRTDIAGRLEELGITPDKEIVTHC----QTHHR    100

Query         86 ATKAAAKFAQLGF-RVKELIGGIEYWRKE-NGEVEGTLGAKADLFWNMKKESLE--    137
d1e0ca2      101 SGLTYLIAKALGYPRVKGYAGSWGEWGNHPDTPV--------------------EL    136


hit structure      alignment
TMalign alignment (TM-score: 0.70 Raw score:95.59)
Query          1 ----NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKE--------CH     48
d1e0ca2        1 GGPV---AL--SL--HDEPTASRDYLLGRL--GAADLAIWDARSPQEYRGEKVLAAKGGH     51

Query         49 IPTAISIPGNKI------------NEDTTKR--LSKEKVIITYCWGPACNGATKAAAKFA     94
d1e0ca2       52 IPGAVNFEWTAAMDPSRALRIRTDIAGRLEELGITPDKEIVTHCQT--HHRSGLTYLIAK    109

Query         95 QLGF-RVKELIGGIEYWRKEN-GEVEGTLGAKADLFWNMKKESLE    137
d1e0ca2      110 ALGYPRVKGYAGSWGEWGNHPDTPVEL------------------    136


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **********.   ***************         **************        
Query         17 TDIADLSIDIKKGYEGIIVVDVRDAEAYK--------ECHIPTAISIPGNKINEDTTKRL     68
d1e0ca2       14 ASRDYLLGRLGA--ADLAIWDARSPQEYRGEKVLAAKGGHIPGAVNFEWTAAMDPSRALR     71

DALI match                      ***********.   ************** ************ ..
Query         69 S--------------KEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGIEYW-RK    112
d1e0ca2       72 IRTDIAGRLEELGITPDKEIVTHCQTHH--RSGLTYLIAKALGYPRVKGYAGSWGEWGNH    129

DALI match       .*****
Query        113 ENGEVE    118
d1e0ca2      130 PDTPVE    135



top
4: d1uara1 Sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.74  Contact: 958
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.20 AHM:0.25 LBcontacta:1.00 LBcontactb:0.99 LHM:0.10
id:1.00 blosum:0.88 compass:0.85 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.63 gdtts:0.76 tmscore:0.82 rmsd:0.87 AHM:0.78 LBcontacta:0.58 LBcontactb:0.76 LHM:0.54
id:0.13 blosum:0.17 compass:0.27 pearson:0.36

hit structure      alignment
DALI alignment (Z-score: 12.6 Raw score:782.70)
Query          1 npneayrhYMKKLSYETDIADLSIDIkkGYEGIIVVDVR-DAEAYKECHIPTAISIPGNK     59
d1uara1        1 --------GYAHPEVLVSTDWVQEHL--EDPKVRVLEVDeDILLYDTGHIPGAQKIDWQR     50

Query         60 I--------------NEDTTKR--LSKEKVIITYCWGPaCNGATKAAAKFAQLGF-RVKE    102
d1uara1       51 DfwdpvvrdfiseeeFAKLMERlgISNDTTVVLYGDKN-NWWAAYAFWFFKYNGHkDVRL    109

Query        103 LIGGIEYWRKENGEVEGtlgakadlfwnmkkesle    137
d1uara1      110 MNGGRQKWVEEGRPLTT-evpsyppgryevpyrde    143


hit structure      alignment
FAST alignment (Normalized score: 10.93 Raw score:1530.00)
Query          1 NPNEAYRHYM--KKLSYETDIADLSIDIKKGYEGIIVVDVR-DAEAYKECHIPTAISIPG     57
d1uara1        1 ----------GYAHPEVLVSTDWVQEHL--EDPKVRVLEVDEDILLYDTGHIPGAQKIDW     48

Query         58 NKI---------------NEDTTKR--LSKEKVIITYCWGP-ACNGATKAAAKFAQLGF-     98
d1uara1       49 QR-DFWDPVVRDFISEEEFAKLMERLGISNDTTVVLYGD--KNNWWAAYAFWFFKYNGHK    105

Query         99 RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-------------------    137
d1uara1      106 DVRLMNGGRQKWVEEGRPL--------------------TTEVPSYPPGRYEVPYRDE    143


hit structure      alignment
TMalign alignment (TM-score: 0.70 Raw score:95.31)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVR-DAEAYKECHIPTAISIPGN-     58
d1uara1        1 -------GY-AHPEVLVSTDWVQEHL--EDPKVRVLEVDEDILLYDTGHIPGAQKIDWQR     50

Query         59 KI--------N----E-DTTKR--LSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKE    102
d1uara1       51 DFWDPVVRDFISEEEFAKLMERLGISNDTTVVLYGDKN-NWWAAYAFWFFKYNGHKDVRL    109

Query        103 LIGGIEYWRKENGEVEGT----------------LGAKADLFWNMKKESLE    137
d1uara1      110 MNGGRQKWVEEGRPLTTEVPSYPPGRYEVPYRDE-----------------    143


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **********.   *********.. *******************               
Query         17 TDIADLSIDIKKGYEGIIVVDVRDA-EAYKECHIPTAISIPGNKINEDTTK---------     66
d1uara1        9 VSTDWVQEHLED--PKVRVLEVDEDILLYDTGHIPGAQKIDWQRDFWDPVVRDFISEEEF     66

DALI match              .**************. ***************. *******************
Query         67 -------RLSKEKVIITYCWGPACNGATKAAAKFAQLGFR-VKELIGGIEYWRKENGEVE    118
d1uara1       67 AKLMERLGISNDTTVVLYGDKNN-WWAAYAFWFFKYNGHKDVRLMNGGRQKWVEEGRPLT    125

DALI match       *             
Query        119 GTLGAKADLFWNMK    132
d1uara1      126 TEVPSYPPGRYEVP    139



top
5: d1urha1 3-​mercaptopyruvate sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.74  Contact: 969
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.18 AHM:0.25 LBcontacta:1.00 LBcontactb:0.99 LHM:0.14
id:1.00 blosum:0.99 compass:0.89 pearson:1.00
Scaled scores:
dali:0.84 daliz:0.67 gdtts:0.81 tmscore:0.86 rmsd:0.89 AHM:0.77 LBcontacta:0.62 LBcontactb:0.75 LHM:0.45
id:0.17 blosum:0.25 compass:0.31 pearson:0.41

hit structure      alignment
DALI alignment (Z-score: 12.9 Raw score:791.20)
Query          1 npneayrhymkkLSYETDIADLSIDIkkGYEGIIVVDVR----------DAEAYKECHIP     50
d1urha1        1 ------------TTWFVGADWLAEHI--DDPEIQIIDARmaspgqedrnVAQEYLNGHIP     46

Query         51 TAISIPGNKI----------------NEDTTK--RLSKEKVIITYCWGPaCNGATKAAAK     92
d1urha1       47 GAVFFDIEALsdhtsplphmlprpetFAVAMRelGVNQDKHLIVYDEGN-LFSAPRAWWM    105

Query         93 FAQLGF-RVKELIGGIEYWRKENGEVEGTlgakadlfwnmkkesle    137
d1urha1      106 LRTFGVeKVSILGGGLAGWQRDDLLLEEG----avelpegefnaaf    147


hit structure      alignment
FAST alignment (Normalized score: 11.41 Raw score:1619.00)
Query          1 NPNEAYRHYMKKL-SYETDIADLSIDIKKGYEGIIVVDVR-----------DAEAYKECH     48
d1urha1        1 -------------TTWFVGADWLAEHI--DDPEIQIIDA-RMASPGQEDRNVAQEYLNGH     44

Query         49 IPTAISIPGNKI-----------------NEDTT--KRLSKEKVIITYCWGPACNGATKA     89
d1urha1       45 IPGAVFFDIEA-LSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDE-GNLFSAPRA    102

Query         90 AAKFAQLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----------    137
d1urha1      103 WWMLRTFGVEKVSILGGGLAGWQRDDLLLE-------------------EGAVELPEGEF    143

Query        138 ----    138
d1urha1      144 NAAF    147


hit structure      alignment
TMalign alignment (TM-score: 0.70 Raw score:95.55)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVR----------DAEAYKECHIP     50
d1urha1        1 ----------TT--WFVGADWLAEHI--DDPEIQIIDARMASPGQEDRNVAQEYLNGHIP     46

Query         51 TAISIPGNKI----------------NEDTTK--RLSKEKVIITYCWGPACNGATKAAAK     92
d1urha1       47 GAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEG-NLFSAPRAWWM    105

Query         93 FAQLGF-RVKELIGGIEYWRKENGEVEGT-------------LGAKADLFWNMKKESLE    137
d1urha1      106 LRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAF-----------------    147


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **********.   *********          *********************      
Query         17 TDIADLSIDIKKGYEGIIVVDVR----------DAEAYKECHIPTAISIPGNKINEDTTK     66
d1urha1        5 VGADWLAEHIDD--PEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSP     62

DALI match                         ***************. *************** *********
Query         67 ------------------RLSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGI    107
d1urha1       63 LPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNL-FSAPRAWWMLRTFGVEKVSILGGGL    121

DALI match       *************          
Query        108 EYWRKENGEVEGTLGAKADLFWN    130
d1urha1      122 AGWQRDDLLLEEGAVELPEGEFN    144



hit structures. 
top
6: d1e0ca1 Sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.78  Contact: 1014
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.21 AHM:0.30 LBcontacta:1.00 LBcontactb:0.99 LHM:0.15
id:1.00 blosum:0.99 compass:0.92 pearson:1.00
Scaled scores:
dali:0.81 daliz:0.63 gdtts:0.77 tmscore:0.82 rmsd:0.86 AHM:0.74 LBcontacta:0.58 LBcontactb:0.75 LHM:0.46
id:0.19 blosum:0.24 compass:0.35 pearson:0.43

hit structure      alignment
DALI alignment (Z-score: 12.9 Raw score:767.20)
Query          1 npneayrhymkkLSYETDIADLSIDIkkGYEGIIVVDVRDAEAYKECHIPTAISIPGNKI     60
d1e0ca1        1 ------mddfasLPLVIEPADLQARL--SAPELILVDLTSAARYAEGHIPGARFVDPKRT     52

Query         61 ----------------NEDTTK--RLSKEKVIITYCWGPaCNGATKAAAKFAQLGF-RVK    101
d1e0ca1       53 qlgqppapglqppreqLESLFGelGHRPEAVYVVYDDEG-GGWAGRFIWLLDVIGQqRYH    111

Query        102 ELIGGIEYWRKENGEVEGTlgakadlfwnmkkesle    137
d1e0ca1      112 YLNGGLTAWLAEDRPLSRE------------lpapa    135


hit structure      alignment
FAST alignment (Normalized score: 11.21 Raw score:1524.00)
Query          1 NPNEAYRHYMKK------LSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAIS     54
d1e0ca1        1 ------------MDDFASLPLVIEPADLQARL--SAPELILVDLTSAARYAEGHIPGARF     46

Query         55 IPGNKI-----------------NEDTTKRLS--KEKVIITYCWGP-ACNGATKAAAKFA     94
d1e0ca1       47 VDPKR-TQLGQPPAPGLQPPREQLESLFGELGHRPEAVYVVYDD--EGGGWAGRFIWLLD    103

Query         95 QLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE--------    137
d1e0ca1      104 VIGQQRYHYLNGGLTAWLAEDRPL--------------------SRELPAPA    135


hit structure      alignment
TMalign alignment (TM-score: 0.67 Raw score:92.22)
Query          1 ------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAIS     54
d1e0ca1        1 MDDFAS------------LPLVIEPADLQARL--SAPELILVDLTSAARYAEGHIPGARF     46

Query         55 IPGNKI----------------NEDTTK--RLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1e0ca1       47 VDPKRTQLGQPPAPGLQPPREQLESLFGELGHRPEAVYVVYDDEG-GGWAGRFIWLLDVI    105

Query         97 GF-RVKELIGGIEYWRKENGEVEGT-----LGAKADLFWNMKKESLE    137
d1e0ca1      106 GQQRYHYLNGGLTAWLAEDRPLSRELPAPA-----------------    135


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **********.   ******************************                
Query         17 TDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKI----------------     60
d1e0ca1       11 IEPADLQARLSA--PELILVDLTSAARYAEGHIPGARFVDPKRTQLGQPPAPGLQPPREQ     68

DALI match         ......***************. *************** *******************
Query         61 --NEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEV    117
d1e0ca1       69 LESLFGELGHRPEAVYVVYDDEGG-GWAGRFIWLLDVIGQQRYHYLNGGLTAWLAEDRPL    127

DALI match       ***     
Query        118 EGTLGAKA    125
d1e0ca1      128 SRELPAPA    135



top
7: d1gmxa_ Sulfurtransferase GlpE (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.85  Contact: 1007
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.22 AHM:0.25 LBcontacta:1.00 LBcontactb:0.99 LHM:0.10
id:1.00 blosum:1.00 compass:0.94 pearson:1.00
Scaled scores:
dali:0.82 daliz:0.64 gdtts:0.77 tmscore:0.81 rmsd:0.86 AHM:0.77 LBcontacta:0.57 LBcontactb:0.76 LHM:0.55
id:0.18 blosum:0.29 compass:0.36 pearson:0.41

hit structure      alignment
DALI alignment (Z-score: 13.4 Raw score:712.00)
Query          1 npneayrhymkklsYETDIADLSIDIKkgYEGIIVVDVRDAEAYKECHIPTAISIPgNKI     60
d1gmxa_        1 ----------mdqfECINVADAHQKLQ--EKEAVLVDIRDPQSFAMGHAVQAFHLT-NDT     47

Query         61 NEDTTKRLSKEKVIITYCWGpacNGATKAAAKFAQLGF-RVKELIGGIEYWRKENG-EVE    118
d1gmxa_       48 LGAFMRDNDFDTPVMVMCYH--gNSSKGAAQYLLQQGYdVVYSIDGGFEAWQRQFPaEVA    105

Query        119 GTlgakadlfwnmkkesle    137
d1gmxa_      106 YG----------------a    108


hit structure      alignment
FAST alignment (Normalized score: 11.37 Raw score:1383.00)
Query          1 NPNEAYRHYMKKLS----YETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIP     56
d1gmxa_        1 --------------MDQFECINVADAHQKLQE--KEAVLVDIRDPQSFAMGHAVQAFHLT     44

Query         57 GNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLG-FRVKELIGGIEYWRKENG    115
d1gmxa_       45 NDT-LGAFMRDNDFDTPVMVMCYHG--NSSKGAAQYLLQQGYDVVYSIDGGFEAWQR---     98

Query        116 EVEGTLGAKADLFWNMKKESLE----------    137
d1gmxa_       99 ----------------------QFPAEVAYGA    108


hit structure      alignment
TMalign alignment (TM-score: 0.65 Raw score:88.83)
Query          1 --NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGN     58
d1gmxa_        1 MD-----------Q-FECINVADAHQKL--QEKEAVLVDIRDPQSFAMGHAVQAFHLT--     44

Query         59 KINEDT-TKRLSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENG-    115
d1gmxa_       45 NDTLGAFMRDNDFDTPVMVMCYHG--NSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPA    102

Query        116 EVEGT-LGAKADLFWNMKKESLE    137
d1gmxa_      103 EVAYGA-----------------    108


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ************.  **************************.... **************
Query         16 ETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKEKVII     75
d1gmxa_        6 CINVADAHQKLQE--KEAVLVDIRDPQSFAMGHAVQAFHLTNDTL-GAFMRDNDFDTPVM     62

DALI match       *****   ***************. ************** ......   
Query         76 TYCWGPACNGATKAAAKFAQLGFR-VKELIGGIEYWRKENGEVEGTLGA    123
d1gmxa_       63 VMCYHG--NSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQ-FPAEVAYGA    108



top
8: d1uara2 Sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.75  Contact: 1106
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.19 AHM:0.21 LBcontacta:1.00 LBcontactb:0.99 LHM:0.12
id:1.00 blosum:0.99 compass:0.86 pearson:1.00
Scaled scores:
dali:0.83 daliz:0.66 gdtts:0.78 tmscore:0.84 rmsd:0.88 AHM:0.81 LBcontacta:0.64 LBcontactb:0.78 LHM:0.50
id:0.20 blosum:0.26 compass:0.30 pearson:0.38

hit structure      alignment
DALI alignment (Z-score: 12.9 Raw score:776.40)
Query          1 npneayrhymkkLSYETDIADLSIDIK-kGYEGIIVVDVRDAEAYKE--------CHIPT     51
d1uara2        1 ------------ESIRAYRDDVLEHIIkvKEGKGALVDVRSPQEYRGelegalraGHIPG     48

Query         52 AISIPGNKI------------NEDTTKR--LSKEKVIITYCWGpaCNGATKAAAKFA-QL     96
d1uara2       49 AKNIPWAKAvnpdgtfksaeeLRALYEPlgITKDKDIVVYCRI--AERSSHSWFVLKyLL    106

Query         97 GF-RVKELIGGIEYWRKEN-GEVEGTlgakadlfwnmkkesle    137
d1uara2      107 GYpHVKNYDGSWTEWGNLVgVPIAKG---------------ee    134


hit structure      alignment
FAST alignment (Normalized score: 10.80 Raw score:1464.00)
Query          1 NPNEAYRHYMKKL-SYETDIADLSIDIKK--GYEGIIVVDVRDAEAYK---------ECH     48
d1uara2        1 -------------ESIRAYRDDVLEHII-KVKEGKGALVDVRSPQEY-RGELEGALRAGH     45

Query         49 IPTAISIPGNKI--------------NEDTTK--RLSKEKVIITYCWGPACNGATKAAAK     92
d1uara2       46 IPGAKNIPWA--KAVNPDGTFKSAEELRALYEPLGITKDKDIVVYCRIA--ERSSHSWFV    101

Query         93 F-AQLGF-RVKELIGGIEYWRK-ENGEVEGTLGAKADLFWNMKKESLE----    137
d1uara2      102 LKYLLGYPHVKNYDGSWTEWGNLVGVPIA-------------------KGEE    134


hit structure      alignment
TMalign alignment (TM-score: 0.68 Raw score:93.27)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGY---EGIIVVDVRDAEAYKE--------CHI     49
d1uara2        1 ------------ESIRAYRDDVLEHI--IKVKEGKGALVDVRSPQEYRGELEGALRAGHI     46

Query         50 PTAISIPGNKI------------NEDTTKR--LSKEKVIITYCWGPACNGATKAAAKFA-     94
d1uara2       47 PGAKNIPWAKAVNPDGTFKSAEELRALYEPLGITKDKDIVVYCRI--AERSSHSWFVLKY    104

Query         95 QLGFR-VKELIGGIEYWRKEN-GEVEGT--LGAKADLFWNMKKESLE    137
d1uara2      105 LLGYPHVKNYDGSWTEWGNLVGVPIAKGEE-----------------    134


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ********  *****************         **************          
Query         20 ADLSIDIKK-GYEGIIVVDVRDAEAYK--------ECHIPTAISIPGNKI----------     60
d1uara2        8 DDVLEHIIKVKEGKGALVDVRSPQEYRGELEGALRAGHIPGAKNIPWAKAVNPDGTFKSA     67

DALI match           .......*************.  ***********. *** ************** .
Query         61 ----NEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQ-LGF-RVKELIGGIEYWRK-E    113
d1uara2       68 EELRALYEPLGITKDKDIVVYCRIA--ERSSHSWFVLKYLLGYPHVKNYDGSWTEWGNLV    125

DALI match       .****** 
Query        114 NGEVEGTL    121
d1uara2      126 GVPIAKGE    133



top
9: d1okga1 3-​mercaptopyruvate sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.72  Contact: 967
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.23 AHM:0.27 LBcontacta:1.00 LBcontactb:0.99 LHM:0.15
id:1.00 blosum:0.93 compass:0.94 pearson:1.00
Scaled scores:
dali:0.80 daliz:0.59 gdtts:0.72 tmscore:0.78 rmsd:0.84 AHM:0.76 LBcontacta:0.55 LBcontactb:0.75 LHM:0.45
id:0.11 blosum:0.18 compass:0.38 pearson:0.38

hit structure      alignment
DALI alignment (Z-score: 10.8 Raw score:714.60)
Query          1 npneayrhymkKLSYETDIADLSIDIkkgyEGIIVVDVR--------DAEAYKECHIPTA     52
d1okga1        1 -------apkhPGKVFLDPSEVADHL----AEYRIVDCRyslkikdhGSIQYAKEHVKSA     49

Query         53 ISIPGNKI-------------------NEDTTKR--LSKEKVIITYCWGPACNGATKAAA     91
d1okga1       50 IRADVDTNlsklvptstarhplppxaeFIDWCMAngMAGELPVLCYDDECGAMGGCRLWW    109

Query         92 KFAQLGFRVKELIGGIEYWRKENGEVEGT-lgakadlfwnmkkesle    137
d1okga1      110 MLNSLGADAYVINGGFQACKAAGLEMESGepsslprpathwpfktaf    156


hit structure      alignment
FAST alignment (Normalized score: 9.66 Raw score:1412.00)
Query          1 NPNEAYRHYMKKL------SYETDIADLSIDIKKG-YEGIIVVDVR---------DAEAY     44
d1okga1        1 -------------APKHPGKVFLDPSEVAD-----HLAEYRIVDC-RYSLKIKDHGSIQY     41

Query         45 KECHIPTAISIPGNKI---------------------NEDTTKRL--SKEKVIITYCWGP     81
d1okga1       42 AKEHVKSAIRADVD--TNLSKLVPTSTARHPLPPXAEFIDWCMANGMAGELPVLCYD---     96

Query         82 AC-----NGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESL    136
d1okga1       97 --DECGAMGGCRLWWMLNSLGADAYVINGGFQACKAAGLEME------------------    136

Query        137 E--------------------    137
d1okga1      137 -SGEPSSLPRPATHWPFKTAF    156


hit structure      alignment
TMalign alignment (TM-score: 0.66 Raw score:89.95)
Query          1 ----NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVR--------DAEAYKECH     48
d1okga1        1 APKH---------PG--KVFLDPSEVADHL---AE-YRIVDCRYSLKIKDHGSIQYAKEH     45

Query         49 IPTAISIPGN-KI------------------NEDTTKR-L-SKEKVIITYCWGPACNGAT     87
d1okga1       46 VKSAIRADVDTNLSKLVPTSTARHPLPPXAEFIDWCMANGMAGELPVLCYDDECGAMGGC    105

Query         88 KAAAKFAQLGFRVKELIGGIEYWRKENGEVEGT------------------LGAKADLFW    129
d1okga1      106 RLWWMLNSLGADAYVINGGFQACKAAGLEMESGEPSSLPRPATHWPFKTAF---------    156

Query        130 NMKKESLE    137
d1okga1      157 --------    157


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       **********    *********         ********************        
Query         17 TDIADLSIDIKKGYEGIIVVDVRD--------AEAYKECHIPTAISIPGNKINEDTTKR-     67
d1okga1       10 LDPSEVADHL----AEYRIVDCRYSLKIKDHGSIQYAKEHVKSAIRADVDTNLSKLVPTS     65

DALI match                           ****************************************
Query         68 --------------------LSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGI    107
d1okga1       66 TARHPLPPXAEFIDWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSLGADAYVINGGF    125

DALI match       *************     
Query        108 EYWRKENGEVEGTLGAKA    125
d1okga1      126 QACKAAGLEMESGEPSSL    143



top
10: d1qb0a_ CDC25b (hh: 0.998)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.77  Contact: 1104
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.29 AHM:0.31 LBcontacta:1.00 LBcontactb:0.99 LHM:0.09
id:1.00 blosum:0.91 compass:0.80 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.57 gdtts:0.65 tmscore:0.74 rmsd:0.83 AHM:0.76 LBcontacta:0.49 LBcontactb:0.73 LHM:0.61
id:0.09 blosum:0.18 compass:0.26 pearson:0.25

hit structure      alignment
DALI alignment (Z-score: 11.9 Raw score:831.00)
Query          1 npneayRHYMK-----------------klsYETDIADLSIDIKKGY----EGIIVVDVR     39
d1qb0a_        1 ------DHRELigdyskafllqtvdgkhqdlKYISPETMVALLTGKFsnivDKFVIVDCR     54

Query         40 DAEAYKECHIPTAISIPGN-KINEdTTKR-LSKE------KVIITYCWGpaCNGATKAAA     91
d1qb0a_       55 YPYEYEGGHIKTAVNLPLErDAES-FLLKsPIAPcsldkrVILIFHCEF-sSERGPRMCR    112

Query         92 KFAQLG-----------fRVKELIGGIEYWRKENG-EVEGtlgAKADlFWNMKKESLE--    137
d1qb0a_      113 FIRERDravndypslyypEMYILKGGYKEFFPQHPnFCEP---QDYR-PMNHEAFKDElk    168

Query        138 ---------    138
d1qb0a_      169 tfrlktrsw    177


hit structure      alignment
FAST alignment (Normalized score: 8.06 Raw score:1255.00)
Query          1 NPNEAYRHYMKKLS-------------------------YETDIADLSIDIKKGYE----     31
d1qb0a_        1 --------------DHRELIGDYSKAFLLQTVDGKHQDLKYISPETMVALL-----TGKF     41

Query         32 -----GIIVVDVRDAEAYKECHIPTAISI-PGNKINEDTTKRLSK---------------     70
d1qb0a_       42 SNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDA----------ESFLLKSPIAPCSLD     91

Query         71 -EKVIITYCWGPA---CNGATKAAAKFAQLG-------------FRVKELIGGIEYWRKE    113
d1qb0a_       92 KRVILIFHC----EFSSERGPRMCRFIRE--RDRAVNDYPSLYYPEMYILKGGYKEFFP-    144

Query        114 NGEVEGTL-------GAKADLFW------NMKKESLE--------    137
d1qb0a_      145 --------QHPNFCEPQDYR---PMNHEAFKDELKT-FRLKTRSW    177


hit structure      alignment
TMalign alignment (TM-score: 0.73 Raw score:100.46)
Query          1 NPNEAYRHYMK-----------KL-------SYETDIADLSIDIKKG-Y---EGIIVVDV     38
d1qb0a_        1 -----DH--RELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDC     53

Query         39 RDAEAYKECHIPTAISIPGNKINEDTT-KRLSKE------KVIITYCWGPACNGATKAAA     91
d1qb0a_       54 RYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS-SERGPRMCR    112

Query         92 KFAQLG----------FR-VKELIGGIEYWRKENGE-VEGTLGAKADLFWNMKKESLE--    137
d1qb0a_      113 FIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCE---PQDYR-PMNHEAFKDELK    168

Query        138 ---------    138
d1qb0a_      169 TFRLKTRSW    177


hit structure      alignment
HHsearch alignment (Probability: 0.99 E-value:0.00)
DALI match       ************    ..****************************.... **       
Query         17 TDIADLSIDIKK----GYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTT-------     65
d1qb0a_       28 ISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAP     87

DALI match             ********* . **************            ***************
Query         66 KRLSKEKVIITYCWGPACNGATKAAAKFAQLGF-----------RVKELIGGIEYWRKE    113
d1qb0a_       88 CSLDKRVILIFHCEFSS-ERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQ    145



hit structures. 
top
11: d1qxna_ Polysulfide-​sulfur transferase (sulfide dehydrogenase,​ Sud) (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.69  Contact: 928
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:0.91 tmscore:0.97 rmsd:0.62 AHM:0.62 LBcontacta:0.99 LBcontactb:0.99 LHM:0.11
id:1.00 blosum:0.94 compass:0.91 pearson:1.00
Scaled scores:
dali:0.73 daliz:0.45 gdtts:0.32 tmscore:0.39 rmsd:0.64 AHM:0.58 LBcontacta:0.48 LBcontactb:0.66 LHM:0.54
id:0.11 blosum:0.18 compass:0.34 pearson:0.34

hit structure      alignment
DALI alignment (Z-score: 10.4 Raw score:602.30)
Query          1 ------NPNEAYRHYMKKLS--YETDIADLSIDIKkGYEGIIVVDVRDAEAYK-ECHIPT     51
d1qxna_        1 admgekFDATFKAQVKAAKAdmVMLSPKDAYKLLQ-ENPDITLIDVRDPDELKaMGKPDV     59

Query         52 --AISIPgNKINeDTTK--RLSKEKVIITYCwgpaCNGATKAAAKFAQLGF-RVKELIGG    106
d1qxna_       60 knYKHMSrGKLE-PLLAksGLDPEKPVVVFC--ktAARAALAGKTLREYGFkTIYNSEGG    116

Query        107 IEYWRKENGEVEGTLgakadlfwnmkkesle    137
d1qxna_      117 MDKWLEEGLPSLDRS----------hhhhhh    137


hit structure      alignment
FAST alignment (Normalized score: 8.73 Raw score:1196.00)
Query          1 N----PNEAYRHYMKKLS-----YETDIADLSIDIKKGYEGIIVVDVRDAEAYKE-CHI-     49
d1qxna_        1 -ADMGEKFDATFKAQVKAAKADMVMLSPKDAYKLLQ-ENPDITLIDVRDPDELKAMGKPD     58

Query         50 -PTAISIPGNKIN-----EDTTK--RLSKEKVIITYCW--GPACNGATKAAAKFAQLGF-     98
d1qxna_       59 VKNYKHM------SRGKLEPLLAKSGLDPEKPVVV---FCKTAA-RAALAGKTLREYGFK    108

Query         99 RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE--------    137
d1qxna_      109 TIYNSEGGMDKWLEEGLPSLD------------------RSHHHHHH    137


hit structure      alignment
TMalign alignment (TM-score: 0.61 Raw score:83.41)
Query          1 -------------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDA     41
d1qxna_        1 ADMGEKFDATFKAQVKAAK-----------ADMVMLSPKDAYKLLQE-NPDITLIDVRDP     48

Query         42 EAYKE-CHIPT--AISIPGNKINEDTTK--RLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1qxna_       49 DELKAMGKPDVKNYKHMSRGKLE-PLLAKSGLDPEKPVVVFC-K-TAARAALAGKTLREY    105

Query         97 GFR-VKELIGGIEYWRKENGEVEGTLGAK----ADLFWNMKKESLE    137
d1qxna_      106 GFKTIYNSEGGMDKWLEEGLPSLD-RSHHHHHH-------------    137


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       ************.. ***************.   .....***** *** .****.  ***
Query         16 ETDIADLSIDIKKGYEGIIVVDVRDAEAYKE---CHIPTAISIPGNKINEDTTKR--LSK     70
d1qxna_       24 MLSPKDAYKLLQEN-PDITLIDVRDPDELKAMGKPDVKNYKHMSRGKL-EPLLAKSGLDP     81

DALI match       ********  .   **************. **********************
Query         71 EKVIITYCWGPACNGATKAAAKFAQLGFR-VKELIGGIEYWRKENGEVEGTL    121
d1qxna_       82 EKPVVVFCKTAA--RAALAGKTLREYGFKTIYNSEGGMDKWLEEGLPSLDRS    131



top
12: d1urha2 3-​mercaptopyruvate sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.73  Contact: 865
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.27 LBcontacta:0.99 LBcontactb:0.97 LHM:0.15
id:1.00 blosum:0.99 compass:0.82 pearson:1.00
Scaled scores:
dali:0.79 daliz:0.59 gdtts:0.70 tmscore:0.76 rmsd:0.81 AHM:0.73 LBcontacta:0.54 LBcontactb:0.69 LHM:0.40
id:0.18 blosum:0.25 compass:0.26 pearson:0.34

hit structure      alignment
DALI alignment (Z-score: 9.7 Raw score:568.30)
Query          1 npneayrhymkKLSYETDIADLSIDIkkGYEGIIVVDVRDAEAYKE-------CHIPTAI     53
d1urha2        1 -----------NPEAVVKVTDVLLAS--HENTAQIIDARPAARFNAevdelrrGHIPGAL     47

Query         54 SIPGNKI-----------NEDTTKR--LSKEKVIITYCWgpaCNGATKAAAKFAQLGFR-     99
d1urha2       48 NVPWTELvregelkttdeLDAIFFGrgVSYDKPIIVSCG--sGVTAAVVLLALATLDVPn    105

Query        100 VKELIGgieyWRKEngevegtlgakadlfwnmkkesle    137
d1urha2      106 VKLYDG----AWSE------------------------    115


hit structure      alignment
FAST alignment (Normalized score: 9.12 Raw score:1145.00)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYK-------ECHIPTAI     53
d1urha2        1 -----------NPEAVVKVTDVLLASH--ENTAQIIDARPAARFNAEVDELRRGHIPGAL     47

Query         54 SIPGNKI-------------NEDTT--KRLSKEKVIITYCWGPA---CNGATKAAAKFAQ     95
d1urha2       48 NVPWT--ELVREGELKTTDELDAIFFGRGVSYDKPIIVS-----CGSGVTAAVVLLALAT    100

Query         96 LG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE------    137
d1urha2      101 LDVPNVKLY----------------------------------DGAWSE    115


hit structure      alignment
TMalign alignment (TM-score: 0.59 Raw score:80.51)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKE-------CHIPTAI     53
d1urha2        1 -----------NPEAVVKVTDVLLASH-ENT-AQIIDARPAARFNAEVDELRRGHIPGAL     47

Query         54 SIPGNKI-----------NEDTTK--RLSKEKVIITYCWGPACNGATKAAAKFAQLGFR-     99
d1urha2       48 NVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVSCGS--GVTAAVVLLALATLDVPN    105

Query        100 VKELIGGIEYWRKE-NGEVEGTLGAKADLFWNMKKESLE    137
d1urha2      106 VKLYDG---AW--SE------------------------    115


hit structure      alignment
HHsearch alignment (Probability: 0.99 E-value:0.00)
DALI match       **********.   ***************        **************         
Query         17 TDIADLSIDIKKGYEGIIVVDVRDAEAYK-------ECHIPTAISIPGNKINEDTT----     65
d1urha2        6 VKVTDVLLASHE--NTAQIIDARPAARFNAEVDELRRGHIPGALNVPWTELVREGELKTT     63

DALI match                ..************ .   ************** .******. 
Query         66 ---------KRLSKEKVIITYCWGPACNGATKAAAKFAQLGF-RVKELIGGI    107
d1urha2       64 DELDAIFFGRGVSYDKPIIVSCGSGV--TAAVVLLALATLDVPNVKLYDGAW    113



top
13: d1okga2 3-​mercaptopyruvate sulfurtransferase (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.63  Contact: 887
Modified z-scores:
dali:1.00 daliz:1.00 gdtts:1.00 tmscore:1.00 rmsd:0.26 AHM:0.29 LBcontacta:0.99 LBcontactb:0.97 LHM:0.13
id:0.99 blosum:0.89 compass:0.86 pearson:1.00
Scaled scores:
dali:0.77 daliz:0.55 gdtts:0.68 tmscore:0.75 rmsd:0.81 AHM:0.74 LBcontacta:0.52 LBcontactb:0.68 LHM:0.49
id:0.09 blosum:0.17 compass:0.31 pearson:0.30

hit structure      alignment
DALI alignment (Z-score: 9.0 Raw score:563.40)
Query          1 npneayrhymkklSYETDIADLSIDikkgyegIIVVDVRDAEAYKE-----------CHI     49
d1okga2        1 -------------QHHYLVDEIPPQ-------AIITDARSADRFAStvrpyaadkmpGHI     40

Query         50 PTAISIPGNKI---------------NEDTTKR-LSKEK-VIITYCWGpaCNGATKAAAK     92
d1okga2       41 EGARNLPYTSHlvtrgdgkvlrseeeIRHNIMTvVQADLsSFVFSCGS--GVTACINIAL     98

Query         93 FAQL-GFRVKELIGGIEYWRKENGevegtlGAKAdlfwnmkkesle    137
d1okga2       99 VHHLgLGHPYLYCGSWSEYSGLFR----ppIMRS------iiddyg    134


hit structure      alignment
FAST alignment (Normalized score: 7.54 Raw score:1022.00)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE---GIIVVDVRDAEAYK------------     45
d1okga2        1 -------------QHHYLVDE----------IPPQAIITDARSADRF-ASTVRPYAADKM     36

Query         46 ECHIPTAISIPGNKI-----------------NEDTTKR-LSKEK--VIITYCWGPA--C     83
d1okga2       37 PGHIEGARNLPYT--SHLVTRGDGKVLRSEEEIRHNIMTVVQAD-LSSFVFSC----GSG     89

Query         84 NGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----    137
d1okga2       90 VTACINIALVHHLGLGHPYLYCGSWSEYSG-------------------------LFRPP    124

Query        138 ----------    138
d1okga2      125 IMRSIIDDYG    134


hit structure      alignment
TMalign alignment (TM-score: 0.60 Raw score:82.68)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKE-----------CHI     49
d1okga2        1 ------------QH-HYLVDEI--PP--Q---AIITDARSADRFASTVRPYAADKMPGHI     40

Query         50 PTAISIPGNKI---------------NEDTTKR-L-SKEKVIITYCWGPACNGATKAAAK     92
d1okga2       41 EGARNLPYTSHLVTRGDGKVLRSEEEIRHNIMTVVQADLSSFVFSCGS--GVTACINIAL     98

Query         93 FAQL-GFRVKELIGGIEYWRKENG-EVE-GTLGA----KADLFWNMKKESLE    137
d1okga2       99 VHHLGLGHPYLYCGSWSEYSGLFRPPIMR--SIIDDYG--------------    134


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match               *************            **************             
Query         25 DIKKGYEGIIVVDVRDAEAYK-----------ECHIPTAISIPGNKINEDTT--------     65
d1okga2        5 LVDEIPPQAIITDARSADRFASTVRPYAADKMPGHIEGARNLPYTSHLVTRGDGKVLRSE     64

DALI match                .......********.  *************... ************* ..
Query         66 ---------KRLSKEKVIITYCWGPACNGATKAAAKFAQLGFR-VKELIGGIEYWRK-EN    114
d1okga2       65 EEIRHNIMTVVQADLSSFVFSCGSG--VTACINIALVHHLGLGHPYLYCGSWSEYSGLFR    122

DALI match       .      
Query        115 GEVEGTL    121
d1okga2      123 PPIMRSI    129



top
14: d1t3ka_ Dual specificity phosphatase Cdc25 (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.43  Contact: 644
Modified z-scores:
dali:0.99 daliz:0.96 gdtts:0.96 tmscore:0.98 rmsd:0.39 AHM:0.38 LBcontacta:0.93 LBcontactb:0.94 LHM:0.10
id:0.98 blosum:0.76 compass:0.88 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.47 tmscore:0.54 rmsd:0.76 AHM:0.71 LBcontacta:0.37 LBcontactb:0.60 LHM:0.57
id:0.08 blosum:0.14 compass:0.27 pearson:0.28

hit structure      alignment
DALI alignment (Z-score: 4.6 Raw score:337.80)
Query          1 npneayrhYMKKLSYETDIA-DLSIDikkGYEGIIVVDVRDAEAYKEchiPTAISIPgnk     59
d1t3ka_        1 --------MAMARSISYITStQLLPL--hRRPNIAIIDVRDEERNYDghiAGSLHYA-sg     49

Query         60 iNEDTTKRLS----kEKVIITYCWGpaCNGATKAAAKFAQLG---------fRVKELIGG    106
d1t3ka_       50 sFDDKISHLVqnvkdKDTLVFHSAL-sQVRGPTCARRLVNYLdekkedtgikNIMILERG    108

Query        107 IEYwRKENgevegtLGAKadlfwnmkkesle    137
d1t3ka_      109 FNGwEASG-----kPVCR--caevpckgdca    132


hit structure      alignment
FAST alignment (Normalized score: 3.56 Raw score:478.30)
Query          1 NPNEAYRHYMKKLS-------YETDIADLSIDIKKG---YEGIIVVDVRDAEA-YKECHI     49
d1t3ka_        1 --------------MAMARSISYITSTQLLP-----LHRRPNIAIIDVRDEERNYDGH--     39

Query         50 -PTAISIPGNKINEDTTKR----LSKEKVIITYCWGPA---------CNGATKAAAKFAQ     95
d1t3ka_       40 IAGSLHYASGS-FDDKISHLVQNVKDKDTLV-------FHSALSQVRGPTCARRLVNYLD     91

Query         96 LG--------FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE----------    137
d1t3ka_       92 --EKKEDTGIKNIMILERGFN-----------------------------GWEASGKPVC    120

Query        138 ------------    138
d1t3ka_      121 RCAEVPCKGDCA    132


hit structure      alignment
TMalign alignment (TM-score: 0.52 Raw score:70.93)
Query          1 NPNEAYRHYMKKLSYETDIA-DL-SIDIKKGYEGIIVVDVRDA-EAYKECHIPTAISIPG     57
d1t3ka_        1 -----M-AMAR-SISYITSTQLLP-LH--R-RPNIAIIDVRDEERNYDGHIAG-SLHYA-     47

Query         58 NK-INEDTTKRL--SK-E-KVIITYCWGPACNGATKAAAKFA-QL-----GF---RVKEL    103
d1t3ka_       48 -SGSFDDKISHLVQNVKDKDTLVFHSALS-QVRGPTCARRLVNYLDEKKEDTGIKNIMIL    105

Query        104 IGGIEYWRK-ENGEV-EGTLGAK----------ADLFWNMKKESLE    137
d1t3ka_      106 ERGFNG-WEA-SG-KP---VCRCAEVPCKGDCA-------------    132


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match       .....***** .   ****************   *******   ..........   ...
Query         16 ETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLS--KEKV     73
d1t3ka_        9 YITSTQLLPLHRR--PNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKD     66

DALI match       .......  ****                    . ********** ****          
Query         74 IITYCWGPACNGA--------TKAAAKFAQLGFR-VKELIGGIEYWRKENGEVEGTLGAK    124
d1t3ka_       67 TLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVP    126

DALI match         
Query        125 AD    126
d1t3ka_      127 CK    128



top
15: d1tq1a_ Thiosulfate sulfurtransferase/​Senescence-​associated protein (hh: 0.999)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.53  Contact: 547
Modified z-scores:
dali:0.97 daliz:0.94 gdtts:0.93 tmscore:0.95 rmsd:0.35 AHM:0.42 LBcontacta:0.93 LBcontactb:0.91 LHM:0.14
id:1.00 blosum:1.00 compass:0.91 pearson:0.99
Scaled scores:
dali:0.68 daliz:0.32 gdtts:0.47 tmscore:0.47 rmsd:0.76 AHM:0.67 LBcontacta:0.42 LBcontactb:0.58 LHM:0.48
id:0.20 blosum:0.29 compass:0.35 pearson:0.33

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:298.10)
Query          1 npneayrhymkklsYETDIADLSIDIKKGYegiIVVDVRDAEAYKECHI-PTAISIP--g     57
d1tq1a_        1 -------aeesrvpSSVSVTVAHDLLLAGH---RYLDVRTPEEFSQGHAcGAINVPYmnr     50

Query         58 nkineDTTK--------rlskeKVIITYCWGpacngaTKAAAKFAQLGFR-VKELIGGIE    108
d1tq1a_       51 gasgmSKNTdfleqvsshfgqsDNIIVGCQS--ggrsIKATTDLLHAGFTgVKDIVGGYS    108

Query        109 YWRKeNGEVEGtlgakadlfwnmkkesle    137
d1tq1a_      109 AWAK-NGLPTK------------------    118


hit structure      alignment
FAST alignment (Normalized score: 4.04 Raw score:514.40)
Query          1 NPNEAYRHYMKKLS-------YETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAI     53
d1tq1a_        1 --------------AEESRVPSSVSVTVAHDLLLAG---HRYLDVRTPEEFSQGHACGAI     43

Query         54 SIPGNKINEDTTKRLSKEK---------------------------VIITYCWGPACN--     84
d1tq1a_       44 NVP----------------YMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQS----GG     83

Query         85 GATKAAAKFAQLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----    137
d1tq1a_       84 RSIKATTDLLHAGFTGVKDIVGGYSAWAKN------------------------GLPTK    118


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:62.97)
Query          1 ------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHI-PTAI     53
d1tq1a_        1 AEESRV-------------PSSVSVTVAHDLLLAGH---RYLDVRTPEEFSQGHACGAIN     44

Query         54 SIPG--------NKINEDT-TK---R-LSKEKVIITYCWGPACNGATKAAAKFAQ-LGFR     99
d1tq1a_       45 VPYMNRGASGMS-KNTDFLEQVSSHFGQSD-NIIVGCQ-SG-GRSIKATTDL-LHAGFTG     99

Query        100 VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1tq1a_      100 VKDIVGGYSAWAK-NGLPTK------------------    118


hit structure      alignment
HHsearch alignment (Probability: 1.00 E-value:0.00)
DALI match            ****************   ****************.......             
Query         10 MKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGN-----------     58
d1tq1a_        3 ESRVPSSVSVTVAHDLLLAGH---RYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNT     59

DALI match                    *********      ************* *************.....
Query         59 KINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFR-VKELIGGIEYWRKENGEV    117
d1tq1a_       60 DFLEQVSSHFGQSDNIIVGCQSGG--RSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPT    117

DALI match       .
Query        118 E    118
d1tq1a_      118 K    118



hit structures. 
top
16: d1hzma_ Erk2 binding domain of Mapk phosphatase mkp-​3 (hh: 0.998)

SCOP Superfamily: Rhodanese/​Cell cycle control phosphatase  |  SCOP Fold: Rhodanese/​Cell cycle control phosphatase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 570
Modified z-scores:
dali:0.93 daliz:0.85 gdtts:0.92 tmscore:0.94 rmsd:0.45 AHM:0.41 LBcontacta:0.93 LBcontactb:0.90 LHM:0.15
id:0.99 blosum:0.91 compass:0.68 pearson:0.96
Scaled scores:
dali:0.63 daliz:0.25 gdtts:0.46 tmscore:0.49 rmsd:0.72 AHM:0.68 LBcontacta:0.37 LBcontactb:0.54 LHM:0.41
id:0.12 blosum:0.19 compass:0.20 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:257.30)
Query          1 npneayrHYMK--KLSYE-tDIADlsIDIKKGYEGIIVVDvrdaeAYKE--cHIPT---A     52
d1hzma_        1 --midtlRPVPfaSEMAIskTVAWlnEQLELGNERLLLMD-----CRPQelyESSHiesA     53

Query         53 ISI-------------------PGNK-inedttKRLSKEKVIITYCwGPACNG-------     85
d1hzma_       54 INVaipgimlrrlqkgnlpvraLFTRgedrdrfTRRCGTDTVVLYD-ESSSDWnentgge    112

Query         86 --atkAAAKFAQLGFRVKELIG------giEYWRkenGEVEgtlGAKAdlfwnmkkesle    137
d1hzma_      113 sllglLLKKLKDEGCRAFYLEGgfskfqaeFSLH---CETN---LDGS------------    154


hit structure      alignment
FAST alignment (Normalized score: 2.34 Raw score:339.70)
Query          1 NPNEAY-------RHYMKKLSYETD----------IADLSIDIKKG--YEGIIVVDVRDA     41
d1hzma_        1 ------MIDTLRPVPFAS-------EMAISKTVAWLNEQLE-----LGNERLLL--MDCR     40

Query         42 EAYKEC---HIPTAISIPGNKI--------------------------NEDTTKRLSKE-     71
d1hzma_       41 PQELY-ESSHIESAIN------VAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTR----R     89

Query         72 ---KVIITYCWGPACN-----------GATKAAAKFAQLGFRVKELIGGIEYWRKENGEV    117
d1hzma_       90 CGTDTVVLY-DESS--SDWNENTGGESLLGLLLKKLKDEGCRAFYL--------------    132

Query        118 EGTLGAKADLFWNMKKESLE----------------------    137
d1hzma_      133 --------------------EGGFSKFQAEFSLHCETNLDGS    154


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:65.20)
Query          1 -------NPNEAYRHYM--KKLSYE-TDIADLSI-DIKKGY-EGIIVVDVRDAEAYKEC-     47
d1hzma_        1 MIDTLRP--------VPFA-SEMAISKTV-AWLNEQL-ELGNERLLLMD-----CRPQEL     44

Query         48 -HI-P--TAISI-------------------PGNKIN-EDT-TKRLSKEKVIITYCWGPA     82
d1hzma_       45 YESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGED-RDRFTRRCGTDTVVLYD-ESS    102

Query         83 C-NGA-T-----K--AAAKFAQLGFRVKELIGG-----IEY--WRKENGEVEGTLGAK-A    125
d1hzma_      103 SDWNENTGGESLLGLLLKKLKD-EGCRAFYLEGGFSKF--QAEFSLH-CETN---LDGS-    154

Query        126 DLFWNMKKESLE    137
d1hzma_      155 ------------    155


hit structure      alignment
HHsearch alignment (Probability: 0.99 E-value:0.00)
DALI match       .... ****  **************          ....****                 
Query         13 LSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNK-------------     59
d1hzma_       14 MAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPV     73

DALI match                    *************....              ****************
Query         60 -------INEDTTKRLSKEKVIITYCWGPA--------CNGATKAAAKFAQLGFRVKELI    104
d1hzma_       74 RALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLE    133

DALI match       *        
Query        105 GGIEYWRKE    113
d1hzma_      134 GGFSKFQAE    142



top
17: d1t6t1_ Hypothetical protein aq 2086 (svm: 0.808)

SCOP Superfamily: Toprim domain (Pfam 01751)  |  SCOP Fold: Toprim domain (Pfam 01751)  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.53  Contact: 563
Modified z-scores:
dali:0.95 daliz:0.93 gdtts:0.92 tmscore:0.93 rmsd:0.36 AHM:0.37 LBcontacta:0.88 LBcontactb:0.89 LHM:0.12
id:0.97 blosum:0.89 compass:0.69 pearson:0.92
Scaled scores:
dali:0.70 daliz:0.40 gdtts:0.54 tmscore:0.55 rmsd:0.75 AHM:0.68 LBcontacta:0.42 LBcontactb:0.63 LHM:0.49
id:0.10 blosum:0.17 compass:0.14 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 4.8 Raw score:306.10)
Query          1 npneayrhymkklsyetDIADLSIDikkgyEGIIVVDvRDAEaYKECH----IPTAISIP     56
d1t6t1_        1 -----------prnlseWIKELKKA----sREAVILV-EGKN-DKKALskfsIKNVIDLS     43

Query         57 gnKINEdTTKRLSKEK-VIITYCWGPA--CNGATKAAAKFAQLGFRVKE------liggi    107
d1t6t1_       44 gkRYAD-VVDMLEGKWeKVILLFDLDThgERINQKMKELLSSQGFLVDEnfrnflkkwni    102

Query        108 EYWRkengevegtlgakadlfwnmkkesle    137
d1t6t1_      103 IHIE------------------------ei    108


hit structure      alignment
FAST alignment (Normalized score: 4.56 Raw score:554.40)
Query          1 NPNEAYRHYMKKLSYET------DIADLSIDIKKGYEGIIVVDVRDAEAYKECH------     48
d1t6t1_        1 -----------------PRNLSEWIKELKKAS----REAVILV-EGKNDKK---ALSKFS     35

Query         49 IPTAISIPGNKI-----NEDTTKRLSKE--KVIITYCWGPA---CNGATKAAAKFAQLGF     98
d1t6t1_       36 IKNVID------LSGKRYADVVDM-LEGKWEKVILLFDLD-THGERINQKMKELLSSQGF     87

Query         99 RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE------------------    137
d1t6t1_       88 LVD------------------------------------ENFRNFLKKWNIIHIEEI    108


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:65.09)
Query          1 --NPNEAYRHYMKKLSYETDIA-DLS-IDIKKGYEGIIVVDVRDAEAYKECHI--P----     50
d1t6t1_        1 PR------------------NLSEWIKELK-KASREAVILV-E----GK-NDKKALSKFS     35

Query         51 -T-AISIPGNKINEDTTKRL--SKEKVIITYCWGPA--CNGATKAAAKFAQLGFRVKE--    102
d1t6t1_       36 IKNVIDLSGKRYA-DVVDMLEGKWE-KVILLFDLDTHGERINQKMKELLSSQGFLVDENF     93

Query        103 LI-GG---IEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1t6t1_       94 RNFLKKWNIIHIEE--I----------------------    108


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.04)
DALI match       ********  ****..........*********  ........    *********
Query         49 IPTAISIPGNKINEDTTKRLSKEKVIITYCWGPACNGATKAAA----KFAQLGFRV    100
d1t6t1_       36 IKNVIDLSGKRYADVVDMLEGKWEKVILLFDLD--THGERINQKMKELLSSQGFLV     89



top
18: d1j7ja_ Hypoxanthine PRTase (svm: 0.773)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 573
Modified z-scores:
dali:0.86 daliz:0.84 gdtts:0.88 tmscore:0.89 rmsd:0.37 AHM:0.30 LBcontacta:0.81 LBcontactb:0.86 LHM:0.14
id:0.63 blosum:0.28 compass:0.57 pearson:0.87
Scaled scores:
dali:0.69 daliz:0.33 gdtts:0.51 tmscore:0.53 rmsd:0.73 AHM:0.73 LBcontacta:0.38 LBcontactb:0.62 LHM:0.48
id:0.00 blosum:0.07 compass:0.13 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:311.00)
Query          1 -npneayrhymkklsyetDIADLSIDIKKGYEGIIVVDVRDaEAYK-eCHIP-------t     51
d1j7ja_        1 htvevmipeaeikariaeLGRQITERYKDSGSEMVLVGLLR-GSFMfmADLCrevqvphe     59

Query         52 AISIPGN---kinedTTKRLsKEKVIITYCWGPA-CNGATKAAAKFAQLGF-RVKELigG    106
d1j7ja_       60 VDFMTASrdvkilkdLDEDI-RGKDVLIVEDIIDsGNTLSKVREILGLREPkSLAIC--T    116

Query        107 IEY-------------WRKEngevegtlgakaDLFWNMKKE--------sle    137
d1j7ja_      117 LLDkpsrrevdvpvefVGFS-----ipdefvvGYGIDYAQRyrhlpyvgkvv    163


hit structure      alignment
FAST alignment (Normalized score: 3.25 Raw score:485.70)
Query          1 NPNEAYRHYMKKLSYET------------------DIADLSIDIKKGYE-GIIVVDVR--     39
d1j7ja_        1 -----------------HTVEVMIPEAEIKARIAELGRQITERYK-DSGSEMVLVGL-LR     41

Query         40 -DAEAYKECHIP---------TAISIPGNKINEDTTKRL--------------SKEKVII     75
d1j7ja_       42 GSFMFMAD----LCREVQVPHEVDFMT------------ASRDVKILKDLDEDIRGKDVL     85

Query         76 TYCW-GPACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKK    133
d1j7ja_       86 IVEDIIDSGNTLSKVREILGLREPKSLAIC------------------------------    115

Query        134 ESLE------------------------------------------------    137
d1j7ja_      116 ----TLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQRYRHLPYVGKVV    163


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:66.25)
Query          1 ------------------NPNEAYRHYMKKLSYETDI-ADLSIDIKKGYEG-IIVVDVRD     40
d1j7ja_        1 HTVEVMIPEAEIKARIAE------------------LGRQITERY-KDSGSEMVLVGLLR     41

Query         41 AEAYKECH--IP------TAISIPGN-------KINEDTTKRLSKEKVIITYCWGPACN-     84
d1j7ja_       42 -GSF-MFMADLCREVQVPHEVDFMTASRDVKILKDL--DE--DIRGKDVLIVEDIIDSGN     95

Query         85 GATKAAAKFAQLGFRVKELIGGIE--------------YWRKE------NGEVEGTLGAK    124
d1j7ja_       96 TLSKVREILGLREPKSLAIC-TLLDKPSRREVDVPVEFVG-FSIPDEFV-----------    142

Query        125 ADLFWNMKKE-SL---------E    137
d1j7ja_      143 VGYGIDYAQRY-RHLPYVGKVV-    163


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.48)
DALI match       **********************..... ****        
Query         19 IADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGN     58
d1j7ja_       20 GRQITERYKDSGSEMVLVGLLRGSFMFMADLCREVQVPHE     59



top
19: d1a3ca_ Pyrimidine operon regulator PyrR (svm: 0.879)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 490
Modified z-scores:
dali:0.86 daliz:0.86 gdtts:0.84 tmscore:0.86 rmsd:0.42 AHM:0.33 LBcontacta:0.75 LBcontactb:0.83 LHM:0.19
id:0.63 blosum:0.34 compass:0.59 pearson:0.87
Scaled scores:
dali:0.72 daliz:0.38 gdtts:0.49 tmscore:0.51 rmsd:0.71 AHM:0.72 LBcontacta:0.38 LBcontactb:0.62 LHM:0.41
id:0.00 blosum:0.06 compass:0.15 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:328.10)
Query          1 npneayrhymkklsyetdiADLSIDIKKGYegIIVVDVRDaeaykecHIPT---------     51
d1a3ca_        1 ----qkavildeqairralTRIAHEMIERN-kCILVGIKT-rgiylaKRLAerieqiegn     54

Query         52 ---AISIPG---------NKINedTTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGF     98
d1a3ca_       55 pvtVGEIDItlyrndeplVKGA--DIPVDITDQKVILVDDVLYtGRTVRAGMDALVDVGR    112

Query         99 --RVKELIG-----------gieYWRK--------engeveGTLGaKADLfwNMKKesle    137
d1a3ca_      113 psSIQLAVLvdrghrelpiradyIGKNiptsksekvmvqldEVDQ-NDLV-aIYEN----    166


hit structure      alignment
FAST alignment (Normalized score: 3.08 Raw score:464.00)
Query          1 NPNEAYRHYMKKLSYET-----------------DIADLSIDIKKGYE-GIIVVDVR--D     40
d1a3ca_        1 -----------------QKAVILDEQAIRRALTRIAHEMIER------NKCILVGIKTRG     37

Query         41 AEAYKECHI-------------PTAISIPGNKINEDTTKRL-------------------     68
d1a3ca_       38 IYLAK----RLAERIEQIEGNPVTVGEID------------ITLYRNDEPLVKGADIPVD     81

Query         69 SKEKVIITYCWG-PACNGATKAAAKFAQ-LGF-RVKELIGGIEYWRKENGEVEGTLGAKA    125
d1a3ca_       82 ITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLA----------------------    119

Query        126 DLFWNMKKESLE-----------------------------------------------    137
d1a3ca_      120 ------------VLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYEN    166


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:66.68)
Query          1 ----------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEA-     43
d1a3ca_        1 QKAVILDEQAIRRALT-------------------RIAHEMIERNK--CILVGIKT--RG     37

Query         44 YKECH-IPT-----------AISIPG-----------NKINEDTTKRLSKEKVIITYCWG     80
d1a3ca_       38 IY-LAKRLAERIEQIEGNPVTVGEIDITLYRNDEPLVKGA---DIPVDITDQKVILVDDV     93

Query         81 PA-CNGATKAAAKFAQLGFR-VKELIGGIEY------------WRKE------------N    114
d1a3ca_       94 LYTGRTVRAGMDALVDVGRPSSIQLA-VLVDRGHRELPIRADYIGKNIPTSKSEKVMVQ-    151

Query        115 GEVEGTLG---AKADLFWN--MKKESLE    137
d1a3ca_      152 -----LDEVDQ-NDLVAIYEN-------    166


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.40)
DALI match        *********** ....
Query         19 IADLSIDIKKGYEGIIV     35
d1a3ca_       15 LTRIAHEMIERNKCILV     31



top
20: d1l1qa_ Adenine PRTase (svm: 0.885)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.37  Contact: 496
Modified z-scores:
dali:0.82 daliz:0.88 gdtts:0.84 tmscore:0.84 rmsd:0.33 AHM:0.28 LBcontacta:0.79 LBcontactb:0.80 LHM:0.14
id:0.77 blosum:0.51 compass:0.61 pearson:0.82
Scaled scores:
dali:0.72 daliz:0.42 gdtts:0.56 tmscore:0.56 rmsd:0.74 AHM:0.70 LBcontacta:0.44 LBcontactb:0.65 LHM:0.42
id:0.04 blosum:0.08 compass:0.12 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:329.30)
Query          1 ----------------------npneayrhymkklsyetdIADLSIDIkkGYEGI-IVVD     37
d1l1qa_        1 tmsvadahaliktipdfptkgiafkdlsdilstpaaldavRKEVTAHY--KDVPItKVVG     58

Query         38 VRDaeaykechIPTA------ISIPG-----------------------NKINEDTTkrl     68
d1l1qa_       59 IES--rgfilgGIVAnslgvgFVALRkagklpgdvckctfdmeyqkgvtIEVQKRQL---    113

Query         69 sKEKVIITYCWGPA-CNGATKAAAKFAQLGF---RVKELigGIEY---------------    109
d1l1qa_      114 gPHDVVLLHDDVLAtGGTLLAAIELCETAGVkpeNIYIN--VLYEiealkgrekvgqkct    171

Query        110 ----WRKEngevegtlgakadlfwnmkkesle    137
d1l1qa_      172 rlfsVIRE----------------------hh    181


hit structure      alignment
FAST alignment (Normalized score: 3.07 Raw score:483.20)
Query          1 NPNEAYRHYMKKLSYET---------------------------------------DIAD     21
d1l1qa_        1 -----------------TMSVADAHALIKTIPDFPTKGIAFKDLSDILSTPAALDAVRKE     43

Query         22 LSIDIKKGYEG---IIVVDVRDAEAYKECHI----------PTAISIPG-----------     57
d1l1qa_       44 VTAHYKD----VPITKVVGI--ESRGFI---LGGIVANSLGVGFVA---LRKAGKLPGDV     91

Query         58 --------------NKINEDTTKRLSKEKVIITYCWG-PACNGATKAAAKFAQLGF---R     99
d1l1qa_       92 CKCTFDMEYQKGVTIEVQKR---QLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPEN    148

Query        100 VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE----------------------    137
d1l1qa_      149 IYIN----------------------------------VLYEIEALKGREKVGQKCTRLF    174

Query        138 -------    138
d1l1qa_      175 SVIREHH    181


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:62.86)
Query          1 -----------------------------------------NPNEAYRHYMKKLSYETDI     19
d1l1qa_        1 TMSVADAHALIKTIPDFPTKGIAFKDLSDILSTPAALDAVR------------------K     42

Query         20 ADLSIDIKKGYEGIIVVDVRDAEAYKECHI--PT-----AISIPGNK--I---NE-----     62
d1l1qa_       43 EVTAHY-KD-VPITKVVGIES-RGF--ILGGIVANSLGVGFVALRKAGKLPGDVCKCTFD     97

Query         63 ----------DTTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFR--VKELIGGIE-    108
d1l1qa_       98 MEYQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYIN-VLYE    156

Query        109 ------------------YWRKE---NGEVEGTLGAKADLFWNMKKESLE    137
d1l1qa_      157 IEALKGREKVGQKCTRLFSV-IREHH------------------------    181


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.10)
DALI match       . ********    ....   **************.....                    
Query         68 LSKEKVIITY----CWGPACNGATKAAAKFAQLGFRVKEL----------IGGIEYWRKE    113
d1l1qa_      113 LGPHDVVLLHDDVLATGG---TLLAAIELCETAGVKPENIYINVLYEIEALKGREKVGQK    169

DALI match             
Query        114 NGEVEG    119
d1l1qa_      170 CTRLFS    175



hit structures. 
top
21: d1hgxa_ Hypoxanthine-​guanine-​xanthine PRTase (svm: 0.872)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.51  Contact: 506
Modified z-scores:
dali:0.85 daliz:0.87 gdtts:0.88 tmscore:0.88 rmsd:0.30 AHM:0.32 LBcontacta:0.79 LBcontactb:0.82 LHM:0.15
id:0.72 blosum:0.30 compass:0.57 pearson:0.83
Scaled scores:
dali:0.72 daliz:0.39 gdtts:0.57 tmscore:0.57 rmsd:0.78 AHM:0.71 LBcontacta:0.41 LBcontactb:0.63 LHM:0.45
id:0.03 blosum:0.06 compass:0.12 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:313.80)
Query          1 ---npneayrhymkklsyetDIADLSIDIkkGYEGIIVVDVRDaeaykeCHIP-------     50
d1hgxa_        1 mddlervlynqddiqkrireLAAELTEFY--EDKNPVMICVLT---gavFFYTdllkhld     55

Query         51 ---tAISIPG----NKINedtTKRLSKEKVIITYCWGPA-cNGATKAAAKFAQLGF-RVK    101
d1hgxa_       56 fqlePDYIICssltISKD---LKTNIEGRHVLVVEDIIDtgLTMYQLLNNLQMRKPaSLK    112

Query        102 ELigGIEY--------------WRKEngevegtlgakaDLFWNMKKE---------sle    137
d1hgxa_      113 VC--TLCDkdigkkaydvpidyCGFV-----venryiiGYGFDFHNKyrnlpvigilke    164


hit structure      alignment
FAST alignment (Normalized score: 2.85 Raw score:427.90)
Query          1 NPNEAYRHYMKKLSYET----------------DIADLSIDIKKGYE-----GIIVVDVR     39
d1hgxa_        1 -----------------MDDLERVLYNQDDIQKRIRELAAELTE---FYEDKNPVMICV-     39

Query         40 ---DAEAYKECHI---------PTAISIPGNKINEDTTKRL-------------SKEKVI     74
d1hgxa_       40 LTGAVFFYT----DLLKHLDFQLEPDYII------------CSSLTISKDLKTNIEGRHV     83

Query         75 ITYCWG-PACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMK    132
d1hgxa_       84 LVVEDIIDTGLTMYQLLNNLQMRKPASLKVC-----------------------------    114

Query        133 KESLE--------------------------------------------------    137
d1hgxa_      115 -----TLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKE    164


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:64.94)
Query          1 -------------------NPNEAYRHYMKKLSYETDI-ADLSIDIKKGYEGIIVVDVRD     40
d1hgxa_        1 MDDLERVLYNQDDIQKRIR-----------------ELAAELTEFY--EDKNPVMICVLT     41

Query         41 AEAYKECH-IP------T-AISIPG----N-KINEDTTKRLSKEKVIITYCWGPACN-GA     86
d1hgxa_       42 -GAVFFYTDLLKHLDFQLEPDYIICSSLTISKD---LK-TNIEGRHVLVVEDIIDTGLTM     96

Query         87 TKAAAKFAQLGF-RVKELIGG--------------IEYW--------RKENGEVEGTLGA    123
d1hgxa_       97 YQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYII-------------    143

Query        124 KADLFWNMKKE------------SLE    137
d1hgxa_      144 --GYGFDFHNKYRNLPVIGILKE---    164


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.44)
DALI match                                                    
Query         58 NKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKE    102
d1hgxa_       19 RELAAELTEFYEDKNPVMICVLTG---AVFFYTDLLKHLDFQLEP     60



top
22: d1vdda_ Recombination protein RecR (svm: 0.625)

SCOP Superfamily: Recombination protein RecR  |  SCOP Fold: Recombination protein RecR  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.44  Contact: 537
Modified z-scores:
dali:0.92 daliz:0.92 gdtts:0.86 tmscore:0.88 rmsd:0.44 AHM:0.47 LBcontacta:0.86 LBcontactb:0.86 LHM:0.24
id:0.85 blosum:0.39 compass:0.45 pearson:0.80
Scaled scores:
dali:0.71 daliz:0.41 gdtts:0.48 tmscore:0.48 rmsd:0.68 AHM:0.59 LBcontacta:0.41 LBcontactb:0.62 LHM:0.34
id:0.06 blosum:0.08 compass:0.09 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.9 Raw score:286.30)
Query          1 ------------------------------------------------npneayrhymkk     12
d1vdda_        1 mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic     60

Query         13 lsyetdiadlsidiKKGYEGIIVVDvRDAEAYkECHI------pTAISI-----------     55
d1vdda_       61 fnitdaekcdvcadPSRDQRTICVV-EEPGDV-IALErsgeyrgLYHVLhgvlspmngvg    118

Query         56 -pgNKINeDTTKRLSKEKVIITYCWGPA--CNGATKAAAKFAQLGFRVKELIGgieywRK    112
d1vdda_      119 pdkLHIK-PLLPRVGQGMEVILATGTTVegDATALYLQRLLEPLGAAISRIAY-----GV    172

Query        113 EN--gevegtlgakadlfwnmkkesle    137
d1vdda_      173 PVggsleytdevtlgraltgrqtvskp    199


hit structure      alignment
FAST alignment (Normalized score: 2.98 Raw score:492.80)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIK---------------------------------     27
d1vdda_        1 ---------------------------MKYPPSLVSLIRELSRLPGIGPKSAQRLAFHLF     33

Query         28 ------------------------------------------KGYEGIIVVDVRDAEAYK     45
d1vdda_       34 EQPREDIERLASALLEAKRDLHVCPICFNITDAEKCDVCADPSRDQRTICV-VEEPGDVI     92

Query         46 ECHI---------PTAISIPGNKI----------------NEDTTKRLSKEKVIITYCWG     80
d1vdda_       93 ----ALERSGEYRGLYHVL-----HGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGT    143

Query         81 PA---CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1vdda_      144 T-VEGDATALYLQRLLEPLGAAISRI----------------------------------    168

Query        138 -------------------------------    138
d1vdda_      169 AYGVPVGGSLEYTDEVTLGRALTGRQTVSKP    199


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:40.89)
Query          1 ---------------------------------------NPNEAYRHYMKKLSYETDIAD     21
d1vdda_        1 MKYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRD--LH--V     56

Query         22 LSIDIK------KGYEGIIV------VDVRDAEAYKECHIPTAISIPGNKINEDTTKRLS     69
d1vdda_       57 CP--ICFNITDA--EKCDVCADPSRD----------------QRTIC-------------     83

Query         70 KEKVIITYCWGPACNGATKAAAKF--AQLGF--RVKELIGGIEY---------WRKEN-G    115
d1vdda_       84 -------VVEEP--GDVIALERSGEY----RGL---YH--VLHGVLSPMNGVGPDKLHIK    125

Query        116 EVE--GT------LGAKA-DL----FWNM-----------------KK--E---------    134
d1vdda_      126 PLLPRVGQGMEVI----LA-TGTTVEGDATALYLQRLLEPLGAAIS-RIAYGVPVGGSLE    179

Query        135 --------S--LE-------    137
d1vdda_      180 YTDEVTLGRALTGRQTVSKP    199


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.33)
DALI match       ********************  
Query         86 ATKAAAKFAQLGFRVKELIGGI    107
d1vdda_      151 ALYLQRLLEPLGAAISRIAYGV    172



top
23: d1d5ra2 Phoshphoinositide phosphatase Pten (Pten tumor suppressor),​ N-​terminal domain (svm: 0.716)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.35  Contact: 456
Modified z-scores:
dali:0.89 daliz:0.90 gdtts:0.87 tmscore:0.88 rmsd:0.40 AHM:0.43 LBcontacta:0.91 LBcontactb:0.92 LHM:0.15
id:0.81 blosum:0.60 compass:0.57 pearson:0.91
Scaled scores:
dali:0.70 daliz:0.39 gdtts:0.48 tmscore:0.49 rmsd:0.72 AHM:0.63 LBcontacta:0.46 LBcontactb:0.71 LHM:0.43
id:0.04 blosum:0.11 compass:0.16 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:270.80)
Query          1 npneayrhYMKK--------LSYE------------------tdIADLSIDIKKGY-EGI     33
d1d5ra2        1 --------RRYQedgfdldlTYIYpniiamgfpaerlegvyrnnIDDVVRFLDSKHkNHY     52

Query         34 IVVDVRDaEAYKE--chiPTAISIP--------gnKINEdTTKR--LSKE----KVIITY     77
d1d5ra2       53 KIYNLCA-ERHYDtakfnCRVAQYPfedhnppqleLIKP-FCEDldQWLSeddnHVAAIH    110

Query         78 CWGpaCNGATKAAAKFAQLG-----frvkeliggieywrkengevegtlgakadlfwnmk    132
d1d5ra2      111 CKA-gKGRTGVMICAYLLHRgkflkaqealdfygevrtrdkkgvtipsqrryvyyysyll    169

Query        133 kesle    137
d1d5ra2      170 knhld    174


hit structure      alignment
FAST alignment (Normalized score: 2.41 Raw score:372.00)
Query          1 NPNEAYRHYMKKLSY---------------------------------ETDIADLSIDIK     27
d1d5ra2        1 ---------------RRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD     45

Query         28 KG--YEGIIVVDVRDAEAYKECHI-----------PTAISIPGNKIN-------------     61
d1d5ra2       46 S-KHKNHYKIYNLC----------AERHYDTAKFNCRVAQY------PFEDHNPPQLELI     88

Query         62 ---EDTTKRLSKE-------KVIITYCWGPA---CNGATKAAAKFAQLGFRVKELIGGIE    108
d1d5ra2       89 KPFCEDLDQ----WLSEDDNHVAAIHC----KAGKGRTGVMICAYLL-------------    127

Query        109 YWRKENGEVEGTLGAKADLFWNMKKESLE-------------------------------    137
d1d5ra2      128 -----------------------------HRGKFLKAQEALDFYGEVRTRDKKGVTIPSQ    158

Query        138 ----------------    138
d1d5ra2      159 RRYVYYYSYLLKNHLD    174


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:58.87)
Query          1 NPNEAYRHY--MKK-------LSY----ETD------------I---ADLSIDIKKGYEG     32
d1d5ra2        1 -------RRYQ--EDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNH     51

Query         33 IIVVDVRDAEAYKECHI--P-T-AISIPG-----N---KINED-TTKRLS-KE---KVII     75
d1d5ra2       52 YKIYNLCA--ER-HYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAA    108

Query         76 TYCWGPACNGATKAAAKFAQLGFR----------VK---ELI------------------    104
d1d5ra2      109 IHCKAG-KGRTGVMICAYLLHRGKFLKAQEALDF-YGEV--RTRDKKGVTIPSQRRYVYY    164

Query        105 ----------GGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1d5ra2      165 YSYLLKNHLD---------------------------------    174


hit structure      alignment
HHsearch alignment (Probability: 0.42 E-value:0.00)
DALI match       ....**********......   ....             .... ****...      .*
Query         27 KKGYEGIIVVDVRDAEAYKECHIPTAI--------SIPGNKINEDTTKRLSK------EK     72
d1d5ra2       46 SKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNH    105

DALI match       ******** ................ 
Query         73 VIITYCWGPACNGATKAAAKFAQLGF     98
d1d5ra2      106 VAAIHCKAGKGRTGVMICAYLLHRGK    131



top
24: d1o5oa_ Uracil PRTase,​ Upp (svm: 0.913)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 530
Modified z-scores:
dali:0.85 daliz:0.86 gdtts:0.82 tmscore:0.83 rmsd:0.45 AHM:0.40 LBcontacta:0.84 LBcontactb:0.89 LHM:0.16
id:0.89 blosum:0.70 compass:0.64 pearson:0.84
Scaled scores:
dali:0.74 daliz:0.40 gdtts:0.49 tmscore:0.48 rmsd:0.71 AHM:0.68 LBcontacta:0.44 LBcontactb:0.71 LHM:0.47
id:0.07 blosum:0.13 compass:0.15 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 3.4 Raw score:351.60)
Query          1 npneayrhYMKKL-------------------------------syetDIADLSI-----     24
d1o5oa_        1 --------HMKNLvvvdhplikhkltimrdkntgpkefrellreitllLAYEATRhlkce     52

Query         25 ------------dikKGYEGIIVVDVRDaeaykecHIPT-------aISIPG--------     57
d1o5oa_       53 evevetpitktigyrINDKDIVVVPILR-aglvmaDGILellpnasvGHIGIyrdpetlq    111

Query         58 ---NKINedtTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGF-RVKELigGIEY---    109
d1o5oa_      112 aveYYAK---LPPLNDDKEVFLLDPMLAtGVSSIKAIEILKENGAkKITLV--ALIAape    166

Query        110 ----------------wrkengevegtlgakaDLFW--NMKKESle    137
d1o5oa_      167 gveavekkyedvkiyvaalderlndhgyiipgLGDAgdRLFRTK--    210


hit structure      alignment
FAST alignment (Normalized score: 2.79 Raw score:474.00)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------DIADLS     23
d1o5oa_        1 -----------------HMKNLVVVDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAY     43

Query         24 IDIKKG----------------------YEGIIVVDVR---DAEAYKECH-----IPTAI     53
d1o5oa_       44 EATR--HLKCEEVEVETPITKTIGYRINDKDIVVVPI-LRAGLVMAD---GILELLPNAS     97

Query         54 SIPGNKINEDTT-------------------KRLSKEKVIITYCWG-PACNGATKAAAKF     93
d1o5oa_       98 VGH---------IGIYRDPETLQAVEYYAKLPPLNDDKEVFLLDPMLATGVSSIKAIEIL    148

Query         94 AQLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE---------------    137
d1o5oa_      149 KENGAKKITLV----------------------------------ALIAAPEGVEAVEKK    174

Query        138 ------------------------------------    138
d1o5oa_      175 YEDVKIYVAALDERLNDHGYIIPGLGDAGDRLFRTK    210


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:66.06)
Query          1 -NPNEAYRHYMKKLSYE-TD--------------------------------I--ADLSI     24
d1o5oa_        1 H-------MK--NL--VV-VDHPLIKHKLTIMRDKNTGPKEFRELLREITLLLAYEATRH     48

Query         25 D----------------IKKGY-E-GIIVVDVRDAEAYKECH-IP--T--A-ISIPG---     57
d1o5oa_       49 LKCEEVEVETPITKTIG--YRINDKDIVVVPILR-AGLVMADGILELLPNASVGHIGIYR    105

Query         58 --------N-KINEDTTKRLSK-EKVIITYCWGPACN-GATKAAAKFAQLGFRVKELIGG    106
d1o5oa_      106 DPETLQAVEYYA---KL-PPLNDDKEVFLLDPMLATGVSSIKAIEILKENGAKKITLV-A    160

Query        107 IEY------------------WRKE---------------NGEVEGTLGAKADLFWNM--    131
d1o5oa_      161 -LIAAPEGVEAVEKKYEDVKIYVAALDERLNDHGYIIPGL------------GDAGDRLF    207

Query        132 KKESLE    137
d1o5oa_      208 RT--K-    210


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.62)
DALI match       .................****************.....
Query         66 KRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKEL    103
d1o5oa_      121 PLNDDKEVFLLDPMLATGVSSIKAIEILKENGAKKITL    158



top
25: d1jlra_ Uracil PRTase,​ Upp (svm: 1.093)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.39  Contact: 547
Modified z-scores:
dali:0.86 daliz:0.86 gdtts:0.83 tmscore:0.84 rmsd:0.49 AHM:0.45 LBcontacta:0.83 LBcontactb:0.86 LHM:0.29
id:0.95 blosum:0.65 compass:0.57 pearson:0.85
Scaled scores:
dali:0.74 daliz:0.39 gdtts:0.47 tmscore:0.48 rmsd:0.70 AHM:0.66 LBcontacta:0.40 LBcontactb:0.62 LHM:0.35
id:0.09 blosum:0.13 compass:0.13 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 3.0 Raw score:346.30)
Query          1 --------------npnEAYRHYMKKL--------------------------------s     14
d1jlra_        1 llvdprystndqeesilQDIITRFPNVvlmkqtaqlrammtiirdketpkeefvfyadrl     60

Query         15 yetDIADLSI-----------------dikKGYEGIIVVDVRDaeaykeCHIP------t     51
d1jlra_       61 irlLIEEALNelpfqkkevttpldvsyhgvSFYSKICGVSIVRagesmeSGLRavcrgvr    120

Query         52 AISIPG----------NKINedTTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFR-     99
d1jlra_      121 IGKILIqrdettaepkLIYE--KLPADIRERWVMLLDPMCAtAGSVCKAIEVLLRLGVKe    178

Query        100 --VKELIG------------------gieywrkengevegtlgakaDLFWN--MKKEsle    137
d1jlra_      179 erIIFVNIlaapqgiervfkeypkvrmvtaavdiclnsryyivpgiGDFGDryFGTM---    235


hit structure      alignment
FAST alignment (Normalized score: 2.23 Raw score:399.80)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d1jlra_        1 -----------------LLVDPRYSTNDQEESILQDIITRFPNVVLMKQTAQLRAMMTII     43

Query         18 -------------DIADLSIDIKKGY---------------------------EGIIVVD     37
d1jlra_       44 RDKETPKEEFVFYADRLIRLLIE---EALNELPFQKKEVTTPLDVSYHGVSFYSKICGVS    100

Query         38 VRDAEAYKECHI------------------PTAISIPGNKINEDTTKRL-----------     68
d1jlra_      101 ------------IVRAGESMESGLRAVCRGVRIGKIL------------IQRDETTAEPK    136

Query         69 ---------SKEKVIITYCWG-PACNGATKAAAKFAQLGF---RVKELIGGIEYWRKENG    115
d1jlra_      137 LIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFV------------    184

Query        116 EVEGTLGAKADLFWNMKKESLE--------------------------------------    137
d1jlra_      185 ----------------------NILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVP    222

Query        138 -------------    138
d1jlra_      223 GIGDFGDRYFGTM    235


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:66.58)
Query          1 ----------------------NPNEAYRHYMKKLSYETDIA------------------     20
d1jlra_        1 LLVDPRYSTNDQEESILQDIIT--------RF-PN---VVLMKQTAQLRAMMTIIRDKET     48

Query         21 ------------------DLSI-DIK----------------KGYEGIIVVDVRDAEAYK     45
d1jlra_       49 PKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVR-AGE-    106

Query         46 ECH-IP---T--A-ISIPGN------------KINEDTTKRLSKEKVIITYCWGPACN-G     85
d1jlra_      107 SMESGLRAVCRGVRIGKILIQRDETTAEPKLIYE---KLPADIRERWVMLLDPMCATAGS    163

Query         86 ATKAAAKFAQLGFRV--KELIGGIEY------------------WRKE------------    113
d1jlra_      164 VCKAIEVLLRLGVKEERIIFV-N-ILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIV    221

Query        114 -NGEVEGTLGAKADLFWNMKKE---SLE    137
d1jlra_      222 P-------------GIGDFGDRYFG-TM    235


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.25)
DALI match       .................*****************....
Query         66 KRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKEL    103
d1jlra_      144 ADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERI    181



hit structures. 
top
26: d1nuia1 Primase fragment of primase-​helicase protein (svm: 0.627)

SCOP Superfamily: DNA primase core  |  SCOP Fold: DNA primase core  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.39  Contact: 501
Modified z-scores:
dali:0.82 daliz:0.82 gdtts:0.86 tmscore:0.87 rmsd:0.33 AHM:0.31 LBcontacta:0.80 LBcontactb:0.78 LHM:0.17
id:0.95 blosum:0.86 compass:0.53 pearson:0.82
Scaled scores:
dali:0.68 daliz:0.33 gdtts:0.54 tmscore:0.55 rmsd:0.77 AHM:0.73 LBcontacta:0.40 LBcontactb:0.56 LHM:0.41
id:0.10 blosum:0.16 compass:0.14 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:265.50)
Query          1 --------------------------------------------------------npne      4
d1nuia1        1 gtynvwnfgesngrysaltargisketcqkagywiakvdgvmyqvadyrdqngnivsqkv     60

Query          5 ayrhymkklsyetdiadlsidikkgyEGIIVVDVRdaeaykeCHIP-------TAISI--     55
d1nuia1       61 rdkdknfkttgshksdalfgkhlwngGKKIVVTEG---eidmLTVMelqdckyPVVSLgh    117

Query         56 PGNKI---NEDTTKRLSKEKVII-TYCWgpaCNGATKAAAKFAQLGF--RVKELIG---G    106
d1nuia1      118 GASAAkktCAANYEYFDQFEQIIlMFDM---DEAGRKAVEEAAQVLPagKVRVAVLpckD    174

Query        107 IEYWRKENGEvegtlgakadlfwnmkkesle    137
d1nuia1      175 ANECHLNGHD-------------reimeqvw    192


hit structure      alignment
FAST alignment (Normalized score: 2.82 Raw score:456.70)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGY------------------------------     30
d1nuia1        1 ------------------------------GTYNVWNFGESNGRYSALTARGISKETCQK     30

Query         31 --------------------------------------------------------EGII     34
d1nuia1       31 AGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKI     90

Query         35 VVDVRDAEAYKECHI---------PTAIS---IPGNKI---NEDTTKRLSKE-KVIITYC     78
d1nuia1       91 VVT-EGEIDML----TVMELQDCKYPVV-SLGHGASAAKKTCAANYEY-FDQFEQIILMF    143

Query         79 WGPACNGATKAAAKFAQLGF-----RVKELI----GGIEYWRKENGEVEGTLGAKADLFW    129
d1nuia1      144 DM--DEAGRKAVEEAAQ---VLPAGKVRVA-VLPCKDANECHLNG---------------    182

Query        130 NMKKESLE----------    137
d1nuia1      183 --------HDREIMEQVW    192


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:57.88)
Query          1 ------------------------------------------------------------      1
d1nuia1        1 GTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKV     60

Query          1 --------------------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGII     34
d1nuia1       61 RDKDKNFKTTGSHKSDALFGKHLWNG------------------------------GKKI     90

Query         35 VVDVRDAEAYKECHI---P-------TAISI-----PGNK-INEDTTKRLSKEKVIITYC     78
d1nuia1       91 VVT-E----GE-IDMLTVMELQDCKYPVVSLGHGASAAKKTCA-ANYEYFDQFEQIILMF    143

Query         79 WGPA--CNGATKAAAKFAQLGFRVKELIGGIEYWRKENG------------EVEGTLGAK    124
d1nuia1      144 DMDEAGRKAVEEAAQVL--PAGKVRVAVLPCKDANECHLNGHDREIMEQVW---------    192

Query        125 ADLFWNMKKESLE    137
d1nuia1      193 -------------    193


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.56)
DALI match       ...***************.... .  *************
Query         58 NKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1nuia1      123 KKTCAANYEYFDQFEQIILMFDMD--EAGRKAVEEAAQV    159



top
27: d1d3ya_ DNA topoisomerase IV,​ alpha subunit (svm: 0.619)

SCOP Superfamily: DNA topoisomerase IV,​ alpha subunit  |  SCOP Fold: DNA topoisomerase IV,​ alpha subunit  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.42  Contact: 614
Modified z-scores:
dali:0.91 daliz:0.90 gdtts:0.85 tmscore:0.88 rmsd:0.52 AHM:0.49 LBcontacta:0.92 LBcontactb:0.89 LHM:0.23
id:0.71 blosum:0.21 compass:0.45 pearson:0.84
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.45 tmscore:0.48 rmsd:0.66 AHM:0.60 LBcontacta:0.47 LBcontactb:0.64 LHM:0.36
id:0.01 blosum:0.06 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 2.9 Raw score:310.00)
Query          1 ------------------------------------------------------------      1
d1d3ya_        1 qakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaalg     60

Query          1 ----------------------------npneayrhymkklsyetdiadlsidikkGYEG     32
d1d3ya_       61 vlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnleTDAD    120

Query         33 IIVVDVRdAEAYKEC--------hipTAISIPGNkINEDTTKR--LSKE---KVIITYCW     79
d1d3ya_      121 FILAIET-SGMFARLnaerfwdkhncILVSLKGV-PARATRRFikRLHEehdLPVLVFTD    178

Query         80 GpaCNGAT-KAAAKFAQ---LGFRVKELIGGieYWRKENGE-------------------    116
d1d3ya_      179 G--DPYGYlNIYRTLKVdklSIPAARLIGVTpqDIIDYDLPthplkeqdikrikdglknd    236

Query        117 ------------------------vegtlgAKADL--------fwnmkkesle    137
d1d3ya_      237 dfvrsfpewqkalkqmldmgvraeqqslakYGLKYvvntylpekikdestwlp    289


hit structure      alignment
FAST alignment (Normalized score: 2.29 Raw score:456.20)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGY------------------------------     30
d1d3ya_        1 ------------------------------QAKIFAQTTKMLEFAKQLLETDDFSTLREA     30

Query         31 ------------------------------------------------------------     31
d1d3ya_       31 YYVSKNWGEARFDDQQASNNVIEDLEAALGVLREHLGFIPEEDGSSVVGPLKIIEETPEG     90

Query         31 ----------------------------EGIIVVDVRDAEAYKECHI------------P     50
d1d3ya_       91 ELVVDCTKLGTGAYNIPNDVTKLNLETDADFILAI-ETSGMFA----RLNAERFWDKHNC    145

Query         51 TAISIPG-NKINEDTTKRLS-------KEKVIITYCWGPACNGA-TKAAAKFAQLG----     97
d1d3ya_      146 ILVSL--KGVPARATRRF--IKRLHEEHDLPVLVFTDG--DPYGYLNIYRTLK---VDKL    196

Query         98 --FRVKELIGG--IEYWRKENGEVEGTLGAKADLFWNMKKESLE----------------    137
d1d3ya_      197 SIPAARLI---GVTPQDII-------------------------DYDLPTHPLKEQDIKR    228

Query        138 ------------------------------------------------------------    138
d1d3ya_      229 IKDGLKNDDFVRSFPEWQKALKQMLDMGVRAEQQSLAKYGLKYVVNTYLPEKIKDESTWL    288

Query        138 -    138
d1d3ya_      289 P    289


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:60.74)
Query          1 ------------------------------------------------------------      1
d1d3ya_        1 QAKIFAQTTKMLEFAKQLLETDDFSTLREAYYVSKNWGEARFDDQQASNNVIEDLEAALG     60

Query          1 ---------------------------------------------------------NPN      3
d1d3ya_       61 VLREHLGFIPEEDGSSVVGPLKIIEETPEGELVVDCTKLGTGAYNIPNDVTKLNLET---    117

Query          4 EAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHI---PT------AIS     54
d1d3ya_      118 -------------------------DAD-FILAIET-SGMFA-RLNAERFWDKHNCILVS    149

Query         55 IPGNKINEDTTKRL--SKE---KVIITYCWGPACNGAT-KAAAKFAQ--LGF-RVKELI-    104
d1d3ya_      150 LKGV-PARATRRFIKRLHEEHDLPVLVFTD--GDPYGYLNIYRTLKVDKLSIPAARLIGV    206

Query        105 ---G--------------------------------------------------GI-E--    108
d1d3ya_      207 TPQDIIDYDLPTHPLKEQDIKRIKDGLKNDDFVRSFPEWQKALKQMLDMGVRAEQQSLAK    266

Query        109 Y--WRKENGEV------------EGTLGAKADLFWNMKKESLE    137
d1d3ya_      267 YGLKYVVNTYLPEKIKDESTWLP--------------------    289


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.54)
DALI match                                                  
Query         66 KRLSKEKVIITYCWGPACNGATKAAAKFA--QLGFRVKELIGG    106
d1d3ya_      137 ERFWDKHNCILVSLKGVPARATRRFIKRLHEEHDLPVLVFTDG    179



top
28: d1mwma2 Plasmid segregation protein ParM (svm: 1.578)

SCOP Superfamily: Actin-​like ATPase domain  |  SCOP Fold: Ribonuclease H-​like motif  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 386
Modified z-scores:
dali:0.84 daliz:0.87 gdtts:0.86 tmscore:0.86 rmsd:0.31 AHM:0.39 LBcontacta:0.80 LBcontactb:0.84 LHM:0.34
id:0.65 blosum:0.64 compass:0.62 pearson:0.78
Scaled scores:
dali:0.74 daliz:0.43 gdtts:0.59 tmscore:0.56 rmsd:0.77 AHM:0.65 LBcontacta:0.44 LBcontactb:0.66 LHM:0.24
id:0.02 blosum:0.11 compass:0.14 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:249.20)
Query          1 npneayrhymkklsyetdiadlsidiKKGY--EGIIVVDVRDA-----------------     41
d1mwma2        1 --------------------------QELDelDSLLIIDLGGTtldisqvmgklsgiski     34

Query         42 -----------------------------------------------------eaykech     48
d1mwma2       35 ygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrindenkisivtea     94

Query         49 iptaisipgNKINeDTTKRLSKEKVIITYCwgpacnGATKAAAKFAQLGFR----VKELI    104
d1mwma2       95 mnealrkleQRVL-NTLNEFSGYTHVMVIG-----gGAELICDAVKKHTQIrderFFKTN    148

Query        105 ---GGIEYWRKENgevegtlgakadlfwnmkkesle    137
d1mwma2      149 nsqYDLVNGMYLI---------------------gn    163


hit structure      alignment
FAST alignment (Normalized score: 2.54 Raw score:379.20)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE-------GIIVVDVRDAEAYKECHIP---     50
d1mwma2        1 -------------------------------QELDELDSLLIIDLG-----------GTT     18

Query         51 --------------TAISI-----------------------------------------     55
d1mwma2       19 LDISQVMGKLSGISKIYG-DSSLGVSLVTSAVKDALSLARTKGSSYLADDIIIHRKDNNY     77

Query         56 ------------------------PGNKINEDTTKRLSKE---KVIITYCWGPAC-NGAT     87
d1mwma2       78 LKQRINDENKISIVTEAMNEALRKLEQR-VLNTLNEF---SGYTHVMVI------GGGAE    127

Query         88 KAAAKFAQLGF-------RVKELIG---GIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1mwma2      128 LICDAVKK---HTQIRDERFFKTNNSQYDLVNGMY-------------------------    159

Query        138 ----    138
d1mwma2      160 LIGN    163


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:35.53)
Query          1 --------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAY--     44
d1mwma2        1 QELDELDSLLIIDL-----------------------------------------GGTTL     19

Query         45 ---------------------KECHI-PT-A------I---SIPGNKINEDTTKRLSKEK     72
d1mwma2       20 DISQVMGKLSGISKIYGDSSLGVSLVTSAVKDALSLARTKGSSYLADD------------     67

Query         73 VIITYCWGPACNGA-T-KAAAKFAQLGFRVK--ELI--GGIEYWRKEN------------    114
d1mwma2       68 ----II----IHRKDNNYLKQRIN--DENKISIVTEAMNEALRKLEQRVLNTLNEFSGYT    117

Query        115 -----GEVEGTLGAKADLFW-------------------NMKKES--LE-------    137
d1mwma2      118 HVMVI----------GGGAELICDAVKKHTQIRDERFFKTNNSQYDLVNGMYLIGN    163


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.16)
DALI match                        
Query         66 KRLSKEKVIITYCWGPA     82
d1mwma2        1 QELDELDSLLIIDLGGT     17



top
29: d1mkpa_ Mapk phosphatase (svm: 1.120)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 407
Modified z-scores:
dali:0.82 daliz:0.83 gdtts:0.86 tmscore:0.86 rmsd:0.34 AHM:0.38 LBcontacta:0.74 LBcontactb:0.82 LHM:0.13
id:0.36 blosum:0.37 compass:0.57 pearson:0.73
Scaled scores:
dali:0.68 daliz:0.36 gdtts:0.53 tmscore:0.51 rmsd:0.74 AHM:0.66 LBcontacta:0.36 LBcontactb:0.62 LHM:0.45
id:-0.03 blosum:0.05 compass:0.10 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 2.0 Raw score:210.30)
Query          1 -npneayrhymkklsyeTDIAdlSIDIKKGYegIIVVDVRDaEAYK---echiPTAISI-     55
d1mkpa_        1 asfpveilpflylgcakDSTN--LDVLEEFG-iKYILNVTP-NLPNlfenageFKYKQIp     56

Query         56 --------pgNKINedTTKR---LSKE--KVIITYCWGPaCNGATKAAAKFAQLGfrvke    102
d1mkpa_       57 isdhwsqnlsQFFP--EAISfidEARGknCGVLVHSLAG-ISRSVTVTVAYLMQK----l    109

Query        103 liggieywrkengevegtlgakadlfwnmkkesle    137
d1mkpa_      110 nlsmndaydivkmkksnispnfnfmgqlldfertl    144


hit structure      alignment
FAST alignment (Normalized score: 2.17 Raw score:305.30)
Query          1 NPNEAYRHYMKKLSYE-------------------TDIADLSIDIKKGYEG---IIVVDV     38
d1mkpa_        1 ----------------ASFPVEILPFLYLGCAKDSTNLDVLEE--------FGIKYILNV     36

Query         39 RDAEAYKECHI------------PTAISIPGNKI----------------NEDTTKRLS-     69
d1mkpa_       37 T----------PNLPNLFENAGEFKYKQI-----PISDHWSQNLSQFFPEAISFIDE--A     79

Query         70 --KEKVIITYCWGP--ACNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKA    125
d1mkpa_       80 RGKNCGVLVHS---LAGISRSVTVTVAYLM------------------------------    106

Query        126 DLFWNMKKESLE--------------------------------------    137
d1mkpa_      107 ------------QKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL    144


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:54.70)
Query          1 ---NPNEAYRHYMKKLSY-----ETD--IADLS-IDIKKGYEGIIVVDVRDAEAYKE---     46
d1mkpa_        1 ASF-----------PVEILPFLYLGCAKDS-TNLDVL-EEFGIKYILNVTP-NLPNLFEN     46

Query         47 CHIP--T-AISI-P-------GN-KINEDTTK-RLSK--EKVIITYCWGPACNGATKAAA     91
d1mkpa_       47 ---AGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHSLAG-ISRSVTVTV    102

Query         92 KFAQLGF----------RV--KE--LI-----------------GGIEYWRKENGEVEGT    120
d1mkpa_      103 AYLMQKLNLSMNDAYDI-VKMKKSN-ISPNFNFMGQLLDFERTL----------------    144

Query        121 LGAKADLFWNMKKESLE    137
d1mkpa_      145 -----------------    145


hit structure      alignment
HHsearch alignment (Probability: 0.29 E-value:0.00)
DALI match        ....      ....**********.............. ..  
Query         57 GNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQ-LGFR     99
d1mkpa_       69 FPEAISFIDEARGKNCGVLVHSLAGISRSVTVTVAYLMQKLNLS    112



top
30: d1uwca_ Feruloyl esterase A (svm: 0.837)

SCOP Superfamily: alpha/​beta-​Hydrolases  |  SCOP Fold: alpha/​beta-​Hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 483
Modified z-scores:
dali:0.86 daliz:0.90 gdtts:0.87 tmscore:0.87 rmsd:0.38 AHM:0.40 LBcontacta:0.83 LBcontactb:0.86 LHM:0.31
id:0.88 blosum:0.78 compass:0.65 pearson:0.91
Scaled scores:
dali:0.73 daliz:0.42 gdtts:0.54 tmscore:0.55 rmsd:0.73 AHM:0.66 LBcontacta:0.43 LBcontactb:0.70 LHM:0.28
id:0.07 blosum:0.13 compass:0.19 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.1 Raw score:278.60)
Query          1 npnEAYRhymkklsyetDIADL----------sidIKKG---------------------     29
d1uwca_        1 ---ASTQ--gisedlynRLVEMatisqaayadlcnIPSTiikgekiynaqtdingwilrd     55

Query         30 -YEGIIVVDV------------------------rdaeaykechiptaisipgNKINeDT     64
d1uwca_       56 dTSKEIITVFrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqDQVE-SL    114

Query         65 TKRLS---KEKVIITYCwGPAC-NGATKAAAKFAQLGFRVKELIG---------------    105
d1uwca_      115 VKQQAsqyPDYALTVTG-HSLGaSMAALTAAQLSATYDNVRLYTFgeprsgnqafasymn    173

Query        106 ------------------------------------------------------------    106
d1uwca_      174 dafqvsspettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevq    233

Query        106 ----------gieywRKENGEVegtlGAKAdlfwnmkkesle    137
d1uwca_      234 cceaqggqgvndahtTYFGMTS----GACT----------wv    261


hit structure      alignment
FAST alignment (Normalized score: 2.09 Raw score:395.70)
Query          1 NPNEAYRHYMKKLSYET------------DIADLSIDIKKG-------------------     29
d1uwca_        1 -----------------ASTQGISEDLYNRLVEMA------TISQAAYADLCNIPSTIIK     37

Query         30 -------------------YEGIIVVDVRDAEAYKECHIPTAISI---------------     55
d1uwca_       38 GEKIYNAQTDINGWILRDDTSKEIITV------------------FRGTGSDTNLQLDTN     79

Query         56 ---------------------------PGNKINEDTTKR---LSKEKVIITYCWGPA-CN     84
d1uwca_       80 YTLTPFDTLPQCNDCEVHGGYYIGWISVQDQV-ESLVKQQASQYPDYALTVT-GHSLGAS    137

Query         85 GATKAAAKFAQLG--FRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----    137
d1uwca_      138 MAALTAAQLSA--TYDNVRLY----------------------------------TFGEP    161

Query        138 ------------------------------------------------------------    138
d1uwca_      162 RSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSA    221

Query        138 ----------------------------------------    138
d1uwca_      222 QNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV    261


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:58.70)
Query          1 NPNEA--------YRHYMKKLSYETDIADLSID-------------IKKG----------     29
d1uwca_        1 ----ASTQGISED------------LYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNA     44

Query         30 ------------YEGIIVVDVRD-AEA---------------------------------     43
d1uwca_       45 QTDINGWILRDDTSKEIITVFRGT-GSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIG    103

Query         44 --YKECHIPTAISIPGN-KINEDTT-KRL--SKEKVIITYCWGPACNGATKAAAKFAQLG     97
d1uwca_      104 WI------------SVQDQVE-SLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATY    150

Query         98 FRVKELIGGI-----------------------------EY-------------------    109
d1uwca_      151 DNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGG    210

Query        110 -------------------------------------WRKENGEVEGTLGAK---ADLFW    129
d1uwca_      211 VEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTS----GACTWV-----    261

Query        130 NMKKESLE    137
d1uwca_      262 --------    262


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.06)
DALI match       *********.....********************** 
Query         70 KEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGG    106
d1uwca_      123 PDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFG    159



hit structures. 
top
31: d1i9sa_ mRNA capping enzyme,​ triphosphatase domain (svm: 0.653)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.31  Contact: 382
Modified z-scores:
dali:0.81 daliz:0.85 gdtts:0.79 tmscore:0.80 rmsd:0.38 AHM:0.35 LBcontacta:0.87 LBcontactb:0.88 LHM:0.18
id:0.95 blosum:0.88 compass:0.71 pearson:0.90
Scaled scores:
dali:0.70 daliz:0.38 gdtts:0.46 tmscore:0.46 rmsd:0.71 AHM:0.66 LBcontacta:0.48 LBcontactb:0.74 LHM:0.40
id:0.12 blosum:0.17 compass:0.21 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 1.8 Raw score:228.60)
Query          1 npneayrhymkkLSYE------------------------tdIADLSIDIKKGYEGI-IV     35
d1i9sa_        1 kipprwlncprrGQPVagrflplktmlgprydsqvaeenrfhPSMLSNYLKSLKVKMsLL     60

Query         36 VDVRDaeaYKEC--------hipTAISI------------pgnKINEdTTKRLskEKVII     75
d1i9sa_       61 VDLTN---TSRFydrndiekegiKYIKLqckghgecpttenteTFIR-LCERF--PELIG    114

Query         76 TYCWGpaCNGATKAAAKFAQLG--------------frvkeliggieywrkengevegtl    121
d1i9sa_      115 VHCTH-gFNRTGFLICAFLVEKmdwsieaavatfaqarppgiykgdylkelfrrygdiee    173

Query        122 gakadlfwnmkkesle    137
d1i9sa_      174 appppvlpdwcfeded    189


hit structure      alignment
FAST alignment (Normalized score: 2.00 Raw score:321.00)
Query          1 NPNEAYRHYMKKLSYE----------------------------------------TDIA     20
d1i9sa_        1 ----------------KIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPS     44

Query         21 DLSIDIKKGYEG-----IIVVDVRDAEAYKECHIP----------------TAISIPGN-     58
d1i9sa_       45 MLSNYLKS----LKVKMSLLVDLT-----------NTSRFYDRNDIEKEGIKYIKLQ--C     87

Query         59 -----KINEDTTKRLS--------KEKVIITYCWGPA---CNGATKAAAKFAQLGFRVKE    102
d1i9sa_       88 KGHGECPTTENTE---TFIRLCERFPELIGVHC----THGFNRTGFLICAFLV-------    133

Query        103 LIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-------------------------    137
d1i9sa_      134 -----------------------------------EKMDWSIEAAVATFAQARPPGIYKG    158

Query        138 -------------------------------    138
d1i9sa_      159 DYLKELFRRYGDIEEAPPPPVLPDWCFEDED    189


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:55.66)
Query          1 ------------NPNEAYRHYMKKLSY----ETD-----------------I--ADLS-I     24
d1i9sa_        1 KIPPRWLNCPRR-----------GQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNY     49

Query         25 DIKKGYEGIIVVDVRDAEAYKECH-I--PT-----AISIPG------N---KINE-DTTK     66
d1i9sa_       50 LKSLKVKMSLLVDLTN--T-SRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLC    106

Query         67 RLSKEKVIITYCWGPACNGATKAAAKFAQLGF---------RVKE--LI-----------    104
d1i9sa_      107 ERF-PELIGVHCTHG-FNRTGFLICAFLVEKMDWSIEAAVA--TFAQARPPGIYKGDYLK    162

Query        105 ---------------------------GGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1i9sa_      163 ELFRRYGDIEEAPPPPVLPDWCFEDED---------------------------------    189


hit structure      alignment
HHsearch alignment (Probability: 0.22 E-value:0.00)
DALI match        .... .....  ********** .............. ..   
Query         58 NKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQ-LGFRV    100
d1i9sa_       97 ENTETFIRLCERFPELIGVHCTHGFNRTGFLICAFLVEKMDWSI    140



top
32: d1yaca_ YcaC (svm: 1.012)

SCOP Superfamily: Isochorismatase-​like hydrolases  |  SCOP Fold: Isochorismatase-​like hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.31  Contact: 542
Modified z-scores:
dali:0.81 daliz:0.88 gdtts:0.81 tmscore:0.79 rmsd:0.37 AHM:0.38 LBcontacta:0.81 LBcontactb:0.85 LHM:0.21
id:0.97 blosum:0.77 compass:0.65 pearson:0.85
Scaled scores:
dali:0.74 daliz:0.44 gdtts:0.51 tmscore:0.50 rmsd:0.75 AHM:0.70 LBcontacta:0.45 LBcontactb:0.70 LHM:0.43
id:0.14 blosum:0.14 compass:0.19 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:286.80)
Query          1 npneayrHYMKklsyetdiadlsidikkgYEGIIVVDVRDAE----------------ay     44
d1yaca_        1 -------TKPY--------------vrldKNDAAVLLVDHQAgllslvrdiepdkfknnv     39

Query         45 kecHIPT------AISI-----------------------------pgNKIN-EDTTKR-     67
d1yaca_       40 lalGDLAkyfnlpTILTtsaetgpngplvpelkaqfpdapyiarpgniNAWDnEDFVKAv     99

Query         68 LSKEK-VIITYCWgpaCNGATKAAAKFAQLGFRVKELIGG--------------------    106
d1yaca_      100 KATGKkQLIIAGV-vtEVCVAFPALSAIEEGFDVFVVTDAsgtfneitrhsawdrmsqag    158

Query        107 ----------------------ieywrKENGevegtlgakadlfwnmkkesle    137
d1yaca_      159 aqlmtwfgvacelhrdwrndiaglatlFSNH-------ipdyrnlmtsydtlt    204


hit structure      alignment
FAST alignment (Normalized score: 2.37 Raw score:396.60)
Query          1 NPNEAYRHYMKKLSYET--------------------------------------DIADL     22
d1yaca_        1 -----------------TKPYVRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALG     43

Query         23 SIDIKKGYEGIIVVDVRDAEAYKECHI-------------------PTAISIPGNKI---     60
d1yaca_       44 DLAKYFN---LPTILT-----------TSAETGPNGPLVPELKAQFPDAPYI-----ARP     84

Query         61 ----------NEDTTKRLSKE--KVIITYCWGPA---CNGATKAAAKFAQLGFRVKELIG    105
d1yaca_       85 GNINAWDNEDFVKAVKAT---GKKQLIIAG----VVTEVCVAFPALSAIEEGFDVFVVT-    136

Query        106 GIEYWRKENGEVEGTLGAKADLFWNMKKESLE----------------------------    137
d1yaca_      137 --------------------------------DASGTFNEITRHSAWDRMSQAGAQLMTW    164

Query        138 ----------------------------------------    138
d1yaca_      165 FGVACELHRDWRNDIAGLATLFSNHIPDYRNLMTSYDTLT    204


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:58.35)
Query          1 -NPNEAYR-HYMKKLS---------------------------YETD--IA-DLSIDIKK     28
d1yaca_        1 T------KP--YV-RLDKNDAAVLLVDHQAGLLSLVRDIEPDK---FKNNVLALGDLAKY     48

Query         29 GYEGIIVVDVRDAEA--YKECH--I--PT--AISI-P-----G-NKINEDT-TKRLSKEK     72
d1yaca_       49 -FN-LPTILTTSAETGPNGPLVPELKAQFPDAPYIARPGNINAWDNEDFVKAVKATGKK-    105

Query         73 VIITYCWGPACNGATKAAAKFAQLGFRVKELI-GGIE-----------------------    108
d1yaca_      106 QLIIAGVVT-EVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRMSQAGAQLMTW    164

Query        109 -----------------------YWRKENG---------------EVEGTLGAKADLFWN    130
d1yaca_      165 FGVACELHRDWRNDIAGLATLFS-----NHIPDYRNLMTSYDTLT---------------    204

Query        131 MKKESLE    137
d1yaca_      205 -------    205


hit structure      alignment
HHsearch alignment (Probability: 0.09 E-value:0.01)
DALI match               ...................... . ....  ******************   
Query         50 PTAISIPGNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGIEY    109
d1yaca_       84 PGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAF--PALSAIEEGFDVFVVTDASGT    141

DALI match           
Query        110 WRKE    113
d1yaca_      142 FNEI    145



top
33: d1ecfa1 Glutamine PRPP amidotransferase,​ C-​terminal domain (svm: 0.985)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.40  Contact: 493
Modified z-scores:
dali:0.77 daliz:0.79 gdtts:0.85 tmscore:0.84 rmsd:0.37 AHM:0.31 LBcontacta:0.77 LBcontactb:0.79 LHM:0.17
id:0.52 blosum:0.27 compass:0.53 pearson:0.82
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.52 tmscore:0.51 rmsd:0.72 AHM:0.71 LBcontacta:0.39 LBcontactb:0.58 LHM:0.42
id:-0.01 blosum:0.04 compass:0.12 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 2.5 Raw score:274.50)
Query          1 ---------------npneayrhymkklsyetdIADLSIDIkkGYEGI-IVVDVRdAEAY     44
d1ecfa1        1 npclfeyvyfarpdsfidkisvysarvnmgtklGEKIAREW--EDLDIdVVIPIP-ETSC     57

Query         45 keCHIP-------TAISIP------------------------gNKINEDTTkrlskekV     73
d1ecfa1       58 -dIALEiarilgkPYRQGFvknryvgrtfimpgqqlrrksvrrkLNANRAEF----rdkN    112

Query         74 IITYCWGPA-CNGATKAAAKFAQLGF-RVKELigGIEY----------------------    109
d1ecfa1      113 VLLVDDSIVrGTTSEQIIEMAREAGAkKVYLA--SAAPeirfpnvygidmpsateliahg    170

Query        110 -----------------WRKENG----------------------------evegtlgak    124
d1ecfa1      171 revdeirqiigadglifQDLNDLidavraenpdiqqfecsvfngvyvtkdvdqgyldfld    230

Query        125 adlfwnmkkesle    137
d1ecfa1      231 tlrnddakavqrq    243


hit structure      alignment
FAST alignment (Normalized score: 2.53 Raw score:461.50)
Query          1 NPNEAYRHYMKKLSYET--------------------------------DIADLSIDIKK     28
d1ecfa1        1 -----------------NPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWED     43

Query         29 GYEG---IIVVDVR--DAEAYKECHI-------PTAISIPG-------------------     57
d1ecfa1       44 ----LDIDVVIPIPETSCDIAL----EIARILGKPYRQ---GFVKNRYVGRTFIMPGQQL     92

Query         58 --------NKINEDTTKRLSKEKVIITYCW-GPACNGATKAAAKFAQLG-FRVKELIGGI    107
d1ecfa1       93 RRKSVRRKLNANRAEF----RDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLA----    144

Query        108 EYWRKENGEVEGTLGAKADLFWNMKKESLE------------------------------    137
d1ecfa1      145 ------------------------------SAAPEIRFPNVYGIDMPSATELIAHGREVD    174

Query        138 ------------------------------------------------------------    138
d1ecfa1      175 EIRQIIGADGLIFQDLNDLIDAVRAENPDIQQFECSVFNGVYVTKDVDQGYLDFLDTLRN    234

Query        138 ---------    138
d1ecfa1      235 DDAKAVQRQ    243


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:63.62)
Query          1 --------------------------------NPNEAYRHYMKKLSYETDI-ADLSIDIK     27
d1ecfa1        1 NPCLFEYVYFARPDSFIDKISVYSARVNMGTK------------------LGEKIAREW-     41

Query         28 KGYEGIIVVDVRDAEAYKECHI--PT------AIS-IPG---------------------     57
d1ecfa1       42 EDLDIDVVIPIPE--TSC-DIALEIARILGKPYRQGFVKNRYVGRTFIMPGQQLRRKSVR     98

Query         58 --NKINEDTTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFRVKELIGGIEY-----    109
d1ecfa1       99 RKLNA---NRAEFRD-KNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLA-SAAPEIRFP    153

Query        110 ----------------------------------WRKENG-EVEGTL-GAK--------A    125
d1ecfa1      154 NVYGIDMPSATELIAHGREVDEIRQIIGADGLIFQDLNDLIDA---VR-AENPDIQQFE-    208

Query        126 DL-F--------------------------------WNMKKESLE    137
d1ecfa1      209 -CSVFNGVYVTKDVDQGYLDFLDTLRNDDAKAVQRQ---------    243


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.37)
DALI match          **********.............
Query         70 KEKVIITYCWGPACNGATKAAAKFAQ     95
d1ecfa1      109 RDKNVLLVDDSIVRGTTSEQIIEMAR    134



top
34: d1fpza_ Kinase associated phosphatase (kap) (hh: 0.961)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.12  Contact: 389
Modified z-scores:
dali:0.78 daliz:0.79 gdtts:0.83 tmscore:0.81 rmsd:0.38 AHM:0.35 LBcontacta:0.78 LBcontactb:0.77 LHM:0.13
id:0.85 blosum:0.37 compass:0.55 pearson:0.81
Scaled scores:
dali:0.67 daliz:0.33 gdtts:0.50 tmscore:0.46 rmsd:0.73 AHM:0.67 LBcontacta:0.38 LBcontactb:0.54 LHM:0.51
id:0.06 blosum:0.06 compass:0.15 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 1.9 Raw score:236.50)
Query          1 ------------------npneayrhymkklsyetDIADLSIDIKKGYEgIIVVdVRDAE     42
d1fpza_        1 tpihiswlslsrvncsqflglcalpgckfkdvrrnVQKDTEELKSCGIQ-DIFV-FCTRG     58

Query         43 AYK----ECHIP-------TAISIPGN---KINEDTTKR---LSKEK------VIITYCw     79
d1fpza_       59 ELSkyrvPNLLDlyqqcgiITHHHPIAdggTPDIASCCEimeELTTClknyrkTLIHSY-    117

Query         80 gpacnGATKAAAKFAQLG------frvkeliggieywrkengevegtlgakadlfwnmkk    133
d1fpza_      118 -----GGLGRSCLVAACLllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdkl    172

Query        134 esle    137
d1fpza_      173 aahl    176


hit structure      alignment
FAST alignment (Normalized score: 1.31 Raw score:202.90)
Query          1 NPNEAYRHYMKKLSYETD------------------------------------IADLSI     24
d1fpza_        1 ------------------TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEE     42

Query         25 DIKKGYEG---IIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKE----------     71
d1fpza_       43 LKS-----CGIQDIFVFCTRGELS--------------------------KYRVPNLLDL     71

Query         72 ----KVIITYCWGPA------------CNGATKAAAKFAQLGFRVKELIGGIEYWRKENG    115
d1fpza_       72 YQQCGIITHHH----PIADGGTPDIASCCEIMEELTTCLKNYRKTLI-------------    114

Query        116 EVEGTLGAKADLFWNMKKESLE--------------------------------------    137
d1fpza_      115 ----------------------HSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRG    152

Query        138 ------------------------    138
d1fpza_      153 SGAIQTIKQYNYLHEFRDKLAAHL    176


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:51.01)
Query          1 ---------NPNEAYRHYMKKLSYETDIADLSI-DIK-KGYEGIIVVDVRDAEAYKECHI     49
d1fpza_        1 TPIHISWLS-----------------------LS-RVNCSQF--L---------------     19

Query         50 PTAISIPGN------K-INEDT-TK--RLSKEKVIITYCWGPACN--G----ATKAAAKF     93
d1fpza_       20 -GLCALPGCKFKDVRRNVQ-KDTEELKSCGI-QDIFVFC----TRGELSKYRVPNLLDLY     72

Query         94 AQLGFRVKELIGGI-EY--------------------------------W--RK--E---    113
d1fpza_       73 QQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLL    132

Query        114 -------N--GE--V---EGTLGAKADLF----------------WNMKKESLE    137
d1fpza_      133 YLSDTISPEQAIDSLRDLRGSGAI-QTIKQYNYLHEFRDKLAAHL---------    176


hit structure      alignment
HHsearch alignment (Probability: 0.60 E-value:0.00)
DALI match                       ......                    
Query         57 GNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGF     98
d1fpza_       95 CCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSD    136



top
35: d1hf2a2 Cell-​division inhibitor MinC,​ N-​terminal domain (svm: 0.617)

SCOP Superfamily: Cell-​division inhibitor MinC,​ N-​terminal domain  |  SCOP Fold: Cell-​division inhibitor MinC,​ N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.46  Contact: 385
Modified z-scores:
dali:0.77 daliz:0.78 gdtts:0.82 tmscore:0.82 rmsd:0.37 AHM:0.43 LBcontacta:0.67 LBcontactb:0.72 LHM:0.21
id:0.88 blosum:0.91 compass:0.71 pearson:0.92
Scaled scores:
dali:0.67 daliz:0.33 gdtts:0.51 tmscore:0.47 rmsd:0.69 AHM:0.58 LBcontacta:0.35 LBcontactb:0.53 LHM:0.25
id:0.08 blosum:0.19 compass:0.10 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 2.3 Raw score:183.70)
Query          1 npneayrhymkklsyetdiadLSIDikkgyegiIVVDVRDAEaykechiptaisiPGNKI     60
d1hf2a2        1 ----------------mvdfkMTKE-------gLVLLIKDYQ---------nleeVLNAI     28

Query         61 NeDTTKR----LSKEKVIITYCW-GPACN-gATKAAAKFAQLGFRVKELiggIEYWRken    114
d1hf2a2       29 S-ARITQmggfFAKGDRISLMIEnHNKHSqdIPRIVSHLRNLGLEVSQI--lVGKVQ---     82

Query        115 gevegtlgakadlfwnmkkesle    137
d1hf2a2       83 ----------------srttves     89


hit structure      alignment
FAST alignment (Normalized score: 3.28 Raw score:362.20)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEG---------IIVVDVRDAEAYKECHIPT     51
d1hf2a2        1 --------------------------------MVDFKMTKEGLVLLI-------------     15

Query         52 AISI--------PGNKINEDTTK----RLSKEKVIITYC-WGPA-CNGATKAAAKFAQLG     97
d1hf2a2       16 ----KDYQNLEEVLNA-ISARITQMGGFFAKGDRISLMIENHNKHSQDIPRIVSHLRNLG     70

Query         98 FR-VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE------------    137
d1hf2a2       71 LEVSQIL----------------------------------VGKVQSRTTVES     89


hit structure      alignment
TMalign alignment (TM-score: 0.35 Raw score:48.60)
Query          1 ------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDA----EAYKECHIP     50
d1hf2a2        1 MVDFKM-------------------------T--KE--GLVLLIKDYQNLE---------     22

Query         51 TAISIPGN-KINEDTTK-R--LSK-EKVIITYC--WGPACNGATKAAAKFAQLGFRVKEL    103
d1hf2a2       23 -----EVLNAIS-ARITQMGGFFAKGDRISLMIENHNKHSQDIPRIVSHLRNLGLEVSQI     76

Query        104 IGGIEYWRKE------NGEVEGTLGAKADLFWNMKKESLE    137
d1hf2a2       77 L-VGKVQ--SRTTVES------------------------     89


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.38)
DALI match       ***************** . 
Query         87 TKAAAKFAQLGFRVKELIGG    106
d1hf2a2       60 PRIVSHLRNLGLEVSQILVG     79



hit structures. 
top
36: d1im5a_ Pyrazinamidase/​nicotinamidase (svm: 0.715)

SCOP Superfamily: Isochorismatase-​like hydrolases  |  SCOP Fold: Isochorismatase-​like hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.20  Contact: 552
Modified z-scores:
dali:0.82 daliz:0.90 gdtts:0.76 tmscore:0.76 rmsd:0.41 AHM:0.43 LBcontacta:0.82 LBcontactb:0.79 LHM:0.39
id:0.89 blosum:0.63 compass:0.59 pearson:0.79
Scaled scores:
dali:0.74 daliz:0.46 gdtts:0.50 tmscore:0.49 rmsd:0.70 AHM:0.61 LBcontacta:0.47 LBcontactb:0.63 LHM:0.15
id:0.10 blosum:0.12 compass:0.10 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:268.20)
Query          1 npneayrhymkklsyetdiadlsidikkgyEGIIVVDVRDAE----------------ay     44
d1im5a_        1 ------------------------------PEEALIVVDMQRdfmpggalpvpegdkiip     30

Query         45 keCHIP--------tAISIP----------------------------------------     56
d1im5a_       31 kvNEYIrkfkekgalIVATRdwhpenhisfrerggpwprhcvqntpgaefvvdlpedavi     90

Query         57 ----------gNKIN--EDTTKRLS--keKVIITYCWgpaCNGATKAAAKFAQLGFRVKE    102
d1im5a_       91 iskatepdkeaYSGFegTDLAKILRgngvKRVYICGV-atEYCVRATALDALKHGFEVYL    149

Query        103 LIGGIEywrkengevegtlgakadlfWNMK--------------kesle    137
d1im5a_      150 LRDAVK-------------------gIKPEdeeraleemksrgikivqf    179


hit structure      alignment
FAST alignment (Normalized score: 2.98 Raw score:467.30)
Query          1 NPNEAYRHYMKKLSYET-------------------------------DIADLSIDIKKG     29
d1im5a_        1 -----------------PEEALIVVDMQRDFMPGGALPVPEGDKIIPKVNEYIRKFKEK-     42

Query         30 YEGIIVVDVRDAEAYKECH---------------------------------IPTAISIP     56
d1im5a_       43 --GALIVATRD--------WHPENHISFRERGGPWPRHCVQNTPGAEFVVDLPEDAVIIS     92

Query         57 GNKI-----------------NEDTTKRLSKE--KVIITYCWGPA-----CNGATKAAAK     92
d1im5a_       93 ----KATEPDKEAYSGFEGTDLAKILRGN---GVKRVYI------CGVATEYCVRATALD    139

Query         93 FAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE---------------    137
d1im5a_      140 ALKHGFEVYLLR---------------------------------DAVKGIKPEDEERAL    166

Query        138 -------------    138
d1im5a_      167 EEMKSRGIKIVQF    179


hit structure      alignment
TMalign alignment (TM-score: 0.24 Raw score:32.20)
Query          1 ------------------------------------------------------------      1
d1im5a_        1 PEEALIVVDMQRDFMPGGALPVPEGDKIIPKVNEYIRKFKEKGALIVATRDWHPENHISF     60

Query          1 -----------------------NPNEAYRHYMKKLSYETDI----------------AD     21
d1im5a_       61 RERGGPWPRHCVQNTPGAEFVVD----------LPED-AVIISKATEPDKEAYSGFEGTD    109

Query         22 LSIDIKKGYEGIIVVDVRDAEA-YKECH--IP----T-AISIPGNKI-------------     60
d1im5a_      110 LAKILRGNGVKRVYICGVATEYCVR-ATALDALKHGFEVYLLR--DAVKGIKPEDEERAL    166

Query         61 ---------NEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGIEYWR    111
d1im5a_      167 EEMKSRGIK--IVQF---------------------------------------------    179

Query        112 KENGEVEGTLGAKADLFWNMKKESLE    137
d1im5a_      180 --------------------------    180


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match       ........ ......... . ....  ******************** 
Query         62 EDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGIEY    109
d1im5a_      111 AKILRGNGVKRVYICGVATEYCVRA--TALDALKHGFEVYLLRDAVKG    156



top
37: d1g4us2 SptP tyrosine phosphatase,​ catalytic domain (svm: 0.619)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.46  Contact: 402
Modified z-scores:
dali:0.85 daliz:0.82 gdtts:0.84 tmscore:0.86 rmsd:0.48 AHM:0.48 LBcontacta:0.88 LBcontactb:0.90 LHM:0.24
id:0.86 blosum:0.58 compass:0.74 pearson:0.94
Scaled scores:
dali:0.69 daliz:0.33 gdtts:0.42 tmscore:0.41 rmsd:0.70 AHM:0.60 LBcontacta:0.40 LBcontactb:0.63 LHM:0.29
id:0.05 blosum:0.10 compass:0.12 pearson:0.20

hit structure      alignment
DALI alignment (Z-score: 1.7 Raw score:227.20)
Query          1 nPNEAY--------------rhYMKKL----------SYET-------------------     17
d1g4us2        1 -PQTMSgptlglarfavssipiNQQTQvklsdgmpvpVNTLtfdgkpvalagsypkntpd     59

Query         18 dIADLSIDIkKGYEGIIVVDVRDAEA---ykECHIP------------------------     50
d1g4us2       60 aLEAHMKML-LEKECSCLVVLTSEDQmqakqLPPYFrgsytfgevhtnsqkvssasqgea    118

Query         51 -----------------tAISIP---------gnkiNEDTTKRLSKeKVIITYCWGpaCN     84
d1g4us2      119 idqynmqlscgekrytipVLHVKnwpdhqplpstdqLEYLADRVKNkHLPMIHCLG-gVG    177

Query         85 GATKAAAKFAQLGfrvkeliggieywrkengevegtlgakadlfwnmkkesle    137
d1g4us2      178 RTGTMAAALVLKDnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm    230


hit structure      alignment
FAST alignment (Normalized score: 2.21 Raw score:392.50)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d1g4us2        1 -----------------PQTMSGPTLGLARFAVSSIPINQQTQVKLSDGMPVPVNTLTFD     43

Query         18 ----------------DIADLSIDIKKGYEGIIVVDVRDAEAYKECHIP-----------     50
d1g4us2       44 GKPVALAGSYPKNTPDALEAHMKMLLEKEC-SCLVVLTSEDQMQA----KQLPPYFRGSY     98

Query         51 -------------------------------------TAISIPGNKI-------------     60
d1g4us2       99 TFGEVHTNSQKVSSASQGEAIDQYNMQLSCGEKRYTIPVLHV-----KNWPDHQPLPSTD    153

Query         61 -NEDTTKRLSKE----KVIITYCWGPA---CNGATKAAAKFAQLGFRVKELIGGIEYWRK    112
d1g4us2      154 QLEYLADR----VKNKHLPMIHC----LGGVGRTGTMAAALVL-----------------    188

Query        113 ENGEVEGTLGAKADLFWNMKKESLE-----------------------------------    137
d1g4us2      189 -------------------------KDNPHSNLEQVRADFRDSRNNRMLEDASQFVQLKA    223

Query        138 -------    138
d1g4us2      224 MQAQLLM    230


hit structure      alignment
TMalign alignment (TM-score: 0.41 Raw score:56.78)
Query          1 ----------------------NPNEAYRHYMKK----------LSY--------ETD--     18
d1g4us2        1 PQTMSGPTLGLARFAVSSIPIN-------QQTQVKLSDGMPVPVNTLTFDGKPVALAGSY     53

Query         19 I-----A--DLSIDIKKGYEGIIVVDVRDAEAYK---ECHIP------------------     50
d1g4us2       54 PKNTPDALEAHMKML-LEKECSCLVVLTSEDQMQAKQLPPYFRGSYTFGEVHTNSQKVSS    112

Query         51 -----------T------------AISI--P----GN----KINEDTTKRLSKEKVIITY     77
d1g4us2      113 ASQGEAIDQYNMQLSCGEKRYTIPVLHVKNWPDHQPLPSTDQLE-YLADRVKNKHLPMIH    171

Query         78 CWGPACNGATKAAAKFAQLGF-----------RVK---ELI-------------------    104
d1g4us2      172 CLGG-VGRTGTMAAALVLKDNPHSNLEQVRAD--FRDS--RNNRMLEDASQFVQLKAMQA    226

Query        105 ----GGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1g4us2      227 QLLM---------------------------------    230


hit structure      alignment
HHsearch alignment (Probability: 0.16 E-value:0.00)
DALI match       ******** ********* ................
Query         63 DTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLG     97
d1g4us2      157 YLADRVKNKHLPMIHCLGGVGRTGTMAAALVLKDN    191



top
38: d1lw3a2 Myotubularin-​related protein 2,​ C-​terminal domain (svm: 1.395)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 475
Modified z-scores:
dali:0.90 daliz:0.90 gdtts:0.86 tmscore:0.88 rmsd:0.45 AHM:0.46 LBcontacta:0.87 LBcontactb:0.87 LHM:0.38
id:0.63 blosum:0.39 compass:0.50 pearson:0.78
Scaled scores:
dali:0.72 daliz:0.38 gdtts:0.44 tmscore:0.47 rmsd:0.72 AHM:0.67 LBcontacta:0.39 LBcontactb:0.58 LHM:0.28
id:0.00 blosum:0.06 compass:0.10 pearson:0.10

hit structure      alignment
DALI alignment (Z-score: 1.6 Raw score:274.50)
Query          1 ------npneaYRHYMK-------------------------------------------     11
d1lw3a2        1 evfpengwklyDPLLEYrrqgipneswritkineryelcdtypallvvpanipdeelkrv     60

Query         12 ----------------------------------klsyetDIADLSIDIKKG--YEGIIV     35
d1lw3a2       61 asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskeDEKYLQAIMDSNaqSHKIFI    120

Query         36 VDVRDAEAYKE------CHIP-------TAISIPG-------------------------     57
d1lw3a2      121 FDARPSVNAVAnkakggGYESedayqnaELVFLDIhnihvmreslrklkeivypnieeth    180

Query         58 --------------nKINE--dttkRLSK--EKVIITYCWGpaCNGATKAAAKFAQLG--     97
d1lw3a2      181 wlsnlesthwlehikLILAgalriaDKVEsgKTSVVVHSSD-gWDRTAQLTSLAMLMLdg    239

Query         98 -frvkeliggieywrkengevegtlgakadlfwnmKKES---------------------    135
d1lw3a2      240 yyrtirgfevlvekewlsfghrfqlrvghgdknhaDADRspvflqfidcvwqmtrqfpta    299

Query        136 ------------------------------------------------------------    136
d1lw3a2      300 fefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplyg    359

Query        136 ---------------------------le    137
d1lw3a2      360 sysnhvlypvasmrhlelwvgyyirwnpr    388


hit structure      alignment
FAST alignment (Normalized score: 1.93 Raw score:444.00)
Query          1 NPNEAYRHYMKKLSYETD------------------------------------------     18
d1lw3a2        1 ------------------EVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTY     42

Query         19 -------------------------------------------------------IADLS     23
d1lw3a2       43 PALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDE    102

Query         24 IDIKKGYE---------GIIVVDVRDAEAYK------ECHI-------PTAISIPGNKIN     61
d1lw3a2      103 KYLQA---IMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLD-----    154

Query         62 ----------------------------------------------EDTTKRLS---KEK     72
d1lw3a2      155 IHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADK-VESGKT    213

Query         73 VIITYCWGPA---CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFW    129
d1lw3a2      214 SVVVHS----SDGWDRTAQLTSLAML----------------------------------    235

Query        130 NMKKESLE----------------------------------------------------    137
d1lw3a2      236 --------MLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFID    287

Query        138 ------------------------------------------------------------    138
d1lw3a2      288 CVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYIN    347

Query        138 -----------------------------------------    138
d1lw3a2      348 SQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPR    388


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:62.67)
Query          1 -----------NPNEAYRH-Y-----------M---------------KKL---------     13
d1lw3a2        1 EVFPENGWKLY----DPLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEE     56

Query         14 ---------------SY----------ETD--I--------A-DLSIDIKKGY------E     31
d1lw3a2       57 LKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSH    116

Query         32 GIIVVDVRDAEAYKE------CHIP-------TAISIPG---------------------     57
d1lw3a2      117 KIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNI    176

Query         58 ----------------N--K-INEDTT-KRLSK--EKVIITYCWGPACNGATKAAAKFAQ     95
d1lw3a2      177 EETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHSSDG-WDRTAQLTSLAML    235

Query         96 LGF---------------RVKE---LI-----------------GGIEYWRKENGEVEGT    120
d1lw3a2      236 MLDGYYRTIRGFEVLVEK---EWLS-FGHRFQLRVGHGDKNHAD----------------    275

Query        121 LGAKADLFWNMK------------------------------------------------    132
d1lw3a2      276 ----------ADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCN    325

Query        133 ------------------------------------------------------------    133
d1lw3a2      326 SEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRW    385

Query        133 ---KESLE    137
d1lw3a2      386 NPR-----    388


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.11)
DALI match          ...... ********* ...........
Query         63 DTTKRLSKE-KVIITYCWGPACNGATKAAAK     92
d1lw3a2      203 RIADKVESGKTSVVVHSSDGWDRTAQLTSLA    233



top
39: d1dd9a_ DNA primase DnaG catalytic core (svm: 0.621)

SCOP Superfamily: DNA primase core  |  SCOP Fold: DNA primase core  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.26  Contact: 491
Modified z-scores:
dali:0.85 daliz:0.82 gdtts:0.88 tmscore:0.89 rmsd:0.39 AHM:0.44 LBcontacta:0.82 LBcontactb:0.80 LHM:0.31
id:0.94 blosum:0.80 compass:0.60 pearson:0.91
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.50 tmscore:0.51 rmsd:0.72 AHM:0.61 LBcontacta:0.40 LBcontactb:0.56 LHM:0.21
id:0.09 blosum:0.14 compass:0.14 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:255.70)
Query          1 ------------------------------------------------------------      1
d1dd9a_        1 tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg     60

Query          1 --------------------------------------------------npneayrhym     10
d1dd9a_       61 npenrqslidagmlvtnrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnspetd    120

Query         11 kklsyetdiadlsidikkGYEGIIVVDVrdAEAYKECH----IPTAISIPgNKINEDTTK     66
d1dd9a_      121 ifhkgrqlyglyeaqqdnAEPNRLLVVE--GYMDVVALaqygINYAVASL-GSTTADHIQ    177

Query         67 RLS--kEKVIITYCwgpaCNGATKAAAKFAQLG--------fRVKELI---GGIEYWRKE    113
d1dd9a_      178 LLFratNNVICCYD---gDRAGRDAAWRALETAlpymtdgrqLRFMFLpdgEDPDTLVRK    234

Query        114 NGE----------------------------------------------------vegtl    121
d1dd9a_      235 EGKeafearmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylr    294

Query        122 gakadlfwnmkkesle    137
d1dd9a_      295 qelgnklgilddsqle    310


hit structure      alignment
FAST alignment (Normalized score: 2.27 Raw score:468.80)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGY------------------------------     30
d1dd9a_        1 ------------------------------TLYQLMDGLNTFYQQSLQQPVATSARQYLE     30

Query         31 ------------------------------------------------------------     31
d1dd9a_       31 KRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNRSYDRFRERVMFP     90

Query         31 --------------------------------------------------EGIIVVDVRD     40
d1dd9a_       91 IRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLV-VEG    149

Query         41 AEAYKECH------IPTAISIPGN--KINEDTTKRLSKE--KVIITYCWGPA-CNGATKA     89
d1dd9a_      150 YMDVV---ALAQYGINYAVAS---LGSTTADHIQL-LFRATNNVICCYD---GDRAGRDA    199

Query         90 AAKFAQLG---------FRVKELIG-------GIEYWRKENGEVEGTLGAKADLFWNMKK    133
d1dd9a_      200 AWRALE--TALPYMTDGRQLRFM--FLPDGEDPDTLVRKE--------------------    235

Query        134 ESLE--------------------------------------------------------    137
d1dd9a_      236 ----GKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRI    291

Query        138 -------------------    138
d1dd9a_      292 YLRQELGNKLGILDDSQLE    310


hit structure      alignment
TMalign alignment (TM-score: 0.30 Raw score:41.55)
Query          1 NPNEAYRHYMKKLSYE-TDIADLSIDIKKGYE--GII------VVDVRDAEAYKEC--HI     49
d1dd9a_        1 --------T-LYQLMDGLN-TFYQQSLQQPVATS--ARQYLEK---------RGLSHEVI     39

Query         50 ----PTA----------------------------------ISIPGNKINEDTTKRLSKE     71
d1dd9a_       40 ARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNRSY----------------DRF     83

Query         72 KVI-ITYCWGPA-C-NGATK------------AAAKFA---------QLGFRVKELIGGI    107
d1dd9a_       84 RERVMFPI-RDKRGRVIGFGGRVLGNDTPKYLNSPE-TDIFHKGRQL-----------YG    130

Query        108 --EY-WRK----------------ENGEVEGTLGAKADLFWN------------M-----    131
d1dd9a_      131 LYEAQ-QDNAEPNRLLVVEGYMDV-----VALAQYGINYAVASLGSTTADHIQLLFRATN    184

Query        132 -KKE-----------------------------SLE------------------------    137
d1dd9a_      185 NVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARM    244

Query        138 ------------------------------------------------------------    138
d1dd9a_      245 EQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGIL    304

Query        138 ------    138
d1dd9a_      305 DDSQLE    310


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.16)
DALI match       ***** .. ************ ........   . *************         ...
Query         49 IPTAISIPGNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQL-------GFRVK    101
d1dd9a_      161 INYAV-ASLGSTTADHIQLLFRATNNVICCYDGD-RAGRDAAWRALETALPYMTDGRQLR    218

DALI match       ...
Query        102 ELI    104
d1dd9a_      219 FMF    221



top
40: d1t6ca2 Exopolyphosphatase Ppx (svm: 0.711)

SCOP Superfamily: Actin-​like ATPase domain  |  SCOP Fold: Ribonuclease H-​like motif  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.31  Contact: 314
Modified z-scores:
dali:0.75 daliz:0.80 gdtts:0.75 tmscore:0.75 rmsd:0.32 AHM:0.37 LBcontacta:0.74 LBcontactb:0.78 LHM:0.25
id:0.86 blosum:0.74 compass:0.63 pearson:0.85
Scaled scores:
dali:0.73 daliz:0.41 gdtts:0.50 tmscore:0.44 rmsd:0.75 AHM:0.64 LBcontacta:0.45 LBcontactb:0.67 LHM:0.26
id:0.08 blosum:0.12 compass:0.14 pearson:0.23

hit structure      alignment
DALI alignment (Z-score: 1.3 Raw score:194.50)
Query          1 npneayrhymkklsyetdiadlsidikkgYEGIIVVDVRDA-------------------     41
d1t6ca2        1 ----------------------------pEGEVCVVDQGGGsteyvfgkgykvrevislp     32

Query         42 --------eaykechiptaisipgnkiNEDTTKRLSKEK-VIITYCwgpacNGAT-----     87
d1t6ca2       33 igivnltetffkqdppteeevkrffefLEKELSKVKKPVdTIVGLG-----GTITtlaal     87

Query         88 --------------------------------------------------------kaAA     91
d1t6ca2       88 eynvypydpqkvhgkvltygqikkwfdtfkeipseerskrfrqvedrrakvilagigiFL    147

Query         92 KFAQLG--fRVKELIGGIEYWRKENgevegtlgakadlfwnmkkesle    137
d1t6ca2      148 KTLEIFekdCLIVSDWGLREGVLVS---------------evlkenhs    180


hit structure      alignment
FAST alignment (Normalized score: 2.56 Raw score:401.80)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIP----------     50
d1t6ca2        1 ----------------------------PEGEVCVVDQG-----------GGSTEYVFGK     21

Query         51 -----TAIS--IPGNKI-----------------------NEDTTKRLSKE-----KVII     75
d1t6ca2       22 GYKVREVISLPIGIV--NLTETFFKQDPPTEEEVKRFFEFLEKELSK----VKKPVDTIV     75

Query         76 TYCWGPA-----------------------------------------------------     82
d1t6ca2       76 GL-----GGTITTLAALEYNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKRFRQ    130

Query         83 --------CNGATKAAAKFAQ-LGF-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMK    132
d1t6ca2      131 VEDRRAKVILAGIGIFLKTLEIFEKDCLIVSDWGLREGVL--------------------    170

Query        133 KESLE----------    137
d1t6ca2      171 -----VSEVLKENHS    180


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:52.49)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAY------KECHIPT--A     52
d1t6ca2        1 --------------------P---E----G-EVCVVDQGGGSTEYVFGKG----YKVREV     28

Query         53 ISI-PGN--K--------------------INEDTTKR-LSKEK-VIITYCWGPACNGA-     86
d1t6ca2       29 ISLPIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKK-PVDTIVGLG----GTITT     83

Query         87 T----------------------------------------------------------K     88
d1t6ca2       84 LAALEYNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKRFRQVEDRRAKVILAGI    143

Query         89 -AAAKFAQLGFR-VKELIGGIEYWRKENGEV-------EGTLGAKADLFWNMKKESLE    137
d1t6ca2      144 GIFLKTLEIFEKDCLIVSDWGL-REGVLVSEVLKENHS--------------------    180


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.62)
DALI match         ************...... .    ...                  
Query         59 KINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIG    105
d1t6ca2       58 EFLEKELSKVKKPVDTIVGLGGT---ITTLAALEYNVYPYDPQKVHG    101



hit structures. 
top
41: d1mnaa_ Picromycin polyketide synthase (svm: 0.995)

SCOP Superfamily: alpha/​beta-​Hydrolases  |  SCOP Fold: alpha/​beta-​Hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 566
Modified z-scores:
dali:0.77 daliz:0.86 gdtts:0.86 tmscore:0.83 rmsd:0.34 AHM:0.35 LBcontacta:0.83 LBcontactb:0.81 LHM:0.21
id:0.56 blosum:0.53 compass:0.65 pearson:0.87
Scaled scores:
dali:0.70 daliz:0.38 gdtts:0.57 tmscore:0.58 rmsd:0.75 AHM:0.66 LBcontacta:0.47 LBcontactb:0.64 LHM:0.37
id:0.00 blosum:0.09 compass:0.20 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.4 Raw score:294.00)
Query          1 --------------------------npneayrhymkklsyetdiadlsidIKKG--yEG     32
d1mnaa_        1 agmfralfrqaveddrygefldvlaeasafrpqfaspeacserldpvllagGPTDraeGR     60

Query         33 IIVVDVR------DAEAYKeCHIP------TAISIP-----------------gnKINED     63
d1mnaa_       61 AVLVGCTgtaangGPHEFL-RLSTsfqeerDFLAVPlpgyggtallpadldtaldAQARA    119

Query         64 TTKRLSkEKVIITYCwGPAC-NGATKAAAKFA-QLGFRV-KELIG---------------    105
d1mnaa_      120 ILRAAG-DAPVVLLG-HSGGaLLAHELAFRLErAHGAPPaGIVLVdpyppghqepievws    177

Query        106 ------------------------------------------------------------    106
d1mnaa_      178 rqlgeglfagelepmsdarllamgryarflagprpgrssapvllvraseplgdwqeergd    237

Query        106 ------------------------gieYWRKEngevegtlgakadlfwnmkkesle    137
d1mnaa_      238 wrahwdlphtvadvpgdhftmmrdhapAVAEA-----------------vlswlda    276


hit structure      alignment
FAST alignment (Normalized score: 2.35 Raw score:457.00)
Query          1 NPNEAYRHYMKKLSYETDIADLSID-----------------------------------     25
d1mnaa_        1 -------------------------AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFA     35

Query         26 -----------------IKKGYE-GIIVVDVR--------DAEAYKECHI--------PT     51
d1mnaa_       36 SPEACSERLDPVLLAGGPTDRAEGRAVLVG--CTGTAANGGPHEFLR---LSTSFQEERD     90

Query         52 AISIPGNKI-----------------NEDTTKRLS------KEKVIITYCWGPA-CNGAT     87
d1mnaa_       91 FLAVP----LPGYGGTALLPADLDTALDAQAR---AILRAAGDAPVVLLG----HSGGAL    139

Query         88 KAAAKFAQ----LGFR-VKELIGGIEYWRKENGEVEGTLGAKADLFW-------------    129
d1mnaa_      140 LAHELAFRLERAHGAPPAGIV--------------------------LVDPYPPGHQEPI    173

Query        130 ------NMKKESLE----------------------------------------------    137
d1mnaa_      174 EVWSRQLGEGLFA-GELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQ    232

Query        138 --------------------------------------------    138
d1mnaa_      233 EERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA    276


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:63.00)
Query          1 ---------------------------------------------------NPNEAYRHY      9
d1mnaa_        1 AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAG---------     51

Query         10 MKKLSYETDIADLSIDIK--KG-YEGIIVVDVR------DAEAYKECH-IP---T-AISI     55
d1mnaa_       52 ----------------GPTD-RAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAV     94

Query         56 PGN-----------------KINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFA-QLG     97
d1mnaa_       95 PLPGYGGTALLPADLDTALDAQARAILRAAG-DAPVVLLGHSGGALLAHELAFRLERAHG    153

Query         98 FRV-KEL-----------------------------------------------------    103
d1mnaa_      154 APPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPG    213

Query        104 ------IGGIE-----------------------YWRKE-----NGEVEGTLGAKADLF-    128
d1mnaa_      214 RSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFT---------MMRDHAP    264

Query        129 ------------WNMKKESLE    137
d1mnaa_      265 AVAEAVLSWLDA---------    276


hit structure      alignment
HHsearch alignment (Probability: 0.08 E-value:0.07)
DALI match                                                ** ........ *******
Query         18 DIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKEKVIITY     77
d1mnaa_       74 GPHEFLRLSTSFQEERDFLAVPLPGYGGTALLPADLDTALDAQ-ARAILRAAGDAPVVLL    132

DALI match       *.....***********.. ****...
Query         78 CWGPACNGATKAAAKFAQL-GFRVKEL    103
d1mnaa_      133 GHSGGALLAHELAFRLERAHGAPPAGI    159



top
42: d1gkub3 Topoisomerase ​(​domain​(​ of reverse gyrase (svm: 0.622)

SCOP Superfamily: Prokaryotic type I DNA topoisomerase  |  SCOP Fold: Prokaryotic type I DNA topoisomerase  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.33  Contact: 565
Modified z-scores:
dali:0.85 daliz:0.86 gdtts:0.90 tmscore:0.90 rmsd:0.43 AHM:0.39 LBcontacta:0.80 LBcontactb:0.89 LHM:0.35
id:0.80 blosum:0.54 compass:0.51 pearson:0.84
Scaled scores:
dali:0.71 daliz:0.37 gdtts:0.51 tmscore:0.55 rmsd:0.75 AHM:0.71 LBcontacta:0.36 LBcontactb:0.64 LHM:0.29
id:0.03 blosum:0.09 compass:0.10 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:308.00)
Query          1 npneayrhymkklsyetdiadlsidikKGYEgIIVVDVrdAEAYkeCHIP----------     50
d1gkub3        1 -----------------------qefdLIKP-ALFIVE--SPTK-aRQISrffgkpsvkv     33

Query         51 ----------------tAISIPGNK---------------------------iNEDTTKR     67
d1gkub3       34 ldgavvyeipmqkyvlmVTASIGHVvdlitnrgfhgvlvngrfvpvyasikdnSRSRIEA     93

Query         68 ---LSKE-KVIITYCWGpaCNGATKAAAKFAQLGF---RVKELIGgiEYWRKE-------    113
d1gkub3       94 lrkLAHDaEFVIVGTDP--DTEGEKIAWDLKNLLSgcgAVKRAEF--HEVTRRaileale    149

Query        114 ------------------------------------------------------------    114
d1gkub3      150 slrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvlgwiidrfqes    209

Query        114 ------------------------------------------------------------    114
d1gkub3      210 rerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetmlsdanrilkfsv    269

Query        114 ------------------------------------------------------------    114
d1gkub3      270 kqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewgesgahecirptr    329

Query        114 ----------ngevegTLGAK---------------------------------------    124
d1gkub3      330 pltrddvqrliqegvlVVEGLrwehfalydlifrrfmasqcrpfkvvvkkysiefdgkta    389

Query        125 ---------------------------------------------------------adl    127
d1gkub3      390 eeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqseiiqmmkergig    449

Query        128 fwNMKKESL---------------------------------------------------    136
d1gkub3      450 rpSTYATIVdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedrtrdlesrmda    509

Query        137 ----------------------e    137
d1gkub3      510 iergeldylkaledmyaeiksid    532


hit structure      alignment
FAST alignment (Normalized score: 1.64 Raw score:443.90)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE-------GIIVVDVRDAEAYKECHI----     49
d1gkub3        1 -------------------------------QEFDLIKPALFIV-ESPTKAR----QISR     24

Query         50 ------------------------PTAISIPGNKI-------------------------     60
d1gkub3       25 FFGKPSVKVLDGAVVYEIPMQKYVLMVTAS-----IGHVVDLITNRGFHGVLVNGRFVPV     79

Query         61 -------NEDTTKRLSKE--------KVIITYCWGPACNGATKAAAKFAQ--LGF-RVKE    102
d1gkub3       80 YASIKDNSRSRIEA----LRKLAHDAEFVIVGTDP--DTEGEKIAWDLKNLLSGCGAVKR    133

Query        103 LIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-------------------------    137
d1gkub3      134 A--EFHE----------------------------VTRRAILEALESLRDVDENLVKAQV    163

Query        138 ------------------------------------------------------------    138
d1gkub3      164 VRRIEDRWIGFVLSQKLWERFNNRNLSAGRAQTLVLGWIIDRFQESRERRKIAIVRDFDL    223

Query        138 ------------------------------------------------------------    138
d1gkub3      224 VLEHDEEEFDLTIKLVEEREELRTPLPPYTTETMLSDANRILKFSVKQTMQIAQELFENG    283

Query        138 ------------------------------------------------------------    138
d1gkub3      284 LITYHRTDSTRVSDVGQRIAKEYLGDDFVGREWGESGAHECIRPTRPLTRDDVQRLIQEG    343

Query        138 ------------------------------------------------------------    138
d1gkub3      344 VLVVEGLRWEHFALYDLIFRRFMASQCRPFKVVVKKYSIEFDGKTAEEERIVRAEGRAYE    403

Query        138 ------------------------------------------------------------    138
d1gkub3      404 LYRAVWVKNELPTGTFRVKAEVKSVPKVLPFTQSEIIQMMKERGIGRPSTYATIVDRLFM    463

Query        138 ------------------------------------------------------------    138
d1gkub3      464 RNYVVEKYGRMIPTKLGIDVFRFLVRRYAKFVSEDRTRDLESRMDAIERGELDYLKALED    523

Query        138 ---------    138
d1gkub3      524 MYAEIKSID    532


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:65.75)
Query          1 ---NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHI-P------     50
d1gkub3        1 QEF---------------------------DLIKPALFIV-ESPTKAR-QISRFFGKPSV     31

Query         51 -----------------TAISIP--GN----------------------------K--IN     61
d1gkub3       32 KVLDGAVVYEIPMQKYVLMVTASIGHVVDLITNRGFHGVLVNGRFVPVYASIKDNSRSRI     91

Query         62 EDTTKRLSKE-KVIITYCWGPA-CN-GATKAAAKFAQLGFRVKELIGGIEYWRKENGEV-    117
d1gkub3       92 E-ALRKLAHDAEFVIVGTDPDTEGEKIAWDLKNLLS--GCGAVKRAE-FHEVT-RRAILE    146

Query        118 ------------------------------------------------------------    118
d1gkub3      147 ALESLRDVDENLVKAQVVRRIEDRWIGFVLSQKLWERFNNRNLSAGRAQTLVLGWIIDRF    206

Query        118 ------------------------------------------------------------    118
d1gkub3      207 QESRERRKIAIVRDFDLVLEHDEEEFDLTIKLVEEREELRTPLPPYTTETMLSDANRILK    266

Query        118 ------------EGT-LGAKADLFW-----------------------------------    129
d1gkub3      267 FSVKQTMQIAQE--LFENGLITYHRTDSTRVSDVGQRIAKEYLGDDFVGREWGESGAHEC    324

Query        130 ------------------------------------------------------------    130
d1gkub3      325 IRPTRPLTRDDVQRLIQEGVLVVEGLRWEHFALYDLIFRRFMASQCRPFKVVVKKYSIEF    384

Query        130 ------------------------------------------------------------    130
d1gkub3      385 DGKTAEEERIVRAEGRAYELYRAVWVKNELPTGTFRVKAEVKSVPKVLPFTQSEIIQMMK    444

Query        130 ------NM--KK--ES--------------------------------------------    135
d1gkub3      445 ERGIGRPSTYATIV-DRLFMRNYVVEKYGRMIPTKLGIDVFRFLVRRYAKFVSEDRTRDL    503

Query        136 -----------------------------LE    137
d1gkub3      504 ESRMDAIERGELDYLKALEDMYAEIKSID--    532


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.70)
DALI match       .....****......... ..................
Query         63 DTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFR     99
d1gkub3       92 EALRKLAHDAEFVIVGTDPDTEGEKIAWDLKNLLSGC    128



top
43: d8abpa_ L-​arabinose-​binding protein (svm: 0.730)

SCOP Superfamily: Periplasmic binding protein-​like I  |  SCOP Fold: Periplasmic binding protein-​like I  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 618
Modified z-scores:
dali:0.76 daliz:0.83 gdtts:0.78 tmscore:0.78 rmsd:0.40 AHM:0.42 LBcontacta:0.77 LBcontactb:0.81 LHM:0.20
id:0.84 blosum:0.66 compass:0.73 pearson:0.88
Scaled scores:
dali:0.69 daliz:0.38 gdtts:0.48 tmscore:0.50 rmsd:0.71 AHM:0.63 LBcontacta:0.41 LBcontactb:0.64 LHM:0.39
id:0.07 blosum:0.12 compass:0.21 pearson:0.24

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:300.90)
Query          1 ------------------------------------------------------------      1
d8abpa_        1 nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf     60

Query          1 --------------------------------------npneayrhymkklsyetDIADL     22
d8abpa_       61 victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerQGQEL    120

Query         23 SIDIkKGYE---GIIVVDVRDAE-----aykeCHIP----------tAISIPG-------     57
d8abpa_      121 YKEMqKRGWdvkESAVMAITANEldtarrrttGSMDalkaagfpekqIYQVPTksndipg    180

Query         58 --NKINEdTTKRLSKEKVIITYCWGpaCNGATKAAAKFAQLGF---RVKELIG-------    105
d8abpa_      181 afDAANS-MLVQHPEVKHWLIVGMN--DSTVLGGVRATEGQGFkaaDIIGIGIngvdavs    237

Query        106 ------------------------------------------gieywRKENgevegtlga    123
d8abpa_      238 elskaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdVVLI------trd    291

Query        124 kadlfwnmkkesle    137
d8abpa_      292 nfkeelekkglggk    305


hit structure      alignment
FAST alignment (Normalized score: 2.79 Raw score:569.70)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d8abpa_        1 -----------------NLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKIAVPDGE     43

Query         18 ------------------------------------------------------------     18
d8abpa_       44 KTLNAIDSLAASGAKGFVICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKGKPMDTVP    103

Query         18 ------------DIADLSIDIKKG-----YEGIIVVDVR------DAEAYKECH------     48
d8abpa_      104 LVMLAATKIGERQGQELYKEMQ--KRGWDVKESAVMAITANELDTARRRTT---GSMDAL    158

Query         49 ------IPTAISIPGNKI------------NEDTTKRLSKE----KVIITYCWGPACNGA     86
d8abpa_      159 KAAGFPEKQIYQVP----TKSNDIPGAFDAANSMLVQ----HPEVKHWLIVGMN--DSTV    208

Query         87 TKAAAKFAQLGF---RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE------    137
d8abpa_      209 LGGVRATEGQGFKAADIIGI----------------------------------GINGVD    234

Query        138 ------------------------------------------------------------    138
d8abpa_      235 AVSELSKAQATGFYGSLLPSPDVHGYKSSEMLYNWVAKDVEPPKFTEVTDVVLITRDNFK    294

Query        138 -----------    138
d8abpa_      295 EELEKKGLGGK    305


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:60.89)
Query          1 ------------------------------------------------------------      1
d8abpa_        1 NLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKIAVPDGEKTLNAIDSLAASGAKGF     60

Query          1 -------------------------------------------------------NPNEA      5
d8abpa_       61 VICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKGKPMDTVPLVMLAATKIGER-----    115

Query          6 YRHYMKKLSYETDIADLSIDI----KKGYEGIIVVDVRDAE----AY-KECH-I---P--     50
d8abpa_      116 -----------QGQELYKEMQKRGW--DVKESAVMAITANELDTARRR-TTGSMDALKAA    161

Query         51 ---T--AISI-P-------G-NKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d8abpa_      162 GFPEKQIYQVPTKSNDIPGAFDAAN-SMLVQHPEVKHWLIVGMN--DSTVLGGVRATEGQ    218

Query         97 GF---RVKELIGG-------------------IEY-------------------------    109
d8abpa_      219 GFKAADIIGIGINGVDAVSELSKAQATGFYGS--LLPSPDVHGYKSSEMLYNWVAKDVEP    276

Query        110 ----WRKENGEVEGTLGAKADLF-----------------------WNMKKESLE    137
d8abpa_      277 PKFT-----------------EVTDVVLITRDNFKEELEKKGLGGK---------    305


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.04)
DALI match       .... *****************.  ***************..
Query         59 KINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQLGFRV    100
d8abpa_      183 DAANSMLVQHPEVKHWLIVGMND--STVLGGVRATEGQGFKA    222



top
44: d1p3da2 UDP-​N-​acetylmuramate-​alanine ligase MurC (svm: 0.989)

SCOP Superfamily: MurD-​like peptide ligases,​ peptide-​binding domain  |  SCOP Fold: MurD-​like peptide ligases,​ peptide-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.31  Contact: 403
Modified z-scores:
dali:0.79 daliz:0.82 gdtts:0.79 tmscore:0.79 rmsd:0.39 AHM:0.36 LBcontacta:0.75 LBcontactb:0.85 LHM:0.24
id:0.71 blosum:0.79 compass:0.58 pearson:0.83
Scaled scores:
dali:0.67 daliz:0.36 gdtts:0.48 tmscore:0.47 rmsd:0.72 AHM:0.65 LBcontacta:0.38 LBcontactb:0.69 LHM:0.29
id:0.03 blosum:0.15 compass:0.12 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 2.2 Raw score:227.30)
Query          1 npneayrhymkKLSYET-------------------------DIADLSIDIKKGY-EGII     34
d1p3da2        1 -----------GAGRRFdqlgefirpngkvrlvddyghhpteVGVTIKAAREGWGdKRIV     49

Query         35 VVDVR--------daeaykecHIPT--AISI-----------------------------     55
d1p3da2       50 MIFQPhrysrtrdlfddfvqvLSQVdaLIMLdvyaageapivgadskslcrsirnlgkvd    109

Query         56 -----pgNKINeDTTKR-LSKEKVIITYCWgpacNGATKAAAKFAQLGfrvkeliggiey    109
d1p3da2      110 pilvsdtSQLG-DVLDQiIQDGDLILAQGA----GSVSKISRGLAESW------------    152

Query        110 wrkengevegtlgakadlfwnmkkesle    137
d1p3da2      153 ----------------------------    153


hit structure      alignment
FAST alignment (Normalized score: 2.11 Raw score:304.30)
Query          1 NPNEAYRHYMKKLSYET---------------------------DIADLSIDIKKGYE--     31
d1p3da2        1 -----------------GAGRRFDQLGEFIRPNGKVRLVDDYGHHPTEVGVTIK----AA     39

Query         32 -------GIIVVD-VRDAEAYKECHIP-------------TAISIPGNKI----------     60
d1p3da2       40 REGWGDKRIVMIFQPHRYSRTRD----LFDDFVQVLSQVDALIM------LDVYAAGEAP     89

Query         61 -----------------------------NEDTTKR-LSKEKVIITYCWGPACN---GAT     87
d1p3da2       90 IVGADSKSLCRSIRNLGKVDPILVSDTSQLGDVLDQIIQDGDLILAQ-------GAGSVS    142

Query         88 KAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-    137
d1p3da2      143 KISRGLAES-----------------------------------------W    152


hit structure      alignment
TMalign alignment (TM-score: 0.40 Raw score:55.23)
Query          1 NPNEAYRHYMK-KLSY--------------ET------DI-ADLSI-D---IKKGYEGII     34
d1p3da2        1 --------GAGRRFDQLGEFIRPNGKVRLVDDYGHHPTEVGVTIKAAREGW---GDKRIV     49

Query         35 VVDV--------------------------RDA----------EAYKECH--I----PT-     51
d1p3da2       50 MIFQPHRYSRTRDLFDDFVQVLSQVDALIMLDVYAAGEAPIVGADSKSLCRSIRNLGKVD    109

Query         52 AISIPGNKINEDTTKR-LSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKELIGGIEYW    110
d1p3da2      110 PILVSDTSQLGDVLDQIIQDGDLILAQG--A-G-SVSKISRGLAESW-------------    152

Query        111 RKENGEVEGTLGAKADLFWNMKKESLE    137
d1p3da2      153 ---------------------------    153


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.22)
DALI match                                                           .... ***
Query         20 ADLSIDIKKGYEGIIVVDVRDAEAYKECHI--------------PTAISIPGNKINEDTT     65
d1p3da2       65 DDFVQVLSQ-VDALIMLDVYAAGEAPIVGADSKSLCRSIRNLGKVDPILVSDTSQLGDVL    123

DALI match       **............ .   ************
Query         66 KRLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1p3da2      124 DQIIQDGDLILAQGAG---SVSKISRGLAES    151



top
45: d1lyva_ Protein-​tyrosine phosphatase YopH,​ catalytic domain (svm: 0.618)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.27  Contact: 385
Modified z-scores:
dali:0.74 daliz:0.73 gdtts:0.77 tmscore:0.81 rmsd:0.50 AHM:0.50 LBcontacta:0.72 LBcontactb:0.71 LHM:0.38
id:0.43 blosum:0.50 compass:0.68 pearson:0.88
Scaled scores:
dali:0.70 daliz:0.31 gdtts:0.44 tmscore:0.45 rmsd:0.68 AHM:0.60 LBcontacta:0.36 LBcontactb:0.49 LHM:0.20
id:-0.02 blosum:0.07 compass:0.14 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 1.4 Raw score:248.30)
Query          1 ------------------------nPNEAYRHY----------------MKKLS------     14
d1lyva_        1 vspygpearaelssrlttlrntlapATNDPRYLqacggeklnrfrdiqcRRQTAvradln     60

Query         15 -----------------yetDIADLSIDIKKGYEGIIVVdVRDAEAYKE-----CHIP--     50
d1lyva_       61 anyiqvgntrtiacqyplqsQLESHFRMLAENRTPVLAV-LASSSEIANqrfgmPDYFrq    119

Query         51 ------------------------------------------tAISIPGN--------ki     60
d1lyva_      120 sgtygsitveskmtqqvglgdgimadmytltireagqktisvpVVHVGNWpdqtavssev    179

Query         61 NEDTTKRLSKEK----------------------VIITYCwgpacnGATKAAAKFAQLG-     97
d1lyva_      180 TKALASLVDQTAetkrnmyeskgssavaddsklrPVIHSR------AGVGRTAQLIGAMc    233

Query         98 ----------frvkeliggieywrkengevegtlgakadlfwnmkkesle    137
d1lyva_      234 mndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns    283


hit structure      alignment
FAST alignment (Normalized score: 2.10 Raw score:413.00)
Query          1 N------PNEAYRHYMKKLSYET-------------------------------------     17
d1lyva_        1 -VSPYGPEARAELSSRL------TTLRNTLAPATNDPRYLQACGGEKLNRFRDIQCRRQT     53

Query         18 ---------------------------DIADLSIDIKKGYEG---IIVVDVRDAEAYKEC     47
d1lyva_       54 AVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAE----NRTPVLAVLASSSEIA--    107

Query         48 HI-----------------------------------------------------PTAIS     54
d1lyva_      108 --NQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVH    165

Query         55 IPGNKI-------------NEDTTKRLSKE-------------------------KVIIT     76
d1lyva_      166 V-----GNWPDQTAVSSEVTKALASL----VDQTAETKRNMYESKGSSAVADDSKLRPVI    216

Query         77 YCWGPA---CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKK    133
d1lyva_      217 HS----RAGVGRTAQLIGAMCM--------------------------------------    234

Query        134 ESLE-------------------------------------------------    137
d1lyva_      235 ----NDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS    283


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:58.36)
Query          1 ------------------------------NPNEA------------------YRHYMKK     12
d1lyva_        1 VSPYGPEARAELSSRLTTLRNTLAPATNDP----RYLQACGGEKLNRFRDIQC--RRQTA     54

Query         13 -------LSY-------ETD--I---A--DLSIDIKKGYEGI-IVVDVRDAEAYKE----     46
d1lyva_       55 VRADLNANYIQVGNTRTIACQYPLQSQLESHFRML--AENRTPVLAVLAS-SSEIANQRF    111

Query         47 --CHIP-------------------------------T-------------AISI--P--     56
d1lyva_      112 GMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPD    171

Query         57 --GN---K---INEDTT-KRLSK-E----------------KVIITYCWGPACNGATKAA     90
d1lyva_      172 QTAVSSEVTKALAS-LVDQTAETKRNMYESKGSSAVADDSKLRPVIHSRAG-VGRTAQLI    229

Query         91 AKFAQLGF-------------RVK---ELI----------------------------GG    106
d1lyva_      230 GAMCMNDSRNSQLSVEDMVSQ--MRVQ--RNGIMVQKDEQLDVLIKLAEGQGRPLLNS--    283

Query        107 IEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1lyva_      284 -------------------------------    284


hit structure      alignment
HHsearch alignment (Probability: 0.11 E-value:0.01)
DALI match           ......                  
Query         69 SKEKVIITYCWGPACNGATKAAAKFAQL     96
d1lyva_      209 DSKLRPVIHSRAGVGRTAQLIGAMCMND    236



hit structures. 
top
46: d2shpa1 Tyrosine phosphatase (svm: 0.903)

SCOP Superfamily: (Phosphotyrosine protein) phosphatases II  |  SCOP Fold: (Phosphotyrosine protein) phosphatases II  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 396
Modified z-scores:
dali:0.77 daliz:0.81 gdtts:0.78 tmscore:0.80 rmsd:0.45 AHM:0.46 LBcontacta:0.80 LBcontactb:0.85 LHM:0.32
id:0.70 blosum:0.58 compass:0.57 pearson:0.80
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.43 tmscore:0.43 rmsd:0.68 AHM:0.61 LBcontacta:0.41 LBcontactb:0.67 LHM:0.21
id:0.03 blosum:0.10 compass:0.12 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 1.6 Raw score:273.50)
Query          1 ------------------------------npnEAYR------------------hYMKK     12
d2shpa1        1 trinaaeiesrvrelskgfweefetlqqqecklLYSRkegqrqenknknryknilpFDHT     60

Query         13 L-----------SYET--------------dIADLSIDIKKGYeGIIVVDVRDAEA---y     44
d2shpa1       61 RvvlhdsdyinaNIIMpkksyiatqgclqntVNDFWRMVFQEN-SRVIVMTTKEVErgks    119

Query         45 keCHIP--------------------------------------------tAISI-----     55
d2shpa1      120 kcVKYWpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwQYHFrtwpd    179

Query         56 ----pgnkiNEDTTKR--LSKE-----kVIITYCWGpaCNGATKAAAKFAQLG-------     97
d2shpa1      180 hgvpsdpggVLDFLEEvhHKQEsimdagPVVVHCSA-gIGRTGTFIVIDILIDiirekgv    238

Query         98 -frvkeliggieywrkengevegtlgakadlfwnmkkesle    137
d2shpa1      239 dcdidvpktiqmvrsqrsgmvqteaqyrsiymavqhyietl    279


hit structure      alignment
FAST alignment (Normalized score: 1.88 Raw score:368.20)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d2shpa1        1 -----------------TRINAAEIESRVRELSKGFWEEFETLQQQECKLLYSRKEGQRQ     43

Query         18 -----------------------------------------------DIADLSIDIKKGY     30
d2shpa1       44 ENKNKNRYKNILPFDHTRVVLHDSDYINANIIMPKKSYIATQGCLQNTVNDFWRMVF--Q    101

Query         31 EG-IIVVDVRDAEAYKECHI----------------------------------------     49
d2shpa1      102 ENSRVIVMTTK---------EVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTL    152

Query         50 ----------------PTAISIPGNKI--------------NEDTTKRLSK---------     70
d2shpa1      153 RELKLSKVGQGNTERTVWQYHF-----RTWPDHGVPSDPGGVLDFLEE---VHHKQESIM    204

Query         71 -EKVIITYCWGPA---CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKAD    126
d2shpa1      205 DAGPVVVHC----SAGIGRTGTFIVIDIL-------------------------------    229

Query        127 LFWNMKKESLE-------------------------------------------------    137
d2shpa1      230 -----------IDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRSIYMAVQHYIET    278

Query        138 -    138
d2shpa1      279 L    279


hit structure      alignment
TMalign alignment (TM-score: 0.29 Raw score:40.01)
Query          1 -------------------------------NPNEAYRHYMKKLSYETDIA--DLSID--     25
d2shpa1        1 TRINAAEIESRVRELSKGFWEEFETLQQQEC-------------------KLL--YSRKE     39

Query         26 ----------------IKK-GYEG---------IIVVD-V--RDAEAYKECHIPTA----     52
d2shpa1       40 GQRQENKNKNRYKNILPFDHTRVVLHDSDYINANIIMPKKSY----------IATQGCLQ     89

Query         53 -----------------IS-----------------------------------------     54
d2shpa1       90 NTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHD    149

Query         55 -------------------------------------------I--PGNKI-NE--DTTK     66
d2shpa1      150 YTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMD--A-    206

Query         67 RLSKEKVII--------------T--YCWGPACNGAT-----KAAAKFAQLGFRVKELIG    105
d2shpa1      207 ------GPVVVHCSAGIGRTGTFIVIDILI-DIIREKGVDCD-----------------I    242

Query        106 GIEYWRKENG----E-VEGTLGAKADLF-WN--MKKESLE    137
d2shpa1      243 DVPKTIQMVRSQRSGMVQTEAQYRSIYMAVQHYIE-TL--    279


hit structure      alignment
HHsearch alignment (Probability: 0.13 E-value:0.00)
DALI match                     ******** .........
Query         59 KINEDTTKRLSKEKVIITYCWGPACNGATKAA     90
d2shpa1      194 EEVHHKQESIMDAGPVVVHCSAGIGRTGTFIV    225



top
47: d1vdra_ Dihydrofolate reductase,​ prokaryotic type (svm: 0.622)

SCOP Superfamily: Dihydrofolate reductases  |  SCOP Fold: Dihydrofolate reductases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 322
Modified z-scores:
dali:0.66 daliz:0.66 gdtts:0.78 tmscore:0.77 rmsd:0.40 AHM:0.50 LBcontacta:0.63 LBcontactb:0.70 LHM:0.20
id:0.66 blosum:0.45 compass:0.61 pearson:0.83
Scaled scores:
dali:0.65 daliz:0.26 gdtts:0.47 tmscore:0.43 rmsd:0.68 AHM:0.55 LBcontacta:0.34 LBcontactb:0.56 LHM:0.34
id:0.02 blosum:0.04 compass:0.14 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 0.8 Raw score:179.00)
Query          1 npneayrhYMKK----------lsyetdIADLSIDikkgyeGIIVVDVrdAEAYKEC--H     48
d1vdra_        1 elvsvaalAENRvigrdgelpwpsipadKKQYRSR----iaDDPVVLG--RTTFESMrdD     54

Query         49 IPT--AISIP------------gnKINEDTTKRLS--KEKVIITYCwgpacNGATKAAAK     92
d1vdra_       55 LPGsaQIVMSrsersfsvdtahraASVEEAVDIAAslDAETAYVIG----gAAIYALFQP    110

Query         93 FAQ--lgfrvkeliggieywrkengevegtlgakadlfwnmkkesle    137
d1vdra_      111 HLDrmvlsrvpgeyegdtyypewdaaeweldaetdhegftlqewvrs    157


hit structure      alignment
FAST alignment (Normalized score: 1.75 Raw score:256.60)
Query          1 NPNEAYRHYMKKLSYET-------------------------------DIADLSIDIKKG     29
d1vdra_        1 -----------------ELVSVAALAENRVIGRDGELPWPSIPADKKQYRSRIAD-----     38

Query         30 YEGIIVVDVR---DAEAYKECH-IPTAISIPGNKI------------------NEDTTKR     67
d1vdra_       39 ---DPVVL--GRTTFESMRDDLPGSAQIV------MSRSERSFSVDTAHRAASVEEAVDI     87

Query         68 LSKE------KVIITYCWGPACNG-ATKAAAKFAQLGFR--VKELIGGIEYWRKENGEVE    118
d1vdra_       88 ----AASLDAETAYVI--------GGAAIYALFQP----HLDRMV---------------    116

Query        119 GTLGAKADLFWNMKKESLE-----------------------------------------    137
d1vdra_      117 -------------------LSRVPGEYEGDTYYPEWDAAEWELDAETDHEGFTLQEWVRS    157


hit structure      alignment
TMalign alignment (TM-score: 0.37 Raw score:50.38)
Query          1 --NPNEAYRHYMKKLSYET---------------------DIADLSIDIKKGYEGIIVVD     37
d1vdra_        1 EL-------------VSVAALAENRVIGRDGELPWPSIPADKKQYRSRI--A-D-DPVVL     43

Query         38 VRDAEAYKECH--IPT-AISIPGN-------------KINEDTTKRLS--KEKVIITYCW     79
d1vdra_       44 -GR-TTFESMRDDLPGSAQIVMSRSERSFSVDTAHRAASVEEAVDIAASLDAETAYVIGG    101

Query         80 GPACNGATKAAAKFAQLGFRVKELIG--------GIEYWRKENGEVEGTLGAKADLFW--    129
d1vdra_      102 ----AAIYALFQP-H---LDRMVLSRVPGEYEGD-----------------------TYY    130

Query        130 ---------------------------NMKKESLE    137
d1vdra_      131 PEWDAAEWELDAETDHEGFTLQEWVRS--------    157


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.31)
DALI match                           
Query         87 TKAAAKFAQLGFRVKELIGG    106
d1vdra_       82 EEAVDIAASLDAETAYVIGG    101



top
48: d1t64a_ Histone deacetylase 8,​ HDAC8 (svm: 0.622)

SCOP Superfamily: Arginase/​deacetylase  |  SCOP Fold: Arginase/​deacetylase  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.34  Contact: 603
Modified z-scores:
dali:0.75 daliz:0.72 gdtts:0.75 tmscore:0.79 rmsd:0.50 AHM:0.45 LBcontacta:0.79 LBcontactb:0.86 LHM:0.40
id:0.98 blosum:0.89 compass:0.66 pearson:0.91
Scaled scores:
dali:0.67 daliz:0.27 gdtts:0.38 tmscore:0.43 rmsd:0.69 AHM:0.67 LBcontacta:0.35 LBcontactb:0.61 LHM:0.17
id:0.12 blosum:0.19 compass:0.19 pearson:0.22

hit structure      alignment
DALI alignment (Z-score: 1.3 Raw score:290.40)
Query          1 --------------------------------npnEAYRHYMK-----------------     11
d1t64a_        1 lvpvyiyspeyvsmcdslakipkrasmvhslieayALHKQMRIvkpkvasmeematfhtd     60

Query         12 ---------------------------------------------------------kls     14
d1t64a_       61 aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv    120

Query         15 YETD-----------------iADLSIDIKKGY---eGIIVVDVRDaeaykeCHIP----     50
d1t64a_      121 AINWsggwhhakkdeasgfcylNDAVLGILRLRrkfeRILYVDLDL------HHGDgved    174

Query         51 --------tAISI---------------------------------------pgNKINeD     63
d1t64a_      175 afsftskvmTVSLhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyQICE-S    233

Query         64 TTKRL---SKEKVIITYCWG------------pacngaTKAAAKFAQLGFRVKELiGGIE    108
d1t64a_      234 VLKEVyqaFNPKAVVLQLGAdtiagdpmcsfnmtpvgiGKCLKYILQWQLATLIL-GGGG    292

Query        109 ywrkengevegtlgakadLFWN-------------------------------------m    131
d1t64a_      293 ------------------YNLAntarcwtyltgvilgktlsseipdhefftaygpdyvle    334

Query        132 kkESLE------------------------    137
d1t64a_      335 itPSCRpdrnephriqqilnyikgnlkhvv    364


hit structure      alignment
FAST alignment (Normalized score: 1.75 Raw score:391.80)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d1t64a_        1 -----------------LVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRI     43

Query         18 ----------------------------------------------------------DI     19
d1t64a_       44 VKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIG    103

Query         20 ADLSIDIKKGYE----------------------------------------------GI     33
d1t64a_      104 GATITAAQ----CLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERI    159

Query         34 IVVDVRDA-EAYKECHIP------------TAISI-------------------------     55
d1t64a_      160 LYVDLD--LHHGD-----GVEDAFSFTSKVMTVS-LHKFSPGFFPGTGDVSDVGLGKGRY    211

Query         56 ---------------PGNKI---NEDTTKRLSKE---KVIITYCWGPA------------     82
d1t64a_      212 YSVNVPIQDGIQDEKYYQICESVLKEVYQA----FNPKAVVLQL----GADTIAGDPMCS    263

Query         83 ----CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-    137
d1t64a_      264 FNMTPVGIGKCLKYILQWQLATLIL----------------------------------G    289

Query        138 ------------------------------------------------------------    138
d1t64a_      290 GGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRI    349

Query        138 ---------------    138
d1t64a_      350 QQILNYIKGNLKHVV    364


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:67.17)
Query          1 ------------------------------------NPNEAYRHYMKK------------     12
d1t64a_        1 LVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYA----LHKQMRIVKPKVASMEEMAT     56

Query         13 ----------------------------------------------------L-------     13
d1t64a_       57 FHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDG    116

Query         14 ---SYETDIADL--------------SIDIKKGYEG------IIVVDVRDAEAYKECHI-     49
d1t64a_      117 MCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLD---L---HHGD    170

Query         50 PT-----------AISI---------------------------------------PGNK     59
d1t64a_      171 GVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQI    230

Query         60 -I--NEDTTKRLSKEKVIITYCWGPA----------CN-GATKAAAKFAQLGFRVKELIG    105
d1t64a_      231 CESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILG-    289

Query        106 GIEY-------------------------------------------WRKENGEVEGTLG    122
d1t64a_      290 GGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEIT-------------    336

Query        123 AKADLFWNMKKESLE---------------------    137
d1t64a_      337 -------PSCR-PDRNEPHRIQQILNYIKGNLKHVV    364


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.28)
DALI match         ........... *******
Query         18 DIADLSIDIKKGYEGIIVVDV     38
d1t64a_      144 DAVLGILRLRRKFERILYVDL    164



top
49: d1rjda_ Leucine carboxy methyltransferase Ppm1 (svm: 0.618)

SCOP Superfamily: S-​adenosyl-​L-​methionine-​dependent methyltransferases  |  SCOP Fold: S-​adenosyl-​L-​methionine-​dependent methyltransferases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.45  Contact: 458
Modified z-scores:
dali:0.69 daliz:0.76 gdtts:0.78 tmscore:0.76 rmsd:0.37 AHM:0.34 LBcontacta:0.73 LBcontactb:0.77 LHM:0.26
id:0.80 blosum:0.47 compass:0.55 pearson:0.74
Scaled scores:
dali:0.71 daliz:0.35 gdtts:0.52 tmscore:0.52 rmsd:0.76 AHM:0.69 LBcontacta:0.41 LBcontactb:0.66 LHM:0.29
id:0.05 blosum:0.07 compass:0.14 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 1.3 Raw score:251.30)
Query          1 ------------------------------------------------------------      1
d1rjda_        1 eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg     60

Query          1 ------npneayrhymkklsyetDIADLSIDIKKGYEgIIVVDVRdaeaYKECHIP----     50
d1rjda_       61 kvdkamrssfpvmnygtylrtvgIDAAILEFLVANEK-VQVVNLG----CGSDLRMlpll    115

Query         51 ------tAISIP------------------------------------------------     56
d1rjda_      116 qmfphlaYVDIDynesvelknsilreseilrislglskedtakspflidqgryklaacdl    175

Query         57 -gnkiNEDTTKR-LSKEKVIITYCWGpaCNGA-----tkaaAKFAqLGFR-VKELIGgie    108
d1rjda_      176 nditeTTRLLDVcTKREIPTIVISEC-lLCYMhnnesqlliNTIM-SKFShGLWISY--d    231

Query        109 ywrkengevegtlgakadlfwnMKKE----------------------------------    134
d1rjda_      232 piggsqpndrfgaimqsnlkesRNLEmptlmtynskekyasrwsaapnvivndmweifna    291

Query        135 ----------------------------------sle    137
d1rjda_      292 qipeserkrlrslqfldeleelkvmqthyilmkaqwh    328


hit structure      alignment
FAST alignment (Normalized score: 2.07 Raw score:439.10)
Query          1 ------------------------------------------------------------      1
d1rjda_        1 ERIIQQTDYDALSCKLAAISVGYLPSSGLQRLSVDLSKKYTEWHRSYLITLKKFSRRAFG     60

Query          1 --------NPNEAYRHYMKKLSYET---DIADLSIDIKKGY--EGIIVVD----------     37
d1rjda_       61 KVDKAMRSSFPVMNYGTYLR-----TVGIDAAILEFLV---ANEKVQVVNLGCGSDLRML    112

Query         38 -------------VRDAEAYKECHIPT---------------------------------     51
d1rjda_      113 PLLQMFPHLAYVDIDYNESVE------LKNSILRESEILRISLGLSKEDTAKSPFLIDQG    166

Query         52 ---AISIPGNKI---NEDTTK-RLSKEKVIITYCWGPAC----------NGATKAAAKFA     94
d1rjda_      167 RYKLAACDLND-ITETTRLLDVCTKREIPTIVI------SECLLCYMHNNESQLLINTIM    219

Query         95 QLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----------------    137
d1rjda_      220 S------------------------------------------KFSHGLWISYDPIGGSQ    237

Query        138 ------------------------------------------------------------    138
d1rjda_      238 PNDRFGAIMQSNLKESRNLEMPTLMTYNSKEKYASRWSAAPNVIVNDMWEIFNAQIPESE    297

Query        138 -------------------------------    138
d1rjda_      298 RKRLRSLQFLDELEELKVMQTHYILMKAQWH    328


hit structure      alignment
TMalign alignment (TM-score: 0.44 Raw score:59.86)
Query          1 ------------------------------------------------------------      1
d1rjda_        1 ERIIQQTDYDALSCKLAAISVGYLPSSGLQRLSVDLSKKYTEWHRSYLITLKKFSRRAFG     60

Query          1 ----------------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDV     38
d1rjda_       61 KVDKAMRSSFPVMNYGTYLRTV----------------GIDAAILEFLVANEK-VQVVNL    103

Query         39 RDAEAYKECHIP---T-------AISIP--------------------------------     56
d1rjda_      104 GC--G--SDLRMLPLLQMFPHLAYVDIDYNESVELKNSILRESEILRISLGLSKEDTAKS    159

Query         57 ---------------GN---KINEDTTKR-LSKEKVIITYCWGPACNG----ATK-AAAK     92
d1rjda_      160 PFLIDQGRYKLAACDLNDITETT-RLLDVCTKREIPTIVISECLLCYMHNNE-SQLLINT    217

Query         93 FAQLGFR-VKELIGG------------------IEYWRKENGEVEGTLGAKADLFWNM--    131
d1rjda_      218 IMS-KFSHGLWISYDPIGGSQPNDRFGAIMQSN------------------------LKE    252

Query        132 -KKES-------------------------------------------------------    135
d1rjda_      253 SRNLEMPTLMTYNSKEKYASRWSAAPNVIVNDMWEIFNAQIPESERKRLRSLQFLDELEE    312

Query        136 ----------------LE    137
d1rjda_      313 LKVMQTHYILMKAQWH--    328


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.71)
DALI match           ........************* .....    .... 
Query         56 PGNKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQ     95
d1rjda_      177 DITETTRLLDVCTKREIPTIVISECLLCYMHNNESQLLIN    216



top
50: d1d4oa_ Transhydrogenase domain III (dIII) (svm: 0.640)

SCOP Superfamily: DHS-​like NAD/​FAD-​binding domain  |  SCOP Fold: DHS-​like NAD/​FAD-​binding domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 437
Modified z-scores:
dali:0.75 daliz:0.80 gdtts:0.77 tmscore:0.77 rmsd:0.35 AHM:0.38 LBcontacta:0.76 LBcontactb:0.80 LHM:0.22
id:0.76 blosum:0.62 compass:0.56 pearson:0.79
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.49 tmscore:0.48 rmsd:0.72 AHM:0.64 LBcontacta:0.40 LBcontactb:0.65 LHM:0.25
id:0.05 blosum:0.10 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 2.0 Raw score:232.20)
Query          1 npneayrhymkklsYETDIADLSIDIKKGYE-----------------------------     31
d1d4oa_        1 -----------gthTEINLDNAIDMIREANSiiitpgyglcaakaqypiadlvkmlseqg     49

Query         32 ---------------------------------------------GIIVVDVrdaeayke     46
d1d4oa_       50 kkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtDLVLVIG--------    101

Query         47 chiptaisiPGNK-INED----------ttKRLS-KEKVIITYCwgpacnGATK-----a     89
d1d4oa_      102 ---------ANDTvNSAAqedpnsiiagmpVLEVwKSKQVIVMK------RSLGvgyaav    146

Query         90 aaKFAQlGFRVKELI----gGIEYWRkeNGEVegtlgakadlfwnmkkesle    137
d1d4oa_      147 dnPIFY-KPNTAMLLgdakkTCDALQ--AKVR------------------es    177


hit structure      alignment
FAST alignment (Normalized score: 1.17 Raw score:181.70)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------DIADLS     23
d1d4oa_        1 -----------------GTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVK     43

Query         24 IDIKKGYEGIIVVDVR------------DAEAYKECHIPTA------ISIPGNKINEDTT     65
d1d4oa_       44 MLSEQG---KKVRF--GIHPVAGRMPGQLNVLLAE------AGVPYDIVLEMDEI-NHDF     91

Query         66 KRLSKEKV-IITYCWGPACNGATKAAAKFAQLGFR-------------------------     99
d1d4oa_       92 PD------TDLVL----------------------VIGANDTVNSAAQEDPNSIIAGMPV    123

Query        100 ------VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE----------------    137
d1d4oa_      124 LEVWKSKQVI----------------------------------VMKRSLGVGYAAVDNP    149

Query        138 ----------------------------    138
d1d4oa_      150 IFYKPNTAMLLGDAKKTCDALQAKVRES    177


hit structure      alignment
TMalign alignment (TM-score: 0.45 Raw score:61.55)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAE--AYKECH--IP------     50
d1d4oa_        1 ----------GT-HTEINLDNAIDMIREANS-IIITPGYGLCAAKAQYPIADLVKMLSEQ     48

Query         51 ---T---------------------------------------------AISIPGNKIN-     61
d1d4oa_       49 GKKVRFGIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNS    108

Query         62 -E-----------DTTKRLSKEKVIITYCWGPACNGATKA-----AAKFAQLGFRVKELI    104
d1d4oa_      109 AAQEDPNSIIAGMPVLE-VWKSKQVIVMK----RS--LGVGYAAV-DNPIFYKPNTAMLL    160

Query        105 GGI-EYWRKE-NGEV--EGTLGAKADLFWNMKKESLE    137
d1d4oa_      161 GDAKKTCDALQAKVRES--------------------    177


hit structure      alignment
HHsearch alignment (Probability: 0.05 E-value:0.03)
DALI match       ************* ..     
Query         16 ETDIADLSIDIKKGYEGIIVV     36
d1d4oa_        5 EINLDNAIDMIRE-ANSIIIT     24



hit structures. 
top
51: d1qj4a_ Hydroxynitrile lyase (svm: 0.620)

SCOP Superfamily: alpha/​beta-​Hydrolases  |  SCOP Fold: alpha/​beta-​Hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.14  Contact: 501
Modified z-scores:
dali:0.72 daliz:0.80 gdtts:0.74 tmscore:0.75 rmsd:0.35 AHM:0.35 LBcontacta:0.74 LBcontactb:0.77 LHM:0.41
id:0.65 blosum:0.63 compass:0.61 pearson:0.80
Scaled scores:
dali:0.72 daliz:0.38 gdtts:0.49 tmscore:0.50 rmsd:0.77 AHM:0.72 LBcontacta:0.40 LBcontactb:0.62 LHM:0.21
id:0.02 blosum:0.11 compass:0.16 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 2.0 Raw score:279.30)
Query          1 npneayrhymkklsyetdiadlsidikkgyegIIVVDVR----DAEAYKECH------iP     50
d1qj4a_        1 ------------------------------afAHFVLIHtichGAWIWHKLKpllealgH     30

Query         51 TAISI--------------------pgnKINEdTTKRLSKEKVIITYCWgpaCNGATKAA     90
d1qj4a_       31 KVTALdlaasgvdprqieeigsfdeysePLLT-FLEALPPGEKVILVGE---SCGGLNIA     86

Query         91 AKFAQLGFRV-KELIG-------------------------------------gieywrk    112
d1qj4a_       87 IAADKYCEKIaAAVFHnsvlpdtehcpsyvvdklmevfpdwkdttyftytkdgkeitglk    146

Query        113 engevegtlgakadlfwNMKKESLE-----------------------------------    137
d1qj4a_      147 lgftllrenlytlcgpeEYELAKMLtrkgslfqnilakrpfftkegygsikkiyvwtdqd    206

Query        138 --------------------------------------------------    138
d1qj4a_      207 eiflpefqlwqienykpdkvykveggdhklqltktkeiaeilqevadtyn    256


hit structure      alignment
FAST alignment (Normalized score: 1.36 Raw score:253.90)
Query          1 NPNEAYRHYMKKLSYET-----------------DIADLSIDIKKGYEGIIVVDVRDAEA     43
d1qj4a_        1 -----------------AFAHFVLIHTICHGAWIWHKLKPLLEALGH-KVTALD------     36

Query         44 YKECHIPTAISIP--------------------GNKINEDTTKRLSKEKVIITYCWGPAC     83
d1qj4a_       37 -------------LAASGVDPRQIEEIGSFDEYSEPL-LTFLEALPPGEKVILV------     76

Query         84 --NGATKAAAKFAQLGFR------VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKES    135
d1qj4a_       77 GESCGGLNIAIAAD----KYCEKIAAAV--------------------------------    100

Query        136 LE----------------------------------------------------------    137
d1qj4a_      101 --FHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYT    158

Query        138 ------------------------------------------------------------    138
d1qj4a_      159 LCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQI    218

Query        138 --------------------------------------    138
d1qj4a_      219 ENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN    256


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:53.40)
Query          1 ------NPNEAYRHYMKKLSYET----------DIADL-SIDIKK-GYEGIIVVDVRDAE     42
d1qj4a_        1 AFAHFV----------------LIHTICHGAWI----WHKLKPLLEALGHKVTALDLA-A     39

Query         43 AYKE-------------CHIPTAISIPGNKINEDTTKRLSKEKVIITYCWGPACNGATKA     89
d1qj4a_       40 SGVDPRQIEEIGSFDEY-------SEPLLTFLE-ALP-PGEK-VILVGE-SCGGLNIAIA     88

Query         90 AAKFAQLGFRVKELIGG-------------------------------------------    106
d1qj4a_       89 ADKYCE-KIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKL    147

Query        107 ----IE---YWRK-ENG-EV-EGTLGA-KADLFWNMK-----------------------    132
d1qj4a_      148 GFTL-LREN--LYTLCGPEEY---ELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYV    201

Query        133 -------------------------------------------------------KESLE    137
d1qj4a_      202 WTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN-----    256


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.05)
DALI match                                      
Query         74 IITYCWGPACNGATKAAAKFAQLGFRVKELI    104
d1qj4a_        6 VLIHTICHGAWIWHKLKPLLEALGHKVTALD     36



top
52: d1qx4a2 cytochrome b5 reductase (svm: 0.666)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.25  Contact: 319
Modified z-scores:
dali:0.61 daliz:0.58 gdtts:0.72 tmscore:0.72 rmsd:0.35 AHM:0.33 LBcontacta:0.53 LBcontactb:0.52 LHM:0.15
id:0.72 blosum:0.70 compass:0.72 pearson:0.88
Scaled scores:
dali:0.63 daliz:0.24 gdtts:0.44 tmscore:0.40 rmsd:0.73 AHM:0.67 LBcontacta:0.26 LBcontactb:0.34 LHM:0.43
id:0.05 blosum:0.13 compass:0.22 pearson:0.27

hit structure      alignment
DALI alignment (Z-score: 1.2 Raw score:179.40)
Query          1 -----------npneayrhymkklsyetdiADLSIDIKKGY------EGIIVVDVrDAEA     43
d1qx4a2        1 gkfairadkksnpvvrtvksvgmiaggtgiTPMLQVIRAVLkdpndhTVCYLLFA-NQSE     59

Query         44 yKECHI--------------ptAISI----------pgNKINEDTT-KRLSK----EKVI     74
d1qx4a2       60 -KDILLrpeleelrnehssrfkLWYTvdkapdawdysqGFVNEEMIrDHLPPpgeeTLIL    118

Query         75 ITycwgpaCNGATK-AAAKFAQLGFRvkeliggieywrkengevegtlgakadlfwnmkk    133
d1qx4a2      119 MC----gpPPMIQFaCLPNLERVGHP-------------------------------ker    143

Query        134 esle    137
d1qx4a2      144 cftf    147


hit structure      alignment
FAST alignment (Normalized score: 2.23 Raw score:316.90)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDI------------KKGYE---GIIV----------     35
d1qx4a2        1 --------------------------GKFAIRADKKSNPVVR-TVKSVGMIAGGTGITPM     33

Query         36 -------------------VDVR-------DAEAYKECHI--------PTAISIPGN---     58
d1qx4a2       34 LQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEE---LRNEHSSRFKLWYT---VDK     87

Query         59 ----------KINEDTT-KRLSK----EKVIITYCWGPA-CNGATK-AAAKFAQLGFRVK    101
d1qx4a2       88 APDAWDYSQGFVNEEMIRDHLP-PPGEETLILMCG----PPPMIQFACLPNLERVGH---    139

Query        102 ELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE--------    137
d1qx4a2      140 ------------------------------------PKERCFTF    147


hit structure      alignment
TMalign alignment (TM-score: 0.32 Raw score:44.21)
Query          1 ----------------------------NPNEAYRHYMKKLSYET---------------     17
d1qx4a2        1 GKFAIRADKKSNPVVRTVKSVGMIAGGT----------GITPMLQVIRAVLKDPNDHTVC     50

Query         18 -------------DIADLSIDIKKGYE-GIIVVDVRDAEAYKECHIPTAISIPGNKINED     63
d1qx4a2       51 YLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKA-P-DA-W---DYSQGF--VNEE    102

Query         64 TTKRLSK-----EKVIITYCWGPACNGATK-AAA--KFAQ--L----G----FRVKELIG    105
d1qx4a2      103 MIRDHLPPPGEETLILM----------CGPPPMIQFAC-LPNLERVGHPKERCFTF----    147

Query        106 GIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1qx4a2      148 --------------------------------    148


hit structure      alignment
HHsearch alignment (Probability: 0.02 E-value:0.16)
DALI match       ........     .......***********
Query         69 SKEKVIITYCWGPACNGATKAAAKFAQLGFR     99
d1qx4a2      110 PPGEETLILMCGPPPMIQFACLPNLERVGHP    140



top
53: d1mw9x_ DNA topoisomerase I,​ 67K N-​terminal domain (svm: 0.621)

SCOP Superfamily: Prokaryotic type I DNA topoisomerase  |  SCOP Fold: Prokaryotic type I DNA topoisomerase  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.20  Contact: 526
Modified z-scores:
dali:0.76 daliz:0.75 gdtts:0.84 tmscore:0.86 rmsd:0.41 AHM:0.37 LBcontacta:0.71 LBcontactb:0.84 LHM:0.34
id:0.94 blosum:0.68 compass:0.47 pearson:0.74
Scaled scores:
dali:0.67 daliz:0.31 gdtts:0.47 tmscore:0.50 rmsd:0.74 AHM:0.69 LBcontacta:0.34 LBcontactb:0.62 LHM:0.24
id:0.10 blosum:0.11 compass:0.07 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 3.1 Raw score:283.10)
Query          1 npneayrhymkklsyetdiadlsidikkgyEGIIVVDVrDAEAYKeCHIP------TAIS     54
d1mw9x_        1 ------------------------------GKALVIVE-SPAKAK-TINKylgsdyVVKS     28

Query         55 IPGNK---------------------------------iNEDTTKRL-SKEKVIITYCWG     80
d1mw9x_       29 SVGHIrdlptergalvnrmgvdpwhnweahyevlpgkekVVSELKQLaEKADHIYLATDL     88

Query         81 PACNgaTKAAAKFAQLG---fRVKELIGgiEYWRkENGE---------------------    116
d1mw9x_       89 DREG-eAIAWHLREVIGgddaRYSRVVF--NEIT-KNAIrqafnkpgelnidrvnaqqar    144

Query        117 ------------------------------------------------------------    117
d1mw9x_      145 rfmdrvvgymvspllwkkiarglsagrvqsvavrlvverereikafvpeefwevdasttt    204

Query        117 ------------------------------------------------------------    117
d1mw9x_      205 psgealalqvthqndkpfrpvnkeqtqaavsllekarysvleredkpttskpgapfitst    264

Query        117 vegtlgakadlfwnmKKESLE---------------------------------------    137
d1mw9x_      265 lqqaastrlgfgvkkTMMMAQrlyeagyitymrtdstnlsqdavnmvrgyisdnfgkkyl    324

Query        138 ------------------------------------------------------------    138
d1mw9x_      325 pespnqyareairpsdvnvmaeslkdmeadaqklyqliwrqfvacqmtpakydsttltvg    384

Query        138 ------------------------------------------------------------    138
d1mw9x_      385 agdfrlkargrilrfdgwtkvmpaledrilpavnkgdaltlveltpaqhftkpparfsea    444

Query        138 ------------------------------------------------------------    138
d1mw9x_      445 slvkelekrgigrpstyasiistiqdrgyvrvenrrfyaekmgeivtdrleenfrelmny    504

Query        138 ----------------------------------------------------    138
d1mw9x_      505 dftaqmennldqvanheaewkavldhffsdftqqldkaekdpeeggmrpnqm    556


hit structure      alignment
FAST alignment (Normalized score: 1.32 Raw score:365.70)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE-GIIVVDVRDAEAYKECHI-------PTA     52
d1mw9x_        1 -------------------------------GKALVIV-ESPAKAK----TINKYLGSDY     24

Query         53 ISIPGNKI------------------------------------NEDTTKRLSKE-----     71
d1mw9x_       25 VVKS----SVGHIRDLPTERGALVNRMGVDPWHNWEAHYEVLPGKEKVVSE----LKQLA     76

Query         72 ---KVIITYCWGPACNGATKAAAKFAQLGF-------RVKELIGGIEYWRKENGEVEGTL    121
d1mw9x_       77 EKADHIYLATDL--DREGEAIAWHLRE---VIGGDDARYSRV--VFNE------------    117

Query        122 GAKADLFWNMKKESLE--------------------------------------------    137
d1mw9x_      118 ----------------ITKNAIRQAFNKPGELNIDRVNAQQARRFMDRVVGYMVSPLLWK    161

Query        138 ------------------------------------------------------------    138
d1mw9x_      162 KIARGLSAGRVQSVAVRLVVEREREIKAFVPEEFWEVDASTTTPSGEALALQVTHQNDKP    221

Query        138 ------------------------------------------------------------    138
d1mw9x_      222 FRPVNKEQTQAAVSLLEKARYSVLEREDKPTTSKPGAPFITSTLQQAASTRLGFGVKKTM    281

Query        138 ------------------------------------------------------------    138
d1mw9x_      282 MMAQRLYEAGYITYMRTDSTNLSQDAVNMVRGYISDNFGKKYLPESPNQYAREAIRPSDV    341

Query        138 ------------------------------------------------------------    138
d1mw9x_      342 NVMAESLKDMEADAQKLYQLIWRQFVACQMTPAKYDSTTLTVGAGDFRLKARGRILRFDG    401

Query        138 ------------------------------------------------------------    138
d1mw9x_      402 WTKVMPALEDRILPAVNKGDALTLVELTPAQHFTKPPARFSEASLVKELEKRGIGRPSTY    461

Query        138 ------------------------------------------------------------    138
d1mw9x_      462 ASIISTIQDRGYVRVENRRFYAEKMGEIVTDRLEENFRELMNYDFTAQMENNLDQVANHE    521

Query        138 -----------------------------------    138
d1mw9x_      522 AEWKAVLDHFFSDFTQQLDKAEKDPEEGGMRPNQM    556


hit structure      alignment
TMalign alignment (TM-score: 0.27 Raw score:37.61)
Query          1 ------------------------------------------------------------      1
d1mw9x_        1 GKALVIVESPAKAKTINKYLGSDYVVKSSVGHIRDLPTERGALVNRMGVDPWHNWEAHYE     60

Query          1 ----------------------------------------------------------NP      2
d1mw9x_       61 VLPGKEKVVSELKQLAEKADHIYLATDLDREGEAIAWHLREVIGGDDARYSRVVFNEI--    118

Query          3 NEAYRHYMKKLSYETDIADLSIDIKKGYEGII----------------------------     34
d1mw9x_      119 -------------------------------TKNAIRQAFNKPGELNIDRVNAQQARRFM    147

Query         35 ------------------------------------------------------------     35
d1mw9x_      148 DRVVGYMVSPLLWKKIARGLSAGRVQSVAVRLVVEREREIKAFVPEEFWEVDASTTTPSG    207

Query         35 ------------------------------------------------------------     35
d1mw9x_      208 EALALQVTHQNDKPFRPVNKEQTQAAVSLLEKARYSVLEREDKPTTSKPGAPFITSTLQQ    267

Query         35 ---------------VVDVRDAEA-YKECHIPTAISIPGNKINEDTTKRL--S-KEK---     72
d1mw9x_      268 AASTRLGFGVKKTMM---MAQ--RLYE--A---GYITYMRTDSTNLSQDAVNMVRGYISD    317

Query         73 ----------------------VI-ITY--C--WGPAC-NGATKAAAKFAQLGF------     98
d1mw9x_      318 NFGKKYLPESPNQYAREAIRPSDVNVMAESLKDMEADAQKLYQLIWRQFVACQMTPAKYD    377

Query         99 ------------------------R--VK-------------------------------    101
d1mw9x_      378 STTLTVGAGDFRLKARGRILRFDGWTK-VMPALEDRILPAVNKGDALTLVELTPAQHFTK    436

Query        102 --------------------------ELIGGIEYWRKENGEVEGTLGAKADLFWNMKKE-    134
d1mw9x_      437 PPARFSEASLVKELEKRGIGRPSTYA--------------------------------SI    464

Query        135 -SL---------------------------------------------------------    136
d1mw9x_      465 ISTIQDRGYVRVENRRFYAEKMGEIVTDRLEENFRELMNYDFTAQMENNLDQVANHEAEW    524

Query        137 --------------------------------E    137
d1mw9x_      525 KAVLDHFFSDFTQQLDKAEKDPEEGGMRPNQM-    556


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.63)
DALI match                    
Query         16 ETDIADLSIDIKK     28
d1mw9x_      117 EITKNAIRQAFNK    129



top
54: d4cd2a_ Dihydrofolate reductases,​ eukaryotic type (svm: 0.618)

SCOP Superfamily: Dihydrofolate reductases  |  SCOP Fold: Dihydrofolate reductases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.18  Contact: 349
Modified z-scores:
dali:0.67 daliz:0.67 gdtts:0.76 tmscore:0.76 rmsd:0.43 AHM:0.50 LBcontacta:0.70 LBcontactb:0.76 LHM:0.21
id:0.84 blosum:0.51 compass:0.58 pearson:0.78
Scaled scores:
dali:0.64 daliz:0.25 gdtts:0.47 tmscore:0.43 rmsd:0.69 AHM:0.60 LBcontacta:0.35 LBcontactb:0.59 LHM:0.35
id:0.07 blosum:0.07 compass:0.17 pearson:0.16

hit structure      alignment
DALI alignment (Z-score: 0.8 Raw score:193.30)
Query          1 --npneayrHYMKK--------lsyetdIADLSIDIKKG------yEGIIVVDVRDaeaY     44
d4cd2a_        1 ksltlivalTTSYGigrsnslpwklkkeISYFKRVTSFVptfdsfeSMNVVLMGRK--tW     58

Query         45 KEC-----HIPT--AISIP------------gnKINEDTTKRLS---------keKVIIT     76
d4cd2a_       59 ESIplqfrPLKGriNVVITrnesldlgngihsaKSLDHALELLYrtygsessvqiNRIFV    118

Query         77 YCwgpacNGATKAAAKfAQLG----------------------------frvkeliggie    108
d4cd2a_      119 IG----gAQLYKAAMD-HPKLdrimatiiykdihcdvffplkfrdkewssvwkkekhsdl    173

Query        109 ywrkengevegtlgakadlfwnmkkesle    137
d4cd2a_      174 eswvgtkvphgkinedgfdyefemwtrdl    202


hit structure      alignment
FAST alignment (Normalized score: 1.71 Raw score:284.10)
Query          1 NPNEAYRHYMKKLSYET------------------------DIADLSIDIKKGYE-----     31
d4cd2a_        1 -----------------KSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKR----VTSFV     39

Query         32 --------GIIVVDVRDAEAYKE------CHIPTAISIPGNKI-----------------     60
d4cd2a_       40 PTFDSFESMNVVLM--GRKTWE-SIPLQFRPLKGRINVV----ITRNESLDLGNGIHSAK     92

Query         61 -NEDTTKRLSKE-------------KVIITYCWGPACNG-ATKAAAKFAQLGFR--VKEL    103
d4cd2a_       93 SLDHALEL----LYRTYGSESSVQINRIFVI--------GGAQLYKAAMDHP--KLDRIM    138

Query        104 IGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE--------------------------    137
d4cd2a_      139 ----------------------------------ATIIYKDIHCDVFFPLKFRDKEWSSV    164

Query        138 --------------------------------------    138
d4cd2a_      165 WKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL    202


hit structure      alignment
TMalign alignment (TM-score: 0.34 Raw score:46.38)
Query          1 -----NPNEAYRHYMKK-------------------L---S---Y---------------     15
d4cd2a_        1 KSLTL---------IVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVV     51

Query         16 -E---TD-IADLSIDIKKGYEGIIVVDVRDAEAYKECHIP-TAISIPGNKINEDTTK-RL     68
d4cd2a_       52 LMGRKTWESIP-LQFRP-LKG-RINVVITR--NE-SLDLGNGIHSAKSLDHALELLYRTY    105

Query         69 ------SKEKVIITYCWGPACNGATKAAA-KFAQLGFRV---------------------    100
d4cd2a_      106 GSESSVQINRIFVIGG----AQ-LYKAAMDH-PKLDRIMATIIYKDIHCDVFFPLKFRDK    159

Query        101 -------------------------------------------KELIGGIEYWRKENGEV    117
d4cd2a_      160 EWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL-----------------    202

Query        118 EGTLGAKADLFWNMKKESLE    137
d4cd2a_      203 --------------------    203


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.47)
DALI match                        
Query        118 EGTLGAKADLFWNMKKE    134
d4cd2a_       12 SYGIGRSNSLPWKLKKE     28



top
55: d1t5ba_ ACP phosphodiesterase AcpD (svm: 0.735)

SCOP Superfamily: Flavoproteins  |  SCOP Fold: Flavodoxin-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.36  Contact: 459
Modified z-scores:
dali:0.70 daliz:0.69 gdtts:0.78 tmscore:0.78 rmsd:0.45 AHM:0.51 LBcontacta:0.68 LBcontactb:0.77 LHM:0.38
id:0.79 blosum:0.55 compass:0.55 pearson:0.79
Scaled scores:
dali:0.65 daliz:0.28 gdtts:0.47 tmscore:0.46 rmsd:0.68 AHM:0.56 LBcontacta:0.33 LBcontactb:0.57 LHM:0.13
id:0.05 blosum:0.11 compass:0.13 pearson:0.17

hit structure      alignment
DALI alignment (Z-score: 1.6 Raw score:196.10)
Query          1 npneayrhymkklsyetdiADLSIDIKKG-------------------------------     29
d1t5ba_        1 mskvlvlkssilagysqsgQLTDYFIEQWrekhvadeitvrdlaanpvpvldgelvgamr     60

Query         30 -----------------------yEGIIVVDV------RDAEaykechiptaisiPGNKI     60
d1t5ba_       61 dapltprqqdalalsdeliaelkaHDVIVIAApmynfnIPTQ-------------LKNYF    107

Query         61 NeDTTK-------------rlSKEKVIITYCWG-------pACNGATKAAAKFAQLGF-R     99
d1t5ba_      108 D-LIARagitfrytekgpeglVTGKRAVVLSSRggihkdtpTDLIAPYLKVFLGFIGItD    166

Query        100 VKELigGIEY------wRKENGEvegtlgakadlfwnmkkesle    137
d1t5ba_      167 VNFV--FAEGiaygpevAAKAQA---------dakaaidsvvaa    199


hit structure      alignment
FAST alignment (Normalized score: 2.29 Raw score:378.40)
Query          1 NPNEAYRHYMKKLSYET-----------------DIADLSIDIKKGY-------------     30
d1t5ba_        1 -----------------MSKVLVLKSSILAGYSQSGQLTDYFIE---QWREKHVADEITV     40

Query         31 --------------------------------------------EGIIVVDVRDAEAYKE     46
d1t5ba_       41 RDLAANPVPVLDGELVGAMRDAPLTPRQQDALALSDELIAELKAHDVIVIAA--------     92

Query         47 CHIPTAISIP-------GNKINEDTTKRL-------------------SKEKVIITYCWG     80
d1t5ba_       93 ----------PMYNFNIPTQL-KNYFD--LIARAGITFRYTEKGPEGLVTGKRAVVL---    136

Query         81 P-----------ACNGATKAAAKFAQLG-FRVKELIGGIEYWRKENGEVEGTLGAKADLF    128
d1t5ba_      137 -SSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFV-------------------------    170

Query        129 WNMKKESLE-----------------------------    137
d1t5ba_      171 ---------FAEGIAYGPEVAAKAQADAKAAIDSVVAA    199


hit structure      alignment
TMalign alignment (TM-score: 0.38 Raw score:51.54)
Query          1 -----------------NPNEAYRHYMKKLSYETDI--ADLSIDIKKGY-------E---     31
d1t5ba_        1 MSKVLVLKSSILAGYSQ------------------SGQ-LTDYFIEQWREKHVADEITVR     41

Query         32 ---------------------------------------------GIIVVDV-----RDA     41
d1t5ba_       42 DLAANPVPVLDGELVGAMRDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPT    101

Query         42 EAYKECHIPTAISIPGNKINEDTT----K-----------RLSKEKVIIT-YCW-GPA--     82
d1t5ba_      102 ------------QLK-NYFD-LIARAGITFRYTEKGPEGL--VTGKRAVVLSSRGGIHKD    145

Query         83 ---CNGATKAAAKFAQLGF-RVKELIGGIEY--WR--KEN-G-------------EVEGT    120
d1t5ba_      146 TPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYG-PEVAAKAQADAKAAIDSVVAA-----    199

Query        121 LGAKADLFWNMKKESLE    137
d1t5ba_      200 -----------------    200


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.70)
DALI match                            
Query         86 ATKAAAKFAQL--GFRVKELI    104
d1t5ba_       22 TDYFIEQWREKHVADEITVRD     42



hit structures. 
top
56: d1i7da_ DNA topoisomerase III (svm: 0.620)

SCOP Superfamily: Prokaryotic type I DNA topoisomerase  |  SCOP Fold: Prokaryotic type I DNA topoisomerase  |  SCOP Class: Multi-​domain proteins (alpha and beta)

Consensus: 0.00  Contact: 561
Modified z-scores:
dali:0.74 daliz:0.75 gdtts:0.84 tmscore:0.84 rmsd:0.35 AHM:0.31 LBcontacta:0.74 LBcontactb:0.78 LHM:0.30
id:0.86 blosum:0.62 compass:0.53 pearson:0.77
Scaled scores:
dali:0.67 daliz:0.30 gdtts:0.51 tmscore:0.51 rmsd:0.75 AHM:0.72 LBcontacta:0.40 LBcontactb:0.58 LHM:0.30
id:0.08 blosum:0.12 compass:0.11 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:248.80)
Query          1 npneayrhymkklsyetdiadlsidikkgyeGIIVVDVRdAEAYkeCHIP----------     50
d1i7da_        1 -------------------------------MRLFIAEK-PSLA--RAIAdvlpkphrkg     26

Query         51 ----------TAISIPGNK-------------------------------------inED     63
d1i7da_       27 dgfiecgngqVVTWCIGHLleqaqpdaydsryarwnladlpivpekwqlqprpsvtkqLN     86

Query         64 TTKRLSKEK-VIITYCWGpACNGATKAAAKFAQLGF------rVKELigGIEYwRKENG-    115
d1i7da_       87 VIKRFLHEAsEIVHAGDP-DREGQLLVDEVLDYLQLapekrqqVQRC--LIND-LNPQAv    142

Query        116 ------------------------------------------------------------    116
d1i7da_      143 eraidrlrsnsefvplcvsalararadwlyginmtraytilgrnagyqgvlsvgrvqtpv    202

Query        116 ------------------------------------------------------------    116
d1i7da_      203 lglvvrrdeeienfvakdffevkahivtpaderftaiwqpseacepyqdeegrllhrpla    262

Query        116 ------------------------------------------------------------    116
d1i7da_      263 ehvvnrisgqpaivtsyndkresesaplpfslsalqieaakrfglsaqnvldicqklyet    322

Query        116 ------------------------------------------------------------    116
d1i7da_      323 hklitfprsdcrylpeehfagrhavmnaisvhapdllpqpvvdpdirnrcwddkkvdahh    382

Query        116 ------------------------------------------------------------    116
d1i7da_      383 aiiptarssainlteneakvynliarqylmqfcpdavfrkcvieldiakgkfvakarfla    442

Query        116 ------------------------------------------------------------    116
d1i7da_      443 eagwrtllgskerdeendgtplpvvakgdellcekgevverqtqpprhftdatllsamtg    502

Query        116 ------------------------------------------------------------    116
d1i7da_      503 iarfvqdkdlkkilratdglgteatragiiellfkrgfltkkgryihstdagkalfhslp    562

Query        116 ------------------------------------evegtlgakadlfwnmkkesle    137
d1i7da_      563 ematrpdmtahwesvltqisekqcryqdfmqplvgtlyqlidqakrtpvrqfrgivap    620


hit structure      alignment
FAST alignment (Normalized score: 0.50 Raw score:145.30)
Query          1 ------------------------------------------------------------      1
d1i7da_        1 MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRYAR     60

Query          1 ------------------------------------------------------------      1
d1i7da_       61 WNLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHAGDPDREGQLLVDEVLDYLQ    120

Query          1 -----------------------------------NPNEAYRHYMKKLSYET----DIAD     21
d1i7da_      121 LAPEKRQQVQRCLINDLNPQAVERAIDRLRSNSEFVPLCVSALARARA----DWLYGINM    176

Query         22 LSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKEKVIITYCWGP     81
d1i7da_      177 TRAYTI------------------------------------------------------    182

Query         82 A--------------CNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADL    127
d1i7da_      183 -LGRNAGYQGVLSVGRVQTPVLGLVVRR--------------------------------    209

Query        128 FWNMKKESLE--------------------------------------------------    137
d1i7da_      210 ----------DEEIENFVAKDFFEVKAHIVTPADERFTAIWQPSEACEPYQDEEGRLLHR    259

Query        138 ------------------------------------------------------------    138
d1i7da_      260 PLAEHVVNRISGQPAIVTSYNDKRESESAPLPFSLSALQIEAAKRFGLSAQNVLDICQKL    319

Query        138 ------------------------------------------------------------    138
d1i7da_      320 YETHKLITFPRSDCRYLPEEHFAGRHAVMNAISVHAPDLLPQPVVDPDIRNRCWDDKKVD    379

Query        138 ------------------------------------------------------------    138
d1i7da_      380 AHHAIIPTARSSAINLTENEAKVYNLIARQYLMQFCPDAVFRKCVIELDIAKGKFVAKAR    439

Query        138 ------------------------------------------------------------    138
d1i7da_      440 FLAEAGWRTLLGSKERDEENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSA    499

Query        138 ------------------------------------------------------------    138
d1i7da_      500 MTGIARFVQDKDLKKILRATDGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFH    559

Query        138 ------------------------------------------------------------    138
d1i7da_      560 SLPEMATRPDMTAHWESVLTQISEKQCRYQDFMQPLVGTLYQLIDQAKRTPVRQFRGIVA    619

Query        138 -    138
d1i7da_      620 P    620


hit structure      alignment
TMalign alignment (TM-score: 0.26 Raw score:36.07)
Query          1 ------------------------------------------------------------      1
d1i7da_        1 MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRYAR     60

Query          1 ------------------------------------------------------------      1
d1i7da_       61 WNLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHAGDPDREGQLLVDEVLDYLQ    120

Query          1 -----------------NPNEAYRHYMKKLSYETDIADLSIDIKKGYE------------     31
d1i7da_      121 LAPEKRQQVQRCLINDL------------------------------NPQAVERAIDRLR    150

Query         32 ------------------------------------------------------------     32
d1i7da_      151 SNSEFVPLCVSALARARADWLYGINMTRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRD    210

Query         32 ------------------------------------------------------------     32
d1i7da_      211 EEIENFVAKDFFEVKAHIVTPADERFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRIS    270

Query         32 --------------------GIIVVDVR----DA--------------E-AYKECH--IP     50
d1i7da_      271 GQPAIVTSYNDKRESESAPL------PFSLSALQIEAAKRFGLSAQNVLDICQKLYETHK    324

Query         51 TAISI-P--GNKINEDTTKRLSKEKVIIT--YC-WGPACNGATK-AAAKFAQLG--F---     98
d1i7da_      325 LITFPRSDC--R---YLPEEHFAGRHAVMNAISVHAPD-L-LPQP-VVDPDIRNRCWDDK    376

Query         99 ---------RVKEL-IGGIEYWRKENGEVEGTLGAKADLFWN------------------    130
d1i7da_      377 KVDAHHAII---PTA--RS-SAIN----------LTENEAKVYNLIARQYLMQFCPDAVF    420

Query        131 ------------------------------------------------------------    131
d1i7da_      421 RKCVIELDIAKGKFVAKARFLAEAGWRTLLGSKERDEENDGTPLPVVAKGDELLCEKGEV    480

Query        131 -----------MKKESLE------------------------------------------    137
d1i7da_      481 VERQTQPPRHF----TDATLLSAMTGIARFVQDKDLKKILRATDGLGTEATRAGIIELLF    536

Query        138 ------------------------------------------------------------    138
d1i7da_      537 KRGFLTKKGRYIHSTDAGKALFHSLPEMATRPDMTAHWESVLTQISEKQCRYQDFMQPLV    596

Query        138 ------------------------    138
d1i7da_      597 GTLYQLIDQAKRTPVRQFRGIVAP    620


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.73)
DALI match                        
Query         16 ETDIADLSIDIKKGYEG     32
d1i7da_      136 DLNPQAVERAIDRLRSN    152



top
57: d1ne7a_ Glucosamine 6-​phosphate deaminase/​isomerase NagB (svm: 0.865)

SCOP Superfamily: NagB/​RpiA/​CoA transferase-​like  |  SCOP Fold: NagB/​RpiA/​CoA transferase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.09  Contact: 378
Modified z-scores:
dali:0.70 daliz:0.77 gdtts:0.73 tmscore:0.72 rmsd:0.39 AHM:0.42 LBcontacta:0.81 LBcontactb:0.76 LHM:0.45
id:0.54 blosum:0.29 compass:0.60 pearson:0.78
Scaled scores:
dali:0.68 daliz:0.34 gdtts:0.47 tmscore:0.44 rmsd:0.70 AHM:0.61 LBcontacta:0.48 LBcontactb:0.62 LHM:0.13
id:0.00 blosum:0.03 compass:0.15 pearson:0.19

hit structure      alignment
DALI alignment (Z-score: 0.8 Raw score:187.60)
Query          1 npneayrhymkklsyetDIADLSIDIKKG-------------------------------     29
d1ne7a_        1 --mkliilehysqasewAAKYIRNRIIQFnpgpekyftlglptgstplgcykklieyykn     58

Query         30 ------------------------------------------------------------     30
d1ne7a_       59 gdlsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaec    118

Query         30 -----------yeGIIVVDVRDAeaykechiptaisiPGNKI-----NEDT---------     64
d1ne7a_      119 dafeekikaaggiELFVGGIGPD-------------gHIAFNepgssLVSRtrvktlamd    165

Query         65 ------------------------TKRLSKEKVIITYCWGPACN-----------gatka     89
d1ne7a_      166 tilanarffdgeltkvptmaltvgVGTVMDAREVMILITGAHKAfalykaieegvnhmwt    225

Query         90 aAKFAqLGFRVKELIG---------gieywrkengevegtlgakadlfwnmkkesle    137
d1ne7a_      226 vSAFQ-QHPRTVFVCDedatlelkvktvkyfkglmlvhnklvdplysikeketeksq    281


hit structure      alignment
FAST alignment (Normalized score: 1.01 Raw score:198.60)
Query          1 NPNEAYRHYMKKLSYET---------------DIADLSIDIKKGY---------------     30
d1ne7a_        1 -----------------MKLIILEHYSQASEWAAKYIRNRII---QFNPGPEKYFTLGLP     40

Query         31 ------------------------------------------------------------     31
d1ne7a_       41 TGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIH    100

Query         31 --------------------------------EGIIVVDVRD------------------     40
d1ne7a_      101 PENTHILDGNAVDLQAECDAFEEKIKAAGGIELFVGGI----GPDGHIAFNEPGSSLVSR    156

Query         41 ------AEAYKECHIPTAISIPGNKINED---------------------TTKRLSKE--     71
d1ne7a_      157 TRVKTLAMDTI------------------LANARFFDGELTKVPTMALTVGVGT----VM    194

Query         72 ----KVIITYCWGPA-CNGATKAAAKFAQLG-----------------FRVKELIGGIEY    109
d1ne7a_      195 DAREVMILI------TGAHKAFALYKAIE--EGVNHMWTVSAFQQHPRTVFVC-------    239

Query        110 WRKENGEVEGTLGAKADLFWNMKKESLE--------------------------------    137
d1ne7a_      240 ----------------------------DEDATLELKVKTVKYFKGLMLVHNKLVDPLYS    271

Query        138 ----------    138
d1ne7a_      272 IKEKETEKSQ    281


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:45.28)
Query          1 -------------------------------------NPNEAYRHYMKKLSYET-DIADL     22
d1ne7a_        1 MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTL----------------GL----P     40

Query         23 SIDIKK-GYE--G---------------IIVVDVRDAEAYKE-CHI-PTAIS--------     54
d1ne7a_       41 T-GSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDI     99

Query         55 IPGNKINEDTTKRLSKEKVIITYCW---GPACN-GATKAAAKFAQLGFRV-K--------    101
d1ne7a_      100 -------HPEN--T-----HILDGNAVD---LQAECDAFEEKIKAAGGIELFVGGIGPDG    142

Query        102 -ELIG-----------GIEYW--RKENG-EVEGTLGA-K--ADLFW--------------    129
d1ne7a_      143 HIAFNEPGSSLVSRTRVKTLAMDTILANARF----FDGELTKVPTMALTVGVGTVMDARE    198

Query        130 ------------------------------------------------------------    130
d1ne7a_      199 VMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGL    258

Query        130 -----------------------NMKKESLE    137
d1ne7a_      259 MLVHNKLVDPLYSIKEKETEKSQ--------    281


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.48)
DALI match                    
Query          1 NPNEAYRHYMKKL     13
d1ne7a_      113 DLQAECDAFEEKI    125



top
58: d1puja_ Probable GTPase YlqF (svm: -1.039)

SCOP Superfamily: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Fold: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.33  Contact: 585
Modified z-scores:
dali:0.93 daliz:0.91 gdtts:0.93 tmscore:0.93 rmsd:0.34 AHM:0.36 LBcontacta:0.82 LBcontactb:0.87 LHM:0.19
id:0.85 blosum:0.46 compass:0.50 pearson:0.79
Scaled scores:
dali:0.72 daliz:0.38 gdtts:0.54 tmscore:0.57 rmsd:0.77 AHM:0.70 LBcontacta:0.36 LBcontactb:0.60 LHM:0.37
id:0.04 blosum:0.09 compass:0.11 pearson:0.12

hit structure      alignment
DALI alignment (Z-score: 3.5 Raw score:318.70)
Query          1 npneayrhymkklsyetDIADLSIDIkkgYEGIIVVDVRD----AEAYkeCHIP------     50
d1puja_        1 -------------hmakARREVTEKL---KLIDIVYELVDaripMSSR-nPMIEdilknk     43

Query         51 taISIPGN-------------------------------kiNEDTTKRLS----------     69
d1puja_       44 prIMLLNKadkadaavtqqwkehfenqgirslsinsvngqgLNQIVPASKeilqekfdrm    103

Query         70 -------kEKVIITYCWGpaCNGATKAAAKFAQ----------lgFRVKELiGGIEywrk    112
d1puja_      104 rakgvkprAIRALIIGIP--NVGKSTLINRLAKkniaqwvkvgkeLELLDT-PGIL----    156

Query        113 engevegtlGAKA-----dlFWNM------------------------------------    131
d1puja_      157 ---------WPKFedelvglRLAVtgaikdsiinlqdvavfglrfleehyperlkerygl    207

Query        132 ----------------------------------------------kkESLE--    137
d1puja_      208 deipediaelfdaigekrgclmsgglinydktteviirdirtekfgrlSFEQpt    261


hit structure      alignment
FAST alignment (Normalized score: 2.59 Raw score:489.10)
Query          1 NPNEAYRHYMKKLSYET----DIADLSIDIKKGYEG--IIVVDVRDAEAYKECHI-----     49
d1puja_        1 -----------------HMAKARREVTEKLK-----LIDIVYELVDARIPM----SSRNP     34

Query         50 --------PTAISIPGNKI-------------------------------------NEDT     64
d1puja_       35 MIEDILKNKPRIMLLN---KADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPA     91

Query         65 TKRLSK-----------------EKVIITYCWGPACNGATKAAAKFAQL-----------     96
d1puja_       92 SKE---ILQEKFDRMRAKGVKPRAIRALIIG-IPNV-GKSTLINRL---AKKNIAQWVKV    143

Query         97 --GFRVKELIGGIEYWRKENGEVEGTLGAKADLFW------------NMKKESLE-----    137
d1puja_      144 GKELELLDT--------------------------PGILWPKFEDELVGLRLAV-TGAIK    176

Query        138 ------------------------------------------------------------    138
d1puja_      177 DSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINY    236

Query        138 -------------------------    138
d1puja_      237 DKTTEVIIRDIRTEKFGRLSFEQPT    261


hit structure      alignment
TMalign alignment (TM-score: 0.33 Raw score:44.83)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNK-     59
d1puja_        1 -------------------------------------------------------H-MAK      4

Query         60 INEDTT-KRLSKEKVIITYCWGPACN-GATKAAAKFAQLGFRVKELIGGIEY--------    109
d1puja_        5 AR-REVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK-NKPRIMLL-N-KADKADAAVT     60

Query        110 -----------------WRKENGE------------------------------------    116
d1puja_       61 QQWKEHFENQGIRSLSINSV-NGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIG    119

Query        117 -------V--E-----G----------------------------------TLGAKADLF    128
d1puja_      120 IPNVGKSTLINRLAKKNIAQWVKVGKELELLDTPGILWPKFEDELVGLRLA--------V    171

Query        129 WN-MKK-ESLE-------------------------------------------------    137
d1puja_      172 TGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSG    231

Query        138 ------------------------------    138
d1puja_      232 GLINYDKTTEVIIRDIRTEKFGRLSFEQPT    261


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.04)
DALI match       ******.  ............
Query         21 DLSIDIKKGYEGIIVVDVRDA     41
d1puja_        8 EVTEKLKLIDIVYELVDARIP     28



top
59: d1g2qa_ Adenine PRTase (svm: 0.457)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.42  Contact: 523
Modified z-scores:
dali:0.82 daliz:0.84 gdtts:0.85 tmscore:0.85 rmsd:0.35 AHM:0.37 LBcontacta:0.79 LBcontactb:0.80 LHM:0.20
id:0.91 blosum:0.79 compass:0.55 pearson:0.76
Scaled scores:
dali:0.69 daliz:0.36 gdtts:0.52 tmscore:0.52 rmsd:0.72 AHM:0.62 LBcontacta:0.42 LBcontactb:0.61 LHM:0.37
id:0.08 blosum:0.15 compass:0.10 pearson:0.14

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:291.30)
Query          1 -----------------------------npneayrhymkklsyetDIADLSIDIkKGYE     31
d1g2qa_        1 mpiasyaqelklalhqypnfpsegilfedflpifrnpglfqklidaFKLHLEEAF-PEVK     59

Query         32 GIIVVDVRDaeaykeCHIP--------tAISIP---------------------gnKINE     62
d1g2qa_       60 IDYIVGLES---rgfLFGPtlalalgvgFVPVRkagklpgecfkatyekeygsdlfEIQK    116

Query         63 dttKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFRVKELiGGIE-------------    108
d1g2qa_      117 ---NAIPAGSNVIIVDDIIAtGGSAAAAGELVEQLEANLLEY-NFVMeldflkgrsklna    172

Query        109 --YWRKengevegtlgakadlfwnmkkesle    137
d1g2qa_      173 pvFTLL-------------------------    178


hit structure      alignment
FAST alignment (Normalized score: 3.08 Raw score:480.50)
Query          1 NPNEAYRHYMKKLSYET------------------------------------------D     18
d1g2qa_        1 -----------------MPIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKL     43

Query         19 IADLSIDIKKGYEG-------IIVVDVRDAEAYKECHIP-----------TAISIPG---     57
d1g2qa_       44 IDAFKLHLEE----AFPEVKIDYIVGL--ESRGFL----FGPTLALALGVGFVP---VRK     90

Query         58 ---------------------NKINEDTTKRLSKEKVIITYCW-GPACNGATKAAAKFAQ     95
d1g2qa_       91 AGKLPGECFKATYEKEYGSDLFEIQKNA---IPAGSNVIIVDDIIATGGSAAAAGELVEQ    147

Query         96 LGFR-VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-----------------    137
d1g2qa_      148 LEANLLEYN----------------------------------FVMELDFLKGRSKLNAP    173

Query        138 -----    138
d1g2qa_      174 VFTLL    178


hit structure      alignment
TMalign alignment (TM-score: 0.46 Raw score:62.68)
Query          1 ----------------------------------------------NPNEAYRHYMKKLS     14
d1g2qa_        1 MPIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDA--------------     46

Query         15 YETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHI--PT-----AISIPGNK--I---NE     62
d1g2qa_       47 ----FKLHLEEAFPEVKIDYIVGLES-RGF--LFGPTLALALGVGFVPVRKAGKLPGECF     99

Query         63 --------------DTTKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFRVKELIGGI    107
d1g2qa_      100 KATYEKEYGSDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYN-FV    158

Query        108 E----------------YWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1g2qa_      159 MELDFLKGRSKLNAPVFTL-L-------------------------    178


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.30)
DALI match       *********************
Query         83 CNGATKAAAKFAQLGFRVKEL    103
d1g2qa_      135 GGSAAAAGELVEQLEANLLEY    155



top
60: d1bzya_ Hypoxanthine-​guanine PRTase (HGPRTase) (svm: 0.516)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 558
Modified z-scores:
dali:0.85 daliz:0.87 gdtts:0.88 tmscore:0.88 rmsd:0.35 AHM:0.30 LBcontacta:0.82 LBcontactb:0.85 LHM:0.16
id:0.93 blosum:0.68 compass:0.60 pearson:0.88
Scaled scores:
dali:0.70 daliz:0.37 gdtts:0.53 tmscore:0.55 rmsd:0.74 AHM:0.73 LBcontacta:0.41 LBcontactb:0.64 LHM:0.46
id:0.09 blosum:0.12 compass:0.17 pearson:0.21

hit structure      alignment
DALI alignment (Z-score: 3.6 Raw score:341.00)
Query          1 -----------------------npneayrhymkklsyetdIADLSIDIKKGY--EGIIV     35
d1bzya_        1 spgvvisddepgydldlfcipnhyaedlervfiphglimdrTERLARDVMKEMggHHIVA     60

Query         36 VDVRDaeaykeCHIP-------------------tAISIPG--------------NKINe     62
d1bzya_       61 LCVLK---ggyKFFAdlldyikalnrnsdrsipmtVDFIRLksycndqstgdikvIGGD-    116

Query         63 dTTKRLSKeKVIITYCWGPA-CNGATKAAAKFAQLGF-RVKELigGIEY-----------    109
d1bzya_      117 -DLSTLTG-KNVLIVEDIIDtGKTMQTLLSLVRQYNPkMVKVA--SLLVkrtprsvgykp    172

Query        110 ---WRKEngevegtlgakADLFWNMKKE-----------------sle    137
d1bzya_      173 dfvGFEI------pdkfvVGYALDYNEYfrdlnhvcvisetgkakyka    214


hit structure      alignment
FAST alignment (Normalized score: 3.21 Raw score:550.10)
Query          1 NPNEAYRHYMKKLSYET----------------------------------------DIA     20
d1bzya_        1 -----------------SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTE     43

Query         21 DLSIDIKKG---YEGIIVVDVRDAEAYKECHI---------------------PTAISIP     56
d1bzya_       44 RLARDVMK-EMGGHHIVALCV--LKGGYK---FFADLLDYIKALNRNSDRSIPMTVDFIR     97

Query         57 --------------GNKINED-TTKRLSKEKVIITYCW-GPACNGATKAAAKFAQLG-FR     99
d1bzya_       98 LKSYCNDQSTGDIKVIGG---DDLST-LTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKM    153

Query        100 VKELIGGIEYWRKENGEVEGTLGAKA----------------------------DLFWNM    131
d1bzya_      154 VKVA----------------------SLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDY    191

Query        132 KKESLE-----------------------    137
d1bzya_      192 ------NEYFRDLNHVCVISETGKAKYKA    214


hit structure      alignment
TMalign alignment (TM-score: 0.49 Raw score:66.54)
Query          1 -------------------------------------------NPNEAYRHYMKKLSYET     17
d1bzya_        1 SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTE-----------------     43

Query         18 DI-ADLSIDIKKGYEGIIVVDVRDAEAYKECH-IP---------------T-AISIPG--     57
d1bzya_       44 RLARDVMKEM-GGHH-IVALCVLK-GGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKS    100

Query         58 -----------N-KINEDTTKRLSKEKVIITYCWGPACN-GATKAAAKFAQLGF-RVKEL    103
d1bzya_      101 YCNDQSTGDIKVIGGD--DLSTL-TGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVA    157

Query        104 IGG-------------IEYW--------RKENGEVEGTLGAKADLFWNMKKE--------    134
d1bzya_      158 SLLVKRTPRSVGYKPDFVGFEIPDKFVV---------------GYALDYNEYFRDLNHVC    202

Query        135 ---------SL-E    137
d1bzya_      203 VISETGKAKYKA-    214


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.74)
DALI match                                          
Query         62 EDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1bzya_       46 ARDVMKEMGGHHIVALCVLKG--GYKFFADLLDYI     78



hit structures. 
top
61: d1qz5a1 Actin (svm: -1.424)

SCOP Superfamily: Actin-​like ATPase domain  |  SCOP Fold: Ribonuclease H-​like motif  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.35  Contact: 387
Modified z-scores:
dali:0.86 daliz:0.88 gdtts:0.90 tmscore:0.90 rmsd:0.29 AHM:0.26 LBcontacta:0.86 LBcontactb:0.85 LHM:0.13
id:0.85 blosum:0.57 compass:0.50 pearson:0.68
Scaled scores:
dali:0.72 daliz:0.40 gdtts:0.59 tmscore:0.58 rmsd:0.79 AHM:0.75 LBcontacta:0.48 LBcontactb:0.69 LHM:0.43
id:0.06 blosum:0.09 compass:0.09 pearson:0.11

hit structure      alignment
DALI alignment (Z-score: 2.6 Raw score:252.40)
Query          1 npneayrhymkklsyetdiadlsidikkgyEGIIVVDVrDAEAY----------------     44
d1qz5a1        1 ------------------------------TTALVCDN-GSGLVkagfagddapravfps     29

Query         45 ----------------------kechiptaisipgNKIN--eDTTK---RLSK-EKVIIT     76
d1qz5a1       30 ivgrpdsyvgdeaqskrgiltlkypiexgiitnwdDMEKiwhHTFYnelRVAPeEHPTLL     89

Query         77 YCWgPACN--GATKAAAKFA-QLGF-RVKELigGIEYWRkENGEvegtlgakadlfwnmk    132
d1qz5a1       90 TEA-PLNPkaNREKMTQIMFeTFNVpAMYVA--IQAVLS-LYAS----------------    129

Query        133 kesle    137
d1qz5a1      130 ----g    130


hit structure      alignment
FAST alignment (Normalized score: 3.27 Raw score:436.30)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE-GIIVVDVRDAEAYKECHIPTAISI----     55
d1qz5a1        1 -------------------------------TTALVCDNG----------------SGLV     13

Query         56 ---------------------------------------------PGNKI-------NED     63
d1qz5a1       14 KAGFAGDDAPRAVFPSIVGRPDSYVGDEAQSKRGILTLKYPIEXGIITN-WDDMEKIWHH     72

Query         64 TTKRL------SKEKVIITYCWGPA----CNGATKAAAKFA-QLGF-RVKELIGGIEYWR    111
d1qz5a1       73 TFY--NELRVAPEEHPTLLTEA---PLNPKANREKMTQIMFETFNVPAMYVA--IQAVLS    125

Query        112 KENGEVEGTLGAKADLFWNMKKESLE----    137
d1qz5a1      126 L-------------------------YASG    130


hit structure      alignment
TMalign alignment (TM-score: 0.28 Raw score:38.24)
Query          1 NPNEAYRHYMKKLSYETDIA-----------DLSIDIKKGYEGIIVVDVRDAEAYKECHI     49
d1qz5a1        1 ----------------TTALVCDNGSGLVKAGFAGD--D-APRAVFP-------------     28

Query         50 PTAISIPG-NKIN-EDTTKR-----------------------LSKEKVIITYCWGPACN     84
d1qz5a1       29 ---SIVGRPDSYVGDEAQSKRGILTLKYPIEXGIITNWDDMEK--------IWH-----H     72

Query         85 GATKAAAKFAQLGFRVKELIGG-IEYWRKENGEVE---GT--LGAKA--D--LFW-----    129
d1qz5a1       73 TFY--N---------ELRVAPEE-HPT----LLTEAPLNPKANR-EKMTQIMFETFNVPA    115

Query        130 ---------------NMKKESLE    137
d1qz5a1      116 MYVAIQAVLSLYASG--------    130


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.36)
DALI match             ........******
Query         57 GNKINEDTTKRLSKEKVIIT     76
d1qz5a1       70 WHHTFYNELRVAPEEHPTLL     89



top
62: d1fsga_ Hypoxanthine-​guanine-​xanthine PRTase (svm: 0.448)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.47  Contact: 562
Modified z-scores:
dali:0.85 daliz:0.85 gdtts:0.89 tmscore:0.90 rmsd:0.33 AHM:0.33 LBcontacta:0.71 LBcontactb:0.82 LHM:0.14
id:0.62 blosum:0.43 compass:0.65 pearson:0.88
Scaled scores:
dali:0.69 daliz:0.34 gdtts:0.53 tmscore:0.56 rmsd:0.77 AHM:0.69 LBcontacta:0.30 LBcontactb:0.57 LHM:0.45
id:0.00 blosum:0.09 compass:0.16 pearson:0.18

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:331.50)
Query          1 --------------------------------------------npneayrhymkklsye     16
d1fsga_        1 gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve     60

Query         17 tDIADLSIDIkKGYEgIIVVDVRDaeAYKECH---------------------ipTAISI     55
d1fsga_       61 kLAYDIHRTY-FGEE-LHIICILK--GSRGFFnllidylatiqkysgressvppfFEHYV    116

Query         56 PG-------------NKINedTTKRLSKeKVIITYCWGPA-CNGATKAAAKFAQLGF-RV    100
d1fsga_      117 RLksyqndnstgqltVLSD--DLSIFRD-KHVLIVEDIVDtGFTLTEFGERLKAVGPkSM    173

Query        101 KELIG------------gieYWRKengevegtlgakaDLFWNMKKE--------------    134
d1fsga_      174 RIATLvekrtdrsnslkgdfVGFS------iedvwivGCCYDFNEMfrdfdhvavlsdaa    227

Query        135 ---sle    137
d1fsga_      228 rkkfek    233


hit structure      alignment
FAST alignment (Normalized score: 3.02 Raw score:539.70)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d1fsga_        1 -----------------GSHMASKPIEDYGKGKGRIEPMYIPDNTFYNADDFLVPPHCKP     43

Query         18 ------------------DIADLSIDIKKGYEGIIVVDVR---DAEAYKECHI-------     49
d1fsga_       44 YIDKILLPGGLVKDRVEKLAYDIHRTYFG--EELHIICI-LKGSRGFFN----LLIDYLA     96

Query         50 --------------PTAISIPGNKINED------------------TTKRLSKEKVIITY     77
d1fsga_       97 TIQKYSGRESSVPPFFEHYVR-------LKSYQNDNSTGQLTVLSDDLSI-FRDKHVLIV    148

Query         78 CWG-PACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKES    135
d1fsga_      149 EDIVDTGFTLTEFGERLKAVGPKSMRIA--------------------------------    176

Query        136 LE---------------------------------------------------------    137
d1fsga_      177 --TLVEKRTDRSNSLKGDFVGFSIEDVWIVGCCYDFNEMFRDFDHVAVLSDAARKKFEK    233


hit structure      alignment
TMalign alignment (TM-score: 0.52 Raw score:71.47)
Query          1 ------NPNEAYRHYMKKLSYE-T--D---------------------------------     18
d1fsga_        1 GSHMAS---------KPIEDYGKGKGRIEPMYIPDNTFYNADDFLVPPHCKPYIDKILLP     51

Query         19 ----------I-ADLSIDIKKGYEGIIVVDVRDAEAYKECH--IP---------------     50
d1fsga_       52 GGLVKDRVEKLAYDIHRTY-FGEE-LHIICILK-GSR-GFFNLLIDYLATIQKYSGRESS    107

Query         51 ---T-AISIPG-------------NKINEDTTKRLSKEKVIITYCWGPACN-GATKAAAK     92
d1fsga_      108 VPPFFEHYVRLKSYQNDNSTGQLTVLS--DDLS-IFRDKHVLIVEDIVDTGFTLTEFGER    164

Query         93 FAQLGFRVKELIGGIEY------------WRKE--------NGEVEGTLGAKADLFWNMK    132
d1fsga_      165 LKAVGPKSMRIA-TLVEKRTDRSNSLKGDFVGFSIEDVWIV-----------GCC-YDFN    211

Query        133 KE-----------------SL-E    137
d1fsga_      212 EMFRDFDHVAVLSDAARKKFEK-    233


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.91)
DALI match                                              
Query         58 NKINEDTTKRLSKEKVIITYCWGPACNGATKAAAKFAQL     96
d1fsga_       60 EKLAYDIHRTYFGEELHIICILKGSRGFFNLLIDYLATI     98



top
63: d1lu9a2 Methylene-​tetrahydromethanopterin dehydrogenase (svm: -1.692)

SCOP Superfamily: Aminoacid dehydrogenase-​like,​ N-​terminal domain  |  SCOP Fold: Aminoacid dehydrogenase-​like,​ N-​terminal domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.49  Contact: 582
Modified z-scores:
dali:0.88 daliz:0.90 gdtts:0.89 tmscore:0.89 rmsd:0.30 AHM:0.36 LBcontacta:0.81 LBcontactb:0.79 LHM:0.25
id:0.48 blosum:0.27 compass:0.29 pearson:0.64
Scaled scores:
dali:0.71 daliz:0.42 gdtts:0.62 tmscore:0.60 rmsd:0.78 AHM:0.65 LBcontacta:0.44 LBcontactb:0.59 LHM:0.30
id:-0.02 blosum:0.03 compass:0.04 pearson:0.08

hit structure      alignment
DALI alignment (Z-score: 3.8 Raw score:258.40)
Query          1 npneayrhymkklsyetdiadlsidikkgYEGIIVVDVRDAeaykeCHIP----------     50
d1lu9a2        1 ----------------------------sKKLLFQFDTDAT---psVFDVvvgydggadh     29

Query         51 -TAISIPG-NKINEdTTKRLS--------kEKVIITYCWGpaCNGATKAAAKFAQLG---     97
d1lu9a2       30 iTGYGNVTpDNVGA-YVDGTIytrggkekqSTAIFVGGGD--MAAGERVFEAVKKRFfgp     86

Query         98 --FRVKELIGgieywrkengevegtlgakadlfwnmkkesle    137
d1lu9a2       87 frVSCMLDSN--------------------------------     96


hit structure      alignment
FAST alignment (Normalized score: 3.70 Raw score:424.00)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE---GIIVVDVRDAEAYKECHI--------     49
d1lu9a2        1 -------------------------------SKKLLFQFDTD----------ATPSVFDV     19

Query         50 ----------PTAI-SIPGNKINEDTTKRL---------SKEKVIITYCWGPACNGATKA     89
d1lu9a2       20 VVGYDGGADHITGYGNVTPDNV-GAYVDG-TIYTRGGKEKQSTAIFVGGGD--MAAGERV     75

Query         90 AAKFAQL------GFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE--    137
d1lu9a2       76 FEAVKK-RFFGPFRVSCMLD----------------------------------SN     96


hit structure      alignment
TMalign alignment (TM-score: 0.39 Raw score:53.62)
Query          1 -NPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHI--P-------     50
d1lu9a2        1 S-----------------------------KKLLFQFDTD---AT--PSVFDVVVGYDGG     26

Query         51 ---T-AISIPGNKINEDTTKRLSK-------E--KVIITYCWGPACNGATKAAAKFAQLG     97
d1lu9a2       27 ADHITGYGNVTPDNVG-AYVDGTIYTRGGKEKQSTAIFVGGGD--MAAGERVFEAVKKRF     83

Query         98 ----F-RVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE    137
d1lu9a2       84 FGPFRVSCMLDS-N-------------------------------     96


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.60)
DALI match                  
Query          1 NPNEAYRHYMK     11
d1lu9a2       68 DMAAGERVFEA     78



top
64: d1cqxa3 Flavohemoglobin,​ C-​terminal domain (svm: 0.571)

SCOP Superfamily: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Fold: Ferredoxin reductase-​like,​ C-​terminal NADP-​linked domain  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.31  Contact: 477
Modified z-scores:
dali:0.84 daliz:0.89 gdtts:0.83 tmscore:0.84 rmsd:0.29 AHM:0.30 LBcontacta:0.80 LBcontactb:0.82 LHM:0.20
id:0.63 blosum:0.27 compass:0.50 pearson:0.67
Scaled scores:
dali:0.73 daliz:0.44 gdtts:0.56 tmscore:0.57 rmsd:0.78 AHM:0.71 LBcontacta:0.44 LBcontactb:0.69 LHM:0.36
id:0.01 blosum:0.05 compass:0.09 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 3.2 Raw score:283.90)
Query          1 npneayrhymkklsyetdiadlsidIKKGYEGIIVVDVRdaeaykECHIP----------     50
d1cqxa3        1 -------------------------DVDAKTPIVLISGG----vgLTPMVsmlkvalqap     31

Query         51 ---taISIP---------------------------------------------gNKINE     62
d1cqxa3       32 prqvvFVHGarnsavhamrdrlreaaktyenldlfvfydqplpedvqgrdydypgLVDVK     91

Query         63 DTTKRL-SKEKVIITYCWgpaCNGATKAAAKFAQLGF---RVKELigGIEYwrkengeve    118
d1cqxa3       92 QIEKSIlLPDADYYICGP---IPFMRMQHDALKNLGIheaRIHYE--VFGP---------    137

Query        119 gtlgakadlfwnmkkesle    137
d1cqxa3      138 --------------dlfae    142


hit structure      alignment
FAST alignment (Normalized score: 2.67 Raw score:372.00)
Query          1 NPNEAYRHYMKKLSYETDIADLSIDIKKGYE------GIIVVDVR---------------     39
d1cqxa3        1 -------------------------------DVDAKTPIVLIS--GGVGLTPMVSMLKVA     27

Query         40 ---------------------DAEAYKECHI-------PTAISIPGNKI-----------     60
d1cqxa3       28 LQAPPRQVVFVHGARNSAVHAMRDRLRE---AAKTYENLDLFV------FYDQPLPEDVQ     78

Query         61 -----------NEDTTKR-LSKEKVIITYCWGPACNGATKAAAKFAQLGF---RVKELIG    105
d1cqxa3       79 GRDYDYPGLVDVKQIEKSILLPDADYYI-CGP--IPFMRMQHDALKNLGIHEARIHYE--    133

Query        106 GIEYWRKENGEVEGTLGAKADLFWNMKKESLE---------    137
d1cqxa3      134 --------------------------------VFGPDLFAE    142


hit structure      alignment
TMalign alignment (TM-score: 0.42 Raw score:58.20)
Query          1 -----------------NPNEAYRHYMKKLSYETDIADLSIDIKK-GY---EGIIVVDVR     39
d1cqxa3        1 DVDAKTPIVLISGGVGL------------------TPMVS-MLKVALQAPPRQVVFVH-G     40

Query         40 DAEAYKECHI--P--T--------AISI------------------PGNKINEDTTKRL-     68
d1cqxa3       41 ARNSAVHAMRDRLREAAKTYENLDLFVFYDQPLPEDVQGRDYDYPGLV-DVK-QIEKSIL     98

Query         69 SKEKVIITYCWGPACNGATKAAAKFAQLGF---RVKELIGGIEYWRKENGEVEGTLGAKA    125
d1cqxa3       99 LPDADYYICG-P--IPFMRMQHDALKNLGIHEARIHYEVFGPDL----------------    139

Query        126 DLFWNMKKESLE    137
d1cqxa3      140 FAE---------    142


hit structure      alignment
HHsearch alignment (Probability: 0.04 E-value:0.15)
DALI match                                           .... *******........... 
Query         21 DLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDTTKRLSKEKVIITYCWG     80
d1cqxa3       51 DRLREAAKTYENLDLFVFYDQPLPEDVQGRDYDYPGLVDV-KQIEKSILLPDADYYICGP    109

DALI match       .  ***************.
Query         81 PACNGATKAAAKFAQLGFR     99
d1cqxa3      110 I--PFMRMQHDALKNLGIH    126



top
65: d1qb7a_ Adenine PRTase (svm: -1.150)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 527
Modified z-scores:
dali:0.81 daliz:0.86 gdtts:0.84 tmscore:0.84 rmsd:0.36 AHM:0.34 LBcontacta:0.81 LBcontactb:0.80 LHM:0.20
id:0.82 blosum:0.45 compass:0.68 pearson:0.81
Scaled scores:
dali:0.70 daliz:0.36 gdtts:0.53 tmscore:0.53 rmsd:0.71 AHM:0.66 LBcontacta:0.44 LBcontactb:0.62 LHM:0.38
id:0.06 blosum:0.07 compass:0.13 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 2.8 Raw score:306.60)
Query          1 ---------------------------------------npneayrhymkklsyetdIAD     21
d1qb7a_        1 pfkevspnsfllddshalsqllkksyrwyspvfsprnvprfadvssitespetlkaiRDF     60

Query         22 LSIDIKKGYEGI-IVVDVRDaeaykeCHIP--------tAISIP----------------     56
d1qb7a_       61 LVQRYRAMSPAPtHILGFDA---rgfLFGPmiaveleipFVLMRkadknagllirsepye    117

Query         57 ---------gNKINEdttKRLSKEKVIITYCWGPA-CNGATKAAAKFAQLGFRVKELiGG    106
d1qb7a_      118 keykeaapevMTIRY---GSIGKGSRVVLIDDVLAtGGTALSGLQLVEASDAVVVEM-VS    173

Query        107 IE-------------------------YWRK-------engevegtlgakadlfwnmkke    134
d1qb7a_      174 ILsipflkaaekihstansrykdikfiSLLSddalteencgdsknytgprvlscgdvlae    233

Query        135 sle    137
d1qb7a_      234 hph    236


hit structure      alignment
FAST alignment (Normalized score: 2.76 Raw score:495.50)
Query          1 NPNEAYRHYMKKLSYET-------------------------------------------     17
d1qb7a_        1 -----------------PFKEVSPNSFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFAD     43

Query         18 -------------DIADLSIDIKKGYEG--IIVVDVRDAEAYKECHI--------PTAIS     54
d1qb7a_       44 VSSITESPETLKAIRDFLVQRYR-AMSPAPTHILG--FDARGFL---FGPMIAVELEIPF     97

Query         55 IPG----------------------------NKINEDTTKRLSKEKVIITYCWG-PACNG     85
d1qb7a_       98 VL-MRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRYGS---IGKGSRVVLIDDVLATGGT    153

Query         86 ATKAAAKFAQLGFR-VKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESLE-------    137
d1qb7a_      154 ALSGLQLVEASDAVVVEMV----------------------------------SILSIPF    179

Query        138 ---------------------------------------------------------    138
d1qb7a_      180 LKAAEKIHSTANSRYKDIKFISLLSDDALTEENCGDSKNYTGPRVLSCGDVLAEHPH    236


hit structure      alignment
TMalign alignment (TM-score: 0.47 Raw score:64.77)
Query          1 ---NPNEAYRHY--MKKLSYETDIA-----------------------------------     20
d1qb7a_        1 PFK--------EVS--PN--SFLLDDSHALSQLLKKSYRWYSPVFSPRNVPRFADVSSIT     48

Query         21 -----------DL-SIDIKKGYEGI-IVVDVRDAEAYKECHI--PT-----AISIPGNK-     59
d1qb7a_       49 ESPETLKAIRDFLVQRY-RAMSPAPTHILGFDA-RGF--LFGPMIAVELEIPFVLMRKAD    104

Query         60 -----INE-----------------DTTKRLSKEKVIITYCWGPACN-GATKAAAKFAQL     96
d1qb7a_      105 KNAGLLIRSEPYEKEYKEAAPEVMTIRYGSIGKGSRVVLIDDVLATGGTALSGLQLVEAS    164

Query         97 GFRVKELIGGIE-------------------------YWRK-------------------    112
d1qb7a_      165 DAVVVEMV-SILSIPFLKAAEKIHSTANSRYKDIKFISL-LSDDALTEENCGDSKNYTGP    222

Query        113 ENGEVEGTLGAKADLFWNMK-------------KESLE    137
d1qb7a_      223 -------------------RVLSCGDVLAEHPH-----    236


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.26)
DALI match       *********************
Query         83 CNGATKAAAKFAQLGFRVKEL    103
d1qb7a_      151 GGTALSGLQLVEASDAVVVEM    171



hit structures. 
top
66: d1a1va1 HCV helicase domain (svm: -1.478)

SCOP Superfamily: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Fold: P-​loop containing nucleoside triphosphate hydrolases  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.32  Contact: 550
Modified z-scores:
dali:0.85 daliz:0.84 gdtts:0.84 tmscore:0.85 rmsd:0.36 AHM:0.37 LBcontacta:0.86 LBcontactb:0.87 LHM:0.16
id:0.92 blosum:0.63 compass:0.48 pearson:0.82
Scaled scores:
dali:0.65 daliz:0.31 gdtts:0.45 tmscore:0.46 rmsd:0.71 AHM:0.65 LBcontacta:0.40 LBcontactb:0.61 LHM:0.40
id:0.07 blosum:0.11 compass:0.10 pearson:0.13

hit structure      alignment
DALI alignment (Z-score: 2.5 Raw score:257.70)
Query          1 npneayrhymkklSYETD--------iADLSIDIKKGYeGIIVVDvRDAEAYKECH----     48
d1a1va1        1 ----ppavpqsfqVAHLHaptgsgkstKVPAAYAAQGY-KVLVLN-PSVAATLGFGayms     54

Query         49 ----ipTAIS--------------IPGNKINEDTT-KRLSkeKVIITYCwgpacngaTKA     89
d1a1va1       55 kahgvdPNIRtgvrtittgspitySTYGKFLADGGxSGGA-yDIIICDEchstdatsILG    113

Query         90 AAKFAQLG-----fRVKELIGgieywrkengevegtlgakadlfwnmkkesle    137
d1a1va1      114 IGTVLDQAetagarLVVLATA------------------------------tp    136


hit structure      alignment
FAST alignment (Normalized score: 3.17 Raw score:432.40)
Query          1 NPNEAYRHYMKKLSYET---------------------DIADLSIDIKKGYEGIIVVDV-     38
d1a1va1        1 -----------------PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQ---GYKVLVLN     40

Query         39 RDAEAYKECHI--------------------------PTAISIPGNKINE----DTTKRL     68
d1a1va1       41 PSVAATL----GFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGK---FLADGGXSGG     93

Query         69 SKE--KVIITYCWGPA------CNGATKAAAKFA----QLGF-RVKELIGGIEYWRKENG    115
d1a1va1       94 ---AYDIIIC------DECHSTDATSILGIGTVLDQAETAGARLVVLA------------    132

Query        116 EVEGTLGAKADLFWNMKKESLE----    137
d1a1va1      133 ----------------------TATP    136


hit structure      alignment
TMalign alignment (TM-score: 0.43 Raw score:59.59)
Query          1 --------NPNEAYRHYMKKLSYETDI---ADL--SIDIKK-GYEGIIVVDVRDAEAYKE     46
d1a1va1        1 PPAVPQSF------------QVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATL-     47

Query         47 CH--IP-------T--------------AISIPGNKIN-EDTT-KRLSKEKVIITYCWGP     81
d1a1va1       48 GFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGXSGGAY--DIIICDE-C-    103

Query         82 ACNG-ATK-AAAKFAQLGF-----RVKELIGG-IEYWRKENGEVEGTLGAKADLFWNMKK    133
d1a1va1      104 HSTDATSILGIGTVLDQAETAGARLVVLATATP---------------------------    136

Query        134 ESLE    137
d1a1va1      137 ----    137


hit structure      alignment
HHsearch alignment (Probability: 0.03 E-value:0.14)
DALI match                                           
Query         68 LSKEKVIITYCWGPACNGATKAAAKFAQLGFRVKEL    103
d1a1va1        4 VPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVL     39



top
67: d1tc1a_ Hypoxanthine PRTase (svm: 0.564)

SCOP Superfamily: PRTase-​like  |  SCOP Fold: PRTase-​like  |  SCOP Class: Alpha and beta proteins (a/​b)

Consensus: 0.44  Contact: 528
Modified z-scores:
dali:0.84 daliz:0.87 gdtts:0.87 tmscore:0.86 rmsd:0.32 AHM:0.31 LBcontacta:0.81 LBcontactb:0.83 LHM:0.17
id:0.54 blosum:0.23 compass:0.50 pearson:0.76
Scaled scores:
dali:0.73 daliz:0.40 gdtts:0.56 tmscore:0.56 rmsd:0.77 AHM:0.72 LBcontacta:0.43 LBcontactb:0.65 LHM:0.41
id:-0.00 blosum:0.04 compass:0.08 pearson:0.15

hit structure      alignment
DALI alignment (Z-score: 3.7 Raw score:308.40)
Query          1 npneayrhymkklsyetdiADLSIDIK--------kgyEGIIVVDVRDaeaykeCHIP--     50
d1tc1a_        1 yefaekilfteeeirtrikEVAKRIADdykgkglrpyvNPLVLISVLK---gsfMFTAdl     57

Query         51 -----------tAISIP-----gNKINedtTKRLSKEKVIITYCWGPA-CNGATKAAAKF     93
d1tc1a_       58 cralcdfnvpvrMEFICvssyvrMLLD---TRHSIEGHHVLIVEDIVDtALTLNYLYHMY    114

Query         94 AQLGF-RVKELigGIEY--------------WRKEngevegtlgakaDLFWNMKKE----    134
d1tc1a_      115 FTRRPaSLKTV--VLLDkregrrvpfsadyvVANI------pnafviGYGLDYDDTyrel    166

Query        135 ------sle    137
d1tc1a_      167 rdivvlrpe    175


hit structure      alignment
FAST alignment (Normalized score: 2.70 Raw score:418.60)
Query          1 NPNEAYRHYMKKLSYETDIAD--------------------LSIDIKKGYE---------     31
d1tc1a_        1 ---------------------YEFAEKILFTEEEIRTRIKEVAKRIAD---DYKGKGLRP     36

Query         32 ---GIIVVDVR---DAEAYKECHI------------PTAISIPGNKINEDTTKRL-----     68
d1tc1a_       37 YVNPLVLISV-LKGSFMFTA----DLCRALCDFNVPVRMEFIC------------VSSYV     79

Query         69 ---------SKEKVIITYCW-GPACNGATKAAAKFAQLGF-RVKELIGGIEYWRKENGEV    117
d1tc1a_       80 RMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTV--------------    125

Query        118 EGTLGAKADLFWNMKKESLE----------------------------------------    137
d1tc1a_      126 --------------------VLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRE    165

Query        138 ----------    138
d1tc1a_      166 LRDIVVLRPE    175


hit structure      alignment
TMalign alignment (TM-score: 0.48 Raw score:65.10)
Query          1 -------------------NPNEAYRHYMKKLSYETDI-ADLSID--IKK--GYE---G-     32
d1tc1a_        1 YEFAEKILFTEEEIRTRIK-----------------EVAKRI-ADDY--KGKGLRPYVNP     40

Query         33 IIVVDVRDAEAYKEC-HI--P---------T-AISIPG----NKINEDTTKRLSKEKVII     75
d1tc1a_       41 LVLISVLK-GSF--MFTADLCRALCDFNVPVRMEFICVSSYVRMLL--DTRHSIEGHHVL     95

Query         76 TYCWGPACN-GATKAAAKFAQLGF-RVKELIGG-------------IEYW-------RKE    113
d1tc1a_       96 IVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFV---    152

Query        114 NGEVEGTLGAKADLFWNMKKE-------------SLE    137
d1tc1a_      153 -----------IGYGLDYDDTYRELRDIVVLRPE---    175


hit structure      alignment
HHsearch alignment (Probability: 0.01 E-value:0.95)
DALI match                                      
Query         71 EKVIITYCWGPACNGATKAAAKFAQLGFRVK    101
d1tc1a_       39 NPLVLISVLKGSFMFTADLCRALCDFNVPVR     69