HorA Server Transitive Detail

Reference:
H. Cheng, BH. Kim, and N. Grishin (2008). Discrimination between distant homologs and structural analogs: lessons from manually constructed, reliable datasets. J. Mol. Biol. 377(4): 1265-1278
BH. Kim, H. Cheng, and N. Grishin (2009). HorA web server to infer homology between proteins using sequence and structural similarity. Nucleic Acids Res. 37(Web Server issue):W532-8
Comments and suggestions to: grishin@chop.swmed.edu


Query: 542d3.pdb
Database: SCOP1.69 less than 40% identity downloaded from ASTRAL


Query <-- 1.647 --> Intermediate <-- 1.664 --> Hit

SVM
score
SVM
score

The query (542d3.pdb) is transitively linked to the hit (d1u78a2) through the intermediate protein (d1gdta1) by significant SVM score (>0.4).

  SCOP Id Protein SCOP Superfamily SCOP Fold SCOP
Class
Intermediate d1gdta1 gamma,​delta resolvase (C-​terminal domain)Homeodomain-​likeDNA/​RNA-​binding 3-​helical bundleAll α
Hit d1u78a2 Transposase tc3a1-​65Homeodomain-​likeDNA/​RNA-​binding 3-​helical bundleAll α

Supporting Alignments

Query <-- 1.647 --> Intermediate
FAST alignment (Normalized score: 4.60 Raw score:264.60) query 1 PDYP------VLDAILELYVDRDTGADAIVA-AGYDRELVVKTLRMVDTAEYKRRQYPPG 53 ::::::::: ::::::::::: :::::::::::::: d1gdta1 1 ----GRKRKIDRDAVLNMW-QQGLGASHISKTMNIARSTVYKVINE-------------- 41 query 54 TKISAKGFGKDRRLPITNRWREGH-- 77 d1gdta1 42 ------------------------SN 43 TMalign alignment (TM-score: 0.39 Raw score:30.18) query 1 --PDYPVLDAILELYVDRDTGADAIVAAGYDR-ELVVKTLRMVDTAEYKRRQYPPGTKIS 57 ::::::::::::: :::::::::::::::: ::::::: :: :: d1gdta1 1 GRKRKIDRDAVLNMW-QQGLGASHISKTMNIARSTVYKVI-NE-SN-------------- 43 query 58 AKGFGKDRRLPITNRWREGH 77 d1gdta1 44 -------------------- 44 HHsearch alignment (Probability: 0.15 E-value:0.00) query 7 DAILELYVDRDTGADAIVAA-GYDRELVVKTLR 38 ::::::: :::::::::::: :::::::::::: d1gdta1 9 DAVLNMW-QQGLGASHISKTMNIARSTVYKVIN 40
Intermediate <-- 1.664 --> Hit
DALI alignment (Z-score: 5.9 Raw score:162.00) d1gdta1 1 -GRKRKI---DRDAVLNMWQQG-LGASHISKTMNI--ARSTVYKVINESN 43 :::::: :::::::::::: :::::::::::: ::::::::::::: d1u78a2 1 aPRRKALsvrDERNVIRAASNScKTARDIRNELQLsaSKRTILNVIKRSG 50 FAST alignment (Normalized score: 7.24 Raw score:335.90) d1gdta1 1 -GRKRKI---DRDAVLNMWQ-QGLGASHISKTM--NIARSTVYKVINESN--- 43 :::::: :::::::::: :::::::::::: :::::::::::: d1u78a2 1 APRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIK---RSG 50 TMalign alignment (TM-score: 0.70 Raw score:30.09) d1gdta1 1 -GRKRKI---DRDAVLNMWQQG-LGASHISKTM-N-IARSTVYKVINESN 43 :::::: :::::::::::: :::::::::: : :::::::::::::: d1u78a2 1 APRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIKRSG 50 HHsearch alignment (Probability: 0.01 E-value:0.11) d1gdta1 8 RDAVLNMWQQGLGASHISKTMNI--ARSTVYKVINE 41 ::::::::::::::::::::::: ::::::::::: d1u78a2 13 RNVIRAASNSCKTARDIRNELQLSASKRTILNVIKR 48