NESdb

Summary for Id1 (NES ID: 105)

Full Name

DNA-binding protein inhibitor ID-1 UniProt

Alternative Names

Inhibitor of DNA binding 1

Organism

Mus musculus (Mouse)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.2Protein kinase A-regulated nucleocytoplasmic shuttling of Id1 during angiogenesis., Nishiyama et al., J Biol Chem, 2007}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

I95Q, L98Q, L100Q, L100R, L100R/E101S/L102S ^{Ref.1Identification of the nuclear export signal in the helix-loop-helix inhibitor Id1., Makita et al., FEBS Lett, 2006} ^{Ref.2Protein kinase A-regulated nucleocytoplasmic shuttling of Id1 during angiogenesis., Nishiyama et al., J Biol Chem, 2007}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

⁹¹VIDYIRDLQLELNS¹⁰⁴ ^{Ref.1Identification of the nuclear export signal in the helix-loop-helix inhibitor Id1., Makita et al., FEBS Lett, 2006}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|2827752|sp|P20067.3|ID1_MOUSE RecName: Full=DNA-binding protein inhibitor ID-1; AltName: Full=Inhibitor of DNA binding 1
MKVASGSAAAAAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLK
ELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRAPLSTLNGEISALAAEVRSES
EYYIILQWETEATGGGCPPSLLFRRIAI

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 976788877668998765788883210004653201221024788710123788889887
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCHHHHHCCCCCCCCCHHHHHHHHHHHH
  AA: MKVASGSAAAAAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY
              10        20        30        40        50        60


Conf: 666799998722799999987519999999999999999861204566889999999988
Pred: HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
  AA: DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRA
              70        80        90       100       110       120


Conf: 876678863101120026410011254212489999982667656129
Pred: CCCCCCCCCCHHHHHCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHCC
  AA: PLSTLNGEISALAAEVRSESEYYIILQWETEATGGGCPPSLLFRRIAI
             130       140       150       160

Show Conservation Score by AL2CO

1     M      -1.000    *
2     K      -1.000    *
3     V      -1.000    *
4     A      -1.000    *
5     S      -1.000    *
6     G      -1.000    *
7     S      -1.000    *
8     A      -1.000    *
9     A      -1.000    *
10    A      -1.000    *
11    A      -1.000    *
12    A      -1.000    *
13    G      -1.000    *
14    P      -1.000    *
15    S      -1.000    *
16    C      -1.000    *
17    S      -0.407
18    L      -0.058
19    K      -0.162
20    A      -0.363
21    G      -0.556
22    R      -0.778
23    T      -0.548
24    A      -0.524
25    G      -0.481
26    E      -0.863
27    V      -0.233
28    V      -0.641
29    L      -0.410
30    G      -0.215
31    L      -0.239
32    S      -0.215
33    E      -0.339
34    Q      -0.370
35    S      -0.233
36    V      -0.332
37    A      -0.151
38    I      -0.323
39    S      -0.305
40    R      -0.301
41    C      -0.671
42    A      -0.382
43    G      -0.995
44    T      -1.035
45    R      -0.970
46    L      -0.997
47    P      -0.673
48    A      -0.629
49    L      -0.687
50    L      -1.000    *
51    D      -1.000    *
52    E      -0.552
53    Q      -0.374
54    Q      -0.905
55    V      -0.679
56    N      -0.992
57    V      -0.563
58    L      -0.047
59    L       0.156
60    Y      -0.062
61    D       0.177
62    M       1.796
63    N       0.372
64    G      -0.063
65    C       1.284
66    Y       0.712
67    S       0.432
68    R       0.788
69    L       2.447
70    K       0.462
71    E      -0.219
72    L       1.805
73    V       1.799
74    P       2.447
75    T       0.117
76    L       0.612
77    P       1.200
78    Q      -0.238
79    N       0.620
80    R      -0.013
81    K       0.167
82    V       0.130
83    S       1.206
84    K       1.014
85    V       0.183
86    E       0.917
87    I       0.724
88    L       1.567
89    Q       1.812
90    H       0.769
91    V       2.447
92    I       2.447
93    D       2.447
94    Y       2.447
95    I       2.447
96    R      -0.014
97    D       1.782
98    L       2.447
99    Q       1.552
100   L      -0.237
101   E       0.660
102   L       2.447
103   N       0.201
104   S      -0.969
105   E      -0.629
106   S      -0.867
107   E      -1.078
108   V      -1.204
109   G      -1.082
110   T      -0.944
111   T      -1.142
112   G      -1.131
113   G      -0.842
114   R      -0.942
115   G      -0.983
116   L      -1.135
117   P      -0.624
118   V      -0.793
119   R      -0.506
120   A      -0.419
121   P      -0.611
122   L      -0.487
123   S      -0.711
124   T      -0.611
125   L       0.006
126   N      -0.038
127   G      -0.668
128   E      -0.522
129   I      -0.537
130   S      -0.370
131   A      -0.650
132   L      -0.137
133   A      -0.202
134   A      -0.998
135   E      -0.227
136   V      -0.935
137   R      -0.466
138   S      -0.987
139   E      -0.881
140   S      -0.664
141   E      -1.000    *
142   Y      -1.000    *
143   Y      -1.000    *
144   I      -1.000    *
145   I      -1.000    *
146   L      -1.000    *
147   Q      -1.000    *
148   W      -1.000    *
149   E      -1.000    *
150   T      -1.000    *
151   E      -1.000    *
152   A      -1.000    *
153   T      -1.000    *
154   G      -1.000    *
155   G      -1.000    *
156   G      -1.000    *
157   C      -1.000    *
158   P      -1.000    *
159   P      -1.000    *
160   S      -1.000    *
161   L      -1.000    *
162   L      -1.000    *
163   F      -1.000    *
164   R      -1.000    *
165   R      -1.000    *
166   I      -1.000    *
167   A      -1.000    *
168   I      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 105.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MKVASGSAAA AAGPSCSLKA GRTAGEVVLG LSEQSVAISR CAGTRLPALL DEQQVNVLLY 
        70         80         90        100        110        120 
DMNGCYSRLK ELVPTLPQNR KVSKVEILQH VIDYIRDLQL ELNSESEVGT TGGRGLPVRA 
       130        140        150        160                       PLSTLNGEIS ALAAEVRSES EYYIILQWET EATGGGCPPS LLFRRIAI

3D Structures in PDB

Not Available

Comments

Id1 is one of Id family proteins of helix-loop-helix (HLH) transcriptional factors, that negatively regulate basic HLH transcriptional factor by inhibiting DNA binding. Id proteins are essential for angiogenesis, tumorigenesis, nerogenesis, and immune cell development. The cellular functions of Id proteins are regulated at the level of transcription, protein stability, and cellular localization. Protein Kinase A stimulation causes Id1 to accumulate in the nucleus, probably due to phosphorylation of S5. Note that aa 124-133 looks like NES and aligns with the experimentally identified NES in Id2. However, it is not functional as demonstrated in the Kurooka and Yoka 2005 JBC paper (PMID: 15563451).

References

[1]. "Identification of the nuclear export signal in the helix-loop-helix inhibitor Id1."
Makita J, Kurooka H, Mori K, Akagi Y, Yokota Y (2006) FEBS Lett, 580:1812-6 PubMed
[2]. "Protein kinase A-regulated nucleocytoplasmic shuttling of Id1 during angiogenesis."
Nishiyama K, Takaji K, Uchijima Y, Kurihara Y, Asano T, Yoshimura M, Ogawa H, Kurihara H (2007) J Biol Chem, 282:17200-9 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©