NESdb

DNA-binding protein inhibitor ID-2 UniProt

Inhibitor of DNA binding 2

Mus musculus (Mouse)

LMB Sensitive ^{Ref.1Nucleo-cytoplasmic shuttling of Id2, a negative regulator of basic helix-loop-helix transcription factors., Kurook et al., J Biol Chem, 2005}

*highlighted yellow in the full sequence

I110A, L115A ^{Ref.1Nucleo-cytoplasmic shuttling of Id2, a negative regulator of basic helix-loop-helix transcription factors., Kurook et al., J Biol Chem, 2005}

Unknown

*shown as underlined residues in the full sequence

¹⁰³LTTLNTDISILSLQASE¹¹⁹ ^{Ref.1Nucleo-cytoplasmic shuttling of Id2, a negative regulator of basic helix-loop-helix transcription factors., Kurook et al., J Biol Chem, 2005}

Unknown

Show FASTA Format

>gi|8039784|sp|P41136.3|ID2_MOUSE RecName: Full=DNA-binding protein inhibitor ID-2; AltName: Full=Inhibitor of DNA binding 2
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVID
YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 940145458999876447666578999999701242114678998763268999998611
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCH
  AA: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVT
              10        20        30        40        50        60


Conf: 999999999999999998640885224578899999999998754563100000024678
Pred: HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCC
  AA: KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
              70        80        90       100       110       120


Conf: 87788975436779
Pred: CCCCCCCCCCCCCC
  AA: PSELMSNDSKVLCG
             130

Show Conservation Score by AL2CO

1     M       1.535
2     K       2.687
3     A       1.257
4     F       0.098
5     S       0.144
6     P       0.111
7     V      -0.012
8     R       0.459
9     S      -0.128
10    V      -0.913
11    R      -0.404
12    K      -0.913
13    N      -0.800
14    S      -0.651
15    L      -0.576
16    S       0.080
17    D      -0.817
18    H      -0.771
19    S      -0.344
20    L      -0.604
21    G      -0.214
22    I      -0.498
23    S      -0.625
24    R      -0.504
25    S      -1.111
26    K      -0.441
27    T      -1.234
28    P      -1.147
29    V      -0.870
30    D      -0.712
31    D      -0.591
32    P      -0.768
33    M      -1.005
34    S      -0.944
35    L      -0.750
36    L      -0.108
37    Y      -0.662
38    N       0.327
39    M       1.014
40    N       0.571
41    D      -0.594
42    C       0.922
43    Y       0.636
44    S      -0.024
45    K       1.053
46    L       2.142
47    K       0.689
48    E      -0.239
49    L       0.854
50    V       1.298
51    P       2.115
52    S      -0.274
53    I       0.537
54    P       1.220
55    Q       0.059
56    N      -0.228
57    K       0.019
58    K       0.027
59    V       0.043
60    T       1.455
61    K       1.193
62    M       0.376
63    E       0.996
64    I       0.648
65    L       1.784
66    Q       1.156
67    H       0.521
68    V       1.823
69    I       2.000
70    D       1.400
71    Y       2.687
72    I       2.687
73    L      -0.093
74    D       0.691
75    L       2.687
76    Q       1.280
77    I      -0.830
78    A       0.114
79    L       2.687
80    D       0.123
81    S      -0.940
82    H      -0.620
83    P      -0.837
84    T      -0.842
85    I      -0.969
86    V      -1.083
87    S      -1.085
88    L      -0.999
89    H      -1.021
90    H      -1.095
91    Q      -1.149
92    R      -0.913
93    P      -0.589
94    G      -0.901
95    Q      -1.088
96    N      -1.084
97    Q      -0.971
98    A      -0.893
99    S      -0.697
100   R      -0.115
101   T      -0.798
102   P       0.222
103   L      -0.096
104   T      -0.525
105   T      -0.618
106   L      -0.091
107   N      -0.277
108   T      -0.529
109   D      -0.222
110   I      -0.728
111   S      -0.536
112   I      -0.806
113   L      -0.164
114   S      -0.426
115   L      -0.728
116   Q      -0.044
117   A      -0.421
118   S      -0.134
119   E      -1.000    *
120   F      -1.000    *
121   P      -1.000    *
122   S      -1.000    *
123   E      -1.000    *
124   L      -1.000    *
125   M      -1.000    *
126   S      -1.000    *
127   N      -1.000    *
128   D      -1.000    *
129   S      -1.000    *
130   K      -1.000    *
131   V      -1.000    *
132   L      -1.000    *
133   C      -1.000    *
134   G      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 106.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MKAFSPVRSV RKNSLSDHSL GISRSKTPVD DPMSLLYNMN DCYSKLKELV PSIPQNKKVT 
        70         80         90        100        110        120 
KMEILQHVID YILDLQIALD SHPTIVSLHH QRPGQNQASR TPLTTLNTDI SILSLQASEF 
       130                                                        PSELMSNDSK VLCG

Not Available

Like Id1, Id2 is a member of the Id protein family. When the export of Id2 is decreased, the repression activity of E-box-mediated transcription by Id2 is increased. Note that amino acids 65-75 conforms to NES consensus and aligns with the experimentally identified NES in Id1. But neither I69A nor L75A mutation affects nuclear export.

[1]. "Nucleo-cytoplasmic shuttling of Id2, a negative regulator of basic helix-loop-helix transcription factors."
Kurooka H, Yokota Y (2005) J Biol Chem, 280:4313-20 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©