NESdb

Summary for HPV16 E7 (NES ID: 114)

Full Name

Protein E7 UniProt

Alternative Names

None

Organism

Human papillomavirus type 16

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Identification of the nuclear localization and export signals of high risk HPV16 E7 oncoprotein., Knapp et al., Virology, 2009}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

I76A, L79A, ⁸²LLM⁸⁴ mutated to A ^{Ref.1Identification of the nuclear localization and export signals of high risk HPV16 E7 oncoprotein., Knapp et al., Virology, 2009}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|137791|sp|P03129.1|VE7_HPV16 RecName: Full=Protein E7
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQ
STHVDIRTLEDLLMGTLGIVCPICSQKP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988999946525134773346420476799998654568989878889865399944898
Pred: CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC
  AA: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK
              10        20        30        40        50        60


Conf: 89951699995430199999982156633576777899
Pred: CCCCEEEEEEECCCCHHHHHHHHCCCCCEECCCCCCCC
  AA: CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
              70        80        90

Show Conservation Score by AL2CO

1     M       2.949
2     H       0.101
3     G       2.599
4     D      -0.573
5     T      -0.949
6     P       0.315
7     T      -0.054
8     L       0.431
9     H      -0.557
10    E       0.782
11    Y       0.869
12    M      -0.302
13    L       0.977
14    D      -0.594
15    L       0.079
16    Q      -0.874
17    P       0.004
18    E      -0.276
19    T      -0.173
20    T      -0.515
21    D       0.016
22    L       1.505
23    Y      -0.743
24    C       0.464
25    Y      -0.133
26    E       1.562
27    Q      -0.410
28    L      -0.032
29    N      -0.649
30    D      -0.421
31    S      -0.198
32    S      -0.432
33    E      -0.383
34    E      -0.121
35    E      -0.598
36    D      -0.058
37    E      -0.909
38    I      -0.830
39    D      -0.594
40    G      -0.932
41    P      -0.786
42    A      -0.747
43    G      -0.740
44    Q      -0.321
45    A      -0.595
46    E      -0.733
47    P      -0.562
48    D      -0.659
49    R      -0.824
50    A      -0.978
51    H      -0.824
52    Y       1.352
53    N      -0.509
54    I       1.581
55    V      -0.676
56    T       0.270
57    F      -1.221
58    C       2.623
59    C      -0.894
60    K      -1.200
61    C       2.949
62    D      -0.681
63    S      -0.762
64    T      -0.796
65    L       1.383
66    R       0.115
67    L       0.730
68    C      -0.367
69    V       0.710
70    Q      -0.930
71    S       0.617
72    T      -0.391
73    H      -1.000
74    V      -0.870
75    D      -0.202
76    I       0.831
77    R      -0.637
78    T      -0.927
79    L       0.755
80    E       0.354
81    D      -0.675
82    L       0.593
83    L       1.555
84    M      -0.299
85    G      -0.508
86    T      -0.454
87    L       0.688
88    G      -0.935
89    I       1.016
90    V       0.374
91    C       2.595
92    P      -0.336
93    I      -1.046
94    C       2.949
95    S       0.209
96    Q      -0.506
97    K      -1.000    *
98    P      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 114.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MHGDTPTLHE YMLDLQPETT DLYCYEQLND SSEEEDEIDG PAGQAEPDRA HYNIVTFCCK 
        70         80         90                                  
CDSTLRLCVQ STHVDIRTLE DLLMGTLGIV CPICSQKP

3D Structures in PDB

2EWL (NMR)
2F8B (NMR)

Comments

High risk HPV16 E7 is a phosphoprotein structurally and functionally related to Adenovirus E1A protein. E7 bind and inactivate several nuclear protein. E7 consists of three domains: CR1 (aa 1-15), CR2 (aa 16-37) and CR3 (aa 38-98). Two NLSs were identified: one is located at the N-terminus (aa 1-37), and the other at the C-terminus (aa 38-98). Both NLSs don't use kapβ as the import receptor. The NES is mapped to aa76-84, and is sensitive to LMB and RJA.

References

[1]. "Identification of the nuclear localization and export signals of high risk HPV16 E7 oncoprotein."
Knapp AA, McManus PM, Bockstall K, Moroianu J (2009) Virology, 383:60-8 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©