NESdb

Summary for N protein (NES ID: 118)

Full Name

N nucleocapsid protein UniProt

Alternative Names

Nucleocapsid protein N

Organism

Porcine reproductive and respiratory syndrome virus (PRRSV)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1 ^{Ref.1Nucleolar-cytoplasmic shuttling of PRRSV nucleocapsid protein: a simple case of molecular mimicry or the complex regulation by nuclear import, nucleolar localization and nuclear export signal sequences., Rowland et al., Virus Res, 2003}

Mutations That Affect Nuclear Export

Unknown

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

⁹⁰CTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA¹²³ ^{Ref.1Nucleolar-cytoplasmic shuttling of PRRSV nucleocapsid protein: a simple case of molecular mimicry or the complex regulation by nuclear import, nucleolar localization and nuclear export signal sequences., Rowland et al., Virus Res, 2003}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|82059056|sp|Q88935|Q88935_PRRSV N nucleocapsid protein (Nucleocapsid protein) (N protein) (ORF7) (Nucleocapsid protein N) (ORF7; putative nucleocapsid protein)
MPNNNGKQQKRKKGDGQPVNQLCQMLGKIIAQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPS
ERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999820111025899973479999999999984324899999665555999999888876
Pred: CCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MPNNNGKQQKRKKGDGQPVNQLCQMLGKIIAQQNQSRGKGPGKKNKKKNPEKPHFPLATE
              10        20        30        40        50        60


Conf: 643344693457788998998854287515732698534899980104524888884328
Pred: CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCEEEEEEEEECCCCEEEEEEEECC
  AA: DDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTAS
              70        80        90       100       110       120


Conf: 999
Pred: CCC
  AA: PSA

Show Conservation Score by AL2CO

1     M       1.382
2     P      -0.358
3     N       0.285
4     N      -1.499
5     N      -0.735
6     G      -1.502
7     K      -0.860
8     Q      -0.204
9     Q      -1.744
10    K      -0.777
11    R      -2.119
12    K      -1.427
13    K      -1.194
14    G       0.436
15    D      -1.494
16    G      -0.343
17    Q      -0.230
18    P      -0.779
19    V      -0.753
20    N       0.438
21    Q       1.382
22    L       1.382
23    C       0.386
24    Q       0.386
25    M      -0.820
26    L       1.382
27    G       0.386
28    K      -1.490
29    I      -0.825
30    I      -0.304
31    A      -1.201
32    Q      -0.849
33    Q       0.386
34    N      -1.207
35    Q       0.264
36    S      -1.523
37    R      -1.498
38    G      -0.816
39    K      -1.465
40    G      -1.203
41    P      -1.763
42    G      -0.213
43    K      -1.216
44    K      -1.509
45    N      -1.979
46    K      -0.738
47    K       0.316
48    K       0.277
49    N      -0.323
50    P       0.348
51    E      -0.348
52    K       0.438
53    P       0.348
54    H       1.382
55    F       1.382
56    P       1.382
57    L       0.348
58    A       1.382
59    T      -0.833
60    E       0.348
61    D       0.348
62    D       1.382
63    V      -0.328
64    R       1.382
65    H       1.382
66    H       0.348
67    F      -0.380
68    T       1.382
69    P      -1.495
70    S      -1.205
71    E       0.420
72    R      -0.308
73    Q       0.249
74    L       0.348
75    C       0.420
76    L       0.264
77    S      -0.357
78    S       0.420
79    I       0.348
80    Q      -0.767
81    T       0.420
82    A       0.348
83    F       0.420
84    N       1.382
85    Q       1.382
86    G       1.382
87    A       0.348
88    G       1.382
89    T      -1.477
90    C       0.249
91    T      -0.357
92    L       1.382
93    S      -0.311
94    D      -1.202
95    S       1.382
96    G       1.382
97    R      -0.370
98    I      -0.321
99    S      -0.341
100   Y       0.253
101   T      -0.358
102   V       1.382
103   E       0.348
104   F       1.382
105   S       0.364
106   L       1.382
107   P       1.382
108   T       0.251
109   H      -1.493
110   H      -0.307
111   T       1.382
112   V       1.382
113   R       1.382
114   L       1.382
115   I       1.382
116   R       0.337
117   V       0.337
118   T       0.260
119   A       0.251
120   S      -1.214
121   P       0.265
122   S      -1.218
123   A       0.251
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 118.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MPNNNGKQQK RKKGDGQPVN QLCQMLGKII AQQNQSRGKG PGKKNKKKNP EKPHFPLATE 
        70         80         90        100        110        120 
DDVRHHFTPS ERQLCLSSIQ TAFNQGAGTC TLSDSGRISY TVEFSLPTHH TVRLIRVTAS 
                                                                  
PSA

3D Structures in PDB

1P65 (X-Ray,2.60 Å resolution)

Comments

N protein is the most abundant viral protein in virus-infected cells and may participate in the modulation of nuclear processes during viral replication. N protein is distributed in both the cytoplasm and the nucleus. It has a NLS located at aa 39-48, and a putative NoLS at aa 41-72. Peptide at aa 90-123 can export EGFP when the N protein fragment is fused to the C-terminal end.

References

[1]. "Nucleolar-cytoplasmic shuttling of PRRSV nucleocapsid protein: a simple case of molecular mimicry or the complex regulation by nuclear import, nucleolar localization and nuclear export signal sequences."
Rowland RR, Yoo D (2003) Virus Res, 95:23-33 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©