NESdb

Summary for survivin (NES ID: 123)

Full Name

Apoptosis inhibitor survivin UniProt

Alternative Names

Baculoviral IAP repeat-containing protein 5 (BIRC5), Apoptosis inhibitor 4 (API4, IAP4)

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1, Inhibit or inhibited by other CRM1 cargos ^{Ref.1The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function., Knauer et al., EMBO Rep, 2006} ^{Ref.2Nuclear export is essential for the tumor-promoting activity of survivin., Knauer et al., FASEB J, 2007} ^{Ref.3CRM1-mediated nuclear export determines the cytoplasmic localization of the antiapoptotic protein Survivin., Rodriguez et al., Exp Cell Res, 2002} ^{Ref.4Separating the anti-apoptotic and mitotic roles of survivin., Colnaghi et al., J Biol Chem, 2006} ^{Ref.5Homodimerization antagonizes nuclear export of survivin., Engelsma et al., Traffic, 2007}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L96A/L98A, F93P/L96A/L98A, ⁸⁹VKKQFEELTL⁹⁸ by Deletion, L98E/F101A/L102A ^{Ref.1The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function., Knauer et al., EMBO Rep, 2006} ^{Ref.2Nuclear export is essential for the tumor-promoting activity of survivin., Knauer et al., FASEB J, 2007} ^{Ref.4Separating the anti-apoptotic and mitotic roles of survivin., Colnaghi et al., J Biol Chem, 2006} ^{Ref.5Homodimerization antagonizes nuclear export of survivin., Engelsma et al., Traffic, 2007}

Mutations That Affect CRM1 Binding

*shown as red residues in the full sequence

L96A/L98A, L98E/F101A/L102A ^{Ref.2Nuclear export is essential for the tumor-promoting activity of survivin., Knauer et al., FASEB J, 2007} ^{Ref.1The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function., Knauer et al., EMBO Rep, 2006} ^{Ref.4Separating the anti-apoptotic and mitotic roles of survivin., Colnaghi et al., J Biol Chem, 2006}

Functional Export Signals

*shown as underlined residues in the full sequence

⁸⁹VKKQFEELTLGEFLKL¹⁰⁴ ^{Ref.1The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function., Knauer et al., EMBO Rep, 2006} ^{Ref.2Nuclear export is essential for the tumor-promoting activity of survivin., Knauer et al., FASEB J, 2007} ^{Ref.4Separating the anti-apoptotic and mitotic roles of survivin., Colnaghi et al., J Biol Chem, 2006} ^{Ref.5Homodimerization antagonizes nuclear export of survivin., Engelsma et al., Traffic, 2007}

Secondary Structure of Export Signal

α-helix (residues 100-140)

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|160359002|sp|O15392.2|BIRC5_HUMAN RecName: Full=Baculoviral IAP repeat-containing protein 5; AltName: Full=Apoptosis inhibitor 4; AltName: Full=Apoptosis inhibitor survivin
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAA
MD

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999999999985519989730079999999878947886637520799999981665111
Pred: CCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHCCCEECCCCCCCCCEEEECC
  AA: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
              10        20        30        40        50        60


Conf: 588888799999167774049999522401664211157864433999999999764445
Pred: CCCCCCCCCCCCCHHHHHHCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
  AA: FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
              70        80        90       100       110       120


Conf: 6879999999999999884279
Pred: HHHHHHHHHHHHHHHHHHHCCC
  AA: KKEFEETAEKVRRAIEQLAAMD
             130       140

Show Conservation Score by AL2CO

1     M      -1.000    *
2     G      -1.000    *
3     A      -1.000    *
4     P      -1.000    *
5     T      -1.000    *
6     L      -1.000    *
7     P      -1.000    *
8     P      -1.000    *
9     A      -1.000    *
10    W      -1.000    *
11    Q      -0.527
12    P      -0.440
13    F      -0.835
14    L      -0.558
15    K      -0.369
16    D      -0.337
17    H      -0.711
18    R       2.679
19    I       0.033
20    S      -0.570
21    T       1.763
22    F       2.063
23    K      -0.698
24    N      -0.514
25    W       1.858
26    P       0.691
27    F      -0.355
28    L      -0.709
29    E      -0.458
30    G      -0.730
31    C      -0.811
32    A      -0.757
33    C      -0.006
34    T      -0.610
35    P       0.274
36    E      -0.604
37    R      -0.625
38    M       1.276
39    A       1.519
40    E      -0.266
41    A       1.026
42    G       2.383
43    F       1.741
44    I       0.247
45    H       0.048
46    C      -0.559
47    P       0.506
48    T      -0.630
49    E      -0.581
50    N      -0.393
51    E      -0.580
52    P      -0.113
53    D       1.621
54    L      -0.805
55    A       1.044
56    Q      -0.170
57    C       2.824
58    F       0.450
59    F      -0.397
60    C       3.125
61    F      -0.525
62    K      -0.064
63    E      -0.740
64    L       1.171
65    E      -0.704
66    G      -0.199
67    W       0.534
68    E      -0.164
69    P      -0.562
70    D      -0.327
71    D       0.394
72    D      -0.354
73    P       1.908
74    I      -0.593
75    E      -0.570
76    E       0.165
77    H       3.125
78    K      -0.486
79    K      -0.035
80    H      -0.119
81    S      -0.288
82    S       0.386
83    G      -0.591
84    C       2.584
85    A      -0.609
86    F       1.493
87    L       0.541
88    S      -0.364
89    V      -0.795
90    K      -0.730
91    K      -0.433
92    Q      -0.612
93    F      -0.909
94    E      -0.666
95    E      -0.377
96    L      -0.611
97    T      -0.450
98    L      -0.584
99    G      -0.564
100   E      -0.339
101   F      -0.664
102   L      -0.670
103   K      -0.690
104   L      -0.637
105   D      -0.800
106   R      -0.721
107   E      -0.657
108   R      -0.452
109   A      -0.793
110   K      -0.700
111   N      -0.675
112   K      -0.734
113   I      -0.616
114   A      -0.581
115   K      -1.000    *
116   E      -1.000    *
117   T      -1.000    *
118   N      -1.000    *
119   N      -1.000    *
120   K      -1.000    *
121   K      -1.000    *
122   K      -1.000    *
123   E      -1.000    *
124   F      -1.000    *
125   E      -1.000    *
126   E      -1.000    *
127   T      -1.000    *
128   A      -1.000    *
129   E      -1.000    *
130   K      -1.000    *
131   V      -1.000    *
132   R      -1.000    *
133   R      -1.000    *
134   A      -1.000    *
135   I      -1.000    *
136   E      -1.000    *
137   Q      -1.000    *
138   L      -1.000    *
139   A      -1.000    *
140   A      -1.000    *
141   M      -1.000    *
142   D      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 123.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MGAPTLPPAW QPFLKDHRIS TFKNWPFLEG CACTPERMAE AGFIHCPTEN EPDLAQCFFC 
        70         80         90        100        110        120 
FKELEGWEPD DDPIEEHKKH SSGCAFLSVK KQFEELTLGE FLKLDRERAK NKIAKETNNK 
       130        140                                             KKEFEETAEK VRRAIEQLAA MD

3D Structures in PDB

1XOX (NMR)
2QFA (X-Ray,1.4 Å resolution)
2RAW (X-Ray,2.40 Å resolution)

Comments

The multiple functions of Survivin include inhibiting apopotosis and regulating cell division. Survivin is almost not detectable in adult human cells but overexpressed in most cancers. Survivin is a homodimer in solution and has an N-terminal BIR domain and a C-terminal coiled-coil domain (single long alpha-helix). In tumor cells, Survivin is found in both the nucleus and the cytoplasm. Overlapping NESs in Survivin were identitied by several labs: 1) Knauer et al identified residues 89-98 as NES. deletion of 89-98 and mutations L96A/L98A mislocalized Survivin and abolished CRM1 binding. 2) Colnaghi et al suggested 96-104 as NES. L98A mutant survivin is no longer cytoplasmic but still binds CRM1. 3) Engelsma et al reoports that 89-98 is a weak NES and the complete signal resides within 84-109 but only in monomeric Survivin. Mutations F101A/L102A disrupted the dimer and increased CRM1 affinity significantly while additional L98A completely abolished CRM1 binding. Hydrophobic residues within 89-98 (that match NES consensus) are not accessible in structures of survivin dimer, survivin-borealin and survivin-borealin-INCEP complexes.

References

[1]. "The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function."
Knauer SK, Bier C, Habtemichael N, Stauber RH (2006) EMBO Rep, 7:1259-65 PubMed
[2]. "Nuclear export is essential for the tumor-promoting activity of survivin."
Knauer SK, Kramer OH, Knosel T, Engels K, Rodel F, Kovacs AF, Dietmaier W, Klein-Hitpass L, Habtemichael N, Schweitzer A, Brieger J, Rodel C, Mann W, Petersen I, Heinzel T, Stauber RH (2007) FASEB J, 21:207-16 PubMed
[3]. "CRM1-mediated nuclear export determines the cytoplasmic localization of the antiapoptotic protein Survivin."
Rodriguez JA, Span SW, Ferreira CG, Kruyt FA, Giaccone G (2002) Exp Cell Res, 275:44-53 PubMed
[4]. "Separating the anti-apoptotic and mitotic roles of survivin."
Colnaghi R, Connell CM, Barrett RM, Wheatley SP (2006) J Biol Chem, 281:33450-6 PubMed
[5]. "Homodimerization antagonizes nuclear export of survivin."
Engelsma D, Rodriguez JA, Fish A, Giaccone G, Fornerod M (2007) Traffic, 8:1495-502 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©