NESdb

Summary for Rex Protein (NES ID: 13)

Full Name

Rex Protein UniProt

Alternative Names

Rex-1
p27Rex
Rev homolog

Organism

Human T-cell leukemia virus type 1 (HTLV-1)

Experimental Evidence for CRM1-mediated Export

Binds CRM1, Inhibit or inhibited by other CRM1 cargos ^{Ref.2Inhibition of human immunodeficiency virus Rev and human T-cell leukemia virus Rex function, but not Mason-Pfizer monkey virus constitutive transport element activity, by a mutant human nucleoporin targeted to Crm1., Bogerd et al., J Virol, 1998} ^{Ref.3Involvement of human CRM1 (exportin 1) in the export and multimerization of the Rex protein of human T-cell leukemia virus type 1., Hakata et al., J Virol, 1998}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L90A/L92A ^{Ref.1Protein sequence requirements for function of the human T-cell leukemia virus type 1 Rex nuclear export signal delineated by a novel in vivo randomization-selection assay, Bogerd et al., Mol Cell Biol, 1996}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

⁸¹ALSAQLYSSLSLDS⁹⁴ ^{Ref.1Protein sequence requirements for function of the human T-cell leukemia virus type 1 Rex nuclear export signal delineated by a novel in vivo randomization-selection assay, Bogerd et al., Mol Cell Biol, 1996}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|117940145|sp|P0C205.1|REX_HTL1A RecName: Full=Protein Rex; AltName: Full=Rev homolog; AltName: Full=Rex-1; AltName: Full=p27Rex
MPKTRRRPRRSQRKRPPTPWPTSQGLDRVFFSDTQSTCLETVYKATGAPSLGDYVRPAYIVTPYWPPVQS
IRSPGTPSMDALSAQLYSSLSLDSPPSPPREPLRPSRSLPRQSLIQPPTFHPPSSRPCANTPPSEMDTWN
PPLGSTSQPCLFQTPDSGPKTCTPSGEAPLSACTSTSFPPPSPGPSCPT

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 998889998988889999999988999866678887521101134689998987798634
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MPKTRRRPRRSQRKRPPTPWPTSQGLDRVFFSDTQSTCLETVYKATGAPSLGDYVRPAYI
              10        20        30        40        50        60


Conf: 799999978899999998874101002688899999999999999999999998899988
Pred: CCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: VTPYWPPVQSIRSPGTPSMDALSAQLYSSLSLDSPPSPPREPLRPSRSLPRQSLIQPPTF
              70        80        90       100       110       120


Conf: 999999999999999998999999999998889899999889999999988788899999
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: HPPSSRPCANTPPSEMDTWNPPLGSTSQPCLFQTPDSGPKTCTPSGEAPLSACTSTSFPP
             130       140       150       160       170       180


Conf: 999999999
Pred: CCCCCCCCC
  AA: PSPGPSCPT

Show Conservation Score by AL2CO

1     M      -1.000    *
2     P      -1.000    *
3     K      -1.000    *
4     T      -1.000    *
5     R      -1.000    *
6     R      -1.000    *
7     R      -1.000    *
8     P      -1.000    *
9     R      -1.000    *
10    R      -1.000    *
11    S      -1.000    *
12    Q      -1.000    *
13    R      -1.000    *
14    K      -1.000    *
15    R      -1.000    *
16    P      -1.000    *
17    P      -1.000    *
18    T      -1.000    *
19    P      -1.000    *
20    W      -1.108
21    P       1.573
22    T      -1.135
23    S       2.217
24    Q       0.498
25    G      -1.194
26    L      -0.688
27    D       0.004
28    R      -0.638
29    V      -0.388
30    F       0.269
31    F      -0.345
32    S      -0.077
33    D      -0.509
34    T       0.224
35    Q      -0.381
36    S      -0.222
37    T      -1.086
38    C      -1.123
39    L      -0.022
40    E      -0.499
41    T      -0.850
42    V      -0.219
43    Y      -0.221
44    K      -0.783
45    A       0.375
46    T      -0.684
47    G      -0.500
48    A      -0.074
49    P       3.342
50    S      -0.064
51    L      -0.864
52    G       0.202
53    D      -0.735
54    Y       0.579
55    V       0.986
56    R       1.490
57    P       0.202
58    A       0.543
59    Y       0.693
60    I       0.438
61    V      -0.790
62    T      -0.006
63    P       1.676
64    Y      -1.349
65    W       0.010
66    P       0.691
67    P       0.071
68    V      -0.038
69    Q      -0.774
70    S      -0.344
71    I      -0.925
72    R      -0.969
73    S       0.012
74    P       2.416
75    G       0.137
76    T       1.242
77    P       3.342
78    S      -0.369
79    M       0.633
80    D       0.108
81    A      -0.247
82    L      -0.353
83    S       2.391
84    A       0.461
85    Q      -1.536
86    L       0.362
87    Y       0.475
88    S      -0.693
89    S       0.112
90    L      -0.300
91    S       0.633
92    L      -1.382
93    D      -0.790
94    S       1.681
95    P       1.750
96    P       0.198
97    S       1.598
98    P       1.378
99    P      -0.605
100   R      -1.022
101   E       0.654
102   P       0.192
103   L      -0.269
104   R      -0.417
105   P       1.060
106   S       0.154
107   R       0.147
108   S       0.040
109   L       0.330
110   P       0.977
111   R      -1.300
112   Q       0.030
113   S       1.754
114   L      -0.855
115   I      -0.412
116   Q       0.174
117   P       3.342
118   P       2.416
119   T      -1.031
120   F       0.661
121   H      -0.926
122   P       0.977
123   P       0.318
124   S       0.870
125   S      -0.396
126   R      -1.136
127   P      -0.555
128   C      -1.501
129   A      -1.287
130   N      -1.053
131   T      -0.275
132   P       0.002
133   P      -0.629
134   S      -1.007
135   E      -1.380
136   M      -1.057
137   D      -1.374
138   T      -0.793
139   W      -0.804
140   N       0.533
141   P       0.994
142   P      -0.221
143   L      -0.640
144   G      -0.517
145   S      -1.275
146   T      -0.106
147   S      -0.160
148   Q       0.125
149   P       0.604
150   C      -0.966
151   L      -1.181
152   F      -0.441
153   Q      -0.360
154   T       0.598
155   P       0.768
156   D      -1.122
157   S      -0.122
158   G      -1.056
159   P       0.937
160   K      -1.020
161   T      -0.605
162   C      -0.955
163   T      -1.234
164   P      -0.958
165   S       1.102
166   G       0.085
167   E       0.031
168   A      -0.245
169   P       1.682
170   L      -1.023
171   S       0.065
172   A       0.465
173   C      -0.642
174   T       1.122
175   S       1.351
176   T       0.184
177   S      -1.019
178   F      -0.195
179   P      -0.221
180   P       1.202
181   P      -1.725
182   S       0.384
183   P       1.553
184   G       0.470
185   P      -1.000    *
186   S      -1.000    *
187   C      -1.000    *
188   P      -1.000    *
189   T      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 13.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MPKTRRRPRR SQRKRPPTPW PTSQGLDRVF FSDTQSTCLE TVYKATGAPS LGDYVRPAYI 
        70         80         90        100        110        120 
VTPYWPPVQS IRSPGTPSMD ALSAQLYSSL SLDSPPSPPR EPLRPSRSLP RQSLIQPPTF 
       130        140        150        160        170        180 HPPSSRPCAN TPPSEMDTWN PPLGSTSQPC LFQTPDSGPK TCTPSGEAPL SACTSTSFPP 
                                                                  PSPGPSCPT

3D Structures in PDB

Not Available

Comments

Rex, like Rev, is an essential posttranscriptional regulatory protein, that induces the export of the incompletely spliced viral mRNA in HTLV-1. AA 81-94 is considered independent NES for export IgG and GST. In addition, Rex binds to CRM1 in a two-hybrid interaction assay with human CRM1. Overexpression of CRM1 also promotes export of Rex. Rex export was shown to be inhibited by δCAN, which blocks CRM1 activity.

References

[1]. "Protein sequence requirements for function of the human T-cell leukemia virus type 1 Rex nuclear export signal delineated by a novel in vivo randomization-selection assay"
Bogerd, H.P., Fridell, R.A., Benson, R.E., Hua, J., Cullen, B.R. (1996) Mol Cell Biol, 16:4207-4214 PubMed
[2]. "Inhibition of human immunodeficiency virus Rev and human T-cell leukemia virus Rex function, but not Mason-Pfizer monkey virus constitutive transport element activity, by a mutant human nucleoporin targeted to Crm1."
Bogerd HP, Echarri A, Ross TM, Cullen BR (1998) J Virol, 72:8627-35 PubMed
[3]. "Involvement of human CRM1 (exportin 1) in the export and multimerization of the Rex protein of human T-cell leukemia virus type 1."
Hakata Y, Umemoto T, Matsushita S, Shida H (1998) J Virol, 72:6602-7 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©