NESdb

Apoptin UniProt

None

Chicken anemia virus

LMB Sensitive ^{Ref.1Apoptin nuclear accumulation is modulated by a CRM1-recognized nuclear export signal that is active in normal but not in tumor cells., Poon et al., Cancer Res, 2005}

*highlighted yellow in the full sequence

L104A/I105A ^{Ref.1Apoptin nuclear accumulation is modulated by a CRM1-recognized nuclear export signal that is active in normal but not in tumor cells., Poon et al., Cancer Res, 2005}

Unknown

Undetermined

Unknown

Show FASTA Format

>gi|1722773|sp|Q99152.1|VP3_CAVC1 RecName: Full=Apoptin
MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCANARAPTLRSATADNSESTGF
KNVPDLRTDQPKPPSKKRSCDPSEYRVSELKESLITTTPSRPRTAKRRIRL

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 975667899999520049999999999701068984202499960266210013410122
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCC
  AA: MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCANARAPTLRSA
              10        20        30        40        50        60


Conf: 268887765655788988899999998878987112222001312318899500001113
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCEEECCCCCCHHHHCCCC
  AA: TADNSESTGFKNVPDLRTDQPKPPSKKRSCDPSEYRVSELKESLITTTPSRPRTAKRRIR
              70        80        90       100       110       120


Conf: 9
Pred: C
  AA: L

Show Conservation Score by AL2CO

1     M      -1.000    *
2     N      -1.000    *
3     A      -1.000    *
4     L      -1.000    *
5     Q      -1.000    *
6     E      -1.000    *
7     D      -1.000    *
8     T       1.496
9     P      -0.896
10    P       0.063
11    G       0.037
12    P      -0.896
13    S       1.496
14    T       0.055
15    V      -0.896
16    F       0.063
17    R       0.018
18    P      -0.866
19    P       0.118
20    T       0.115
21    S       0.118
22    S       1.496
23    R       0.084
24    P       0.115
25    L      -0.848
26    E      -0.848
27    T      -0.848
28    P       0.084
29    H      -0.847
30    C      -0.011
31    R      -0.848
32    E       1.496
33    I       1.496
34    R      -0.866
35    I       1.496
36    G       1.496
37    I      -0.011
38    A       0.084
39    G       0.084
40    I      -0.866
41    T      -0.011
42    I       1.496
43    T       0.118
44    L       0.115
45    S       1.496
46    L       1.496
47    C       0.084
48    G       1.496
49    C      -0.847
50    A       1.496
51    N      -0.866
52    A       0.084
53    R       1.496
54    A       0.084
55    P       0.084
56    T       1.496
57    L       0.084
58    R       1.496
59    S       1.496
60    A       1.496
61    T       0.116
62    A       1.496
63    D       0.115
64    N      -1.522
65    S      -0.010
66    E      -0.847
67    S      -1.522
68    T       1.496
69    G       1.496
70    F       0.084
71    K       0.084
72    N      -0.866
73    V      -1.522
74    P      -1.522
75    D       1.496
76    L       0.115
77    R      -0.847
78    T      -0.011
79    D       0.018
80    Q       0.018
81    P       1.496
82    K       0.018
83    P      -0.011
84    P      -0.866
85    S      -0.828
86    K      -0.866
87    K      -0.866
88    R      -0.011
89    S      -0.866
90    C      -1.522
91    D      -1.522
92    P      -0.847
93    S      -1.522
94    E      -1.522
95    Y      -1.522
96    R      -1.522
97    V      -0.011
98    S      -1.522
99    E      -0.866
100   L       0.084
101   K       1.496
102   E       1.496
103   S       0.084
104   L       0.115
105   I       1.496
106   T       1.496
107   T      -0.848
108   T      -0.011
109   P      -0.896
110   S      -0.896
111   R      -0.896
112   P       0.055
113   R       0.018
114   T      -1.522
115   A      -1.522
116   K       1.496
117   R       0.116
118   R       0.055
119   I       0.036
120   R      -1.000    *
121   L      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 134.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MNALQEDTPP GPSTVFRPPT SSRPLETPHC REIRIGIAGI TITLSLCGCA NARAPTLRSA 
        70         80         90        100        110        120 
TADNSESTGF KNVPDLRTDQ PKPPSKKRSC DPSEYRVSEL KESLITTTPS RPRTAKRRIR 
                                                                  L

Not Available

Apoptin possesses tumor cell-specific proapoptotic activity, which is linked to its ability to localized in the nucleus of transformed cells. The protein harbors two NLSs and one NES, which can be regulated by the phosphorylation of T108. Notably, a leucine-rich sequence (aa 33-46) is not a NES. Instead, it promotes nuclear accumulation.

[1]. "Apoptin nuclear accumulation is modulated by a CRM1-recognized nuclear export signal that is active in normal but not in tumor cells."
Poon IK, Oro C, Dias MM, Zhang J, Jans DA (2005) Cancer Res, 65:7059-64 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©